BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040L16

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801460.1|  PREDICTED: pentatricopeptide repeat-containi...    374   1e-122   Nicotiana sylvestris
emb|CBI27495.3|  unnamed protein product                                371   2e-122   Vitis vinifera
ref|XP_004237182.2|  PREDICTED: pentatricopeptide repeat-containi...    374   2e-122   Solanum lycopersicum
ref|XP_002269531.1|  PREDICTED: pentatricopeptide repeat-containi...    371   8e-122   Vitis vinifera
emb|CBI24106.3|  unnamed protein product                                369   1e-121   Vitis vinifera
ref|XP_009601923.1|  PREDICTED: pentatricopeptide repeat-containi...    371   1e-121   Nicotiana tomentosiformis
emb|CDP07966.1|  unnamed protein product                                370   3e-121   Coffea canephora [robusta coffee]
ref|XP_002273494.2|  PREDICTED: pentatricopeptide repeat-containi...    368   9e-121   Vitis vinifera
ref|XP_010270795.1|  PREDICTED: pentatricopeptide repeat-containi...    367   4e-120   Nelumbo nucifera [Indian lotus]
ref|XP_011021682.1|  PREDICTED: pentatricopeptide repeat-containi...    353   3e-117   Populus euphratica
ref|XP_002314741.2|  hypothetical protein POPTR_0010s10900g             354   2e-115   
ref|XP_011021681.1|  PREDICTED: pentatricopeptide repeat-containi...    353   1e-114   Populus euphratica
ref|XP_006470889.1|  PREDICTED: pentatricopeptide repeat-containi...    352   1e-114   Citrus sinensis [apfelsine]
ref|XP_006420692.1|  hypothetical protein CICLE_v10004581mg             352   1e-114   Citrus clementina [clementine]
gb|KDO57832.1|  hypothetical protein CISIN_1g007461mg                   351   5e-114   Citrus sinensis [apfelsine]
ref|XP_007015128.1|  Pentatricopeptide repeat superfamily protein...    349   2e-113   
gb|KDP38220.1|  hypothetical protein JCGZ_04863                         342   3e-113   Jatropha curcas
gb|KJB35742.1|  hypothetical protein B456_006G126500                    340   6e-112   Gossypium raimondii
ref|XP_004151188.1|  PREDICTED: pentatricopeptide repeat-containi...    345   1e-111   Cucumis sativus [cucumbers]
ref|XP_004172063.1|  PREDICTED: pentatricopeptide repeat-containi...    345   1e-111   
ref|XP_008465506.1|  PREDICTED: pentatricopeptide repeat-containi...    344   2e-111   Cucumis melo [Oriental melon]
ref|XP_011090005.1|  PREDICTED: pentatricopeptide repeat-containi...    344   3e-111   Sesamum indicum [beniseed]
gb|KJB35743.1|  hypothetical protein B456_006G126500                    340   3e-110   Gossypium raimondii
ref|XP_010043883.1|  PREDICTED: pentatricopeptide repeat-containi...    341   3e-110   Eucalyptus grandis [rose gum]
ref|XP_007222296.1|  hypothetical protein PRUPE_ppa003348mg             335   5e-108   
gb|KHN38588.1|  Pentatricopeptide repeat-containing protein, chlo...    334   2e-107   Glycine soja [wild soybean]
gb|EYU36097.1|  hypothetical protein MIMGU_mgv1a020159mg                333   2e-107   Erythranthe guttata [common monkey flower]
ref|XP_003529243.2|  PREDICTED: pentatricopeptide repeat-containi...    334   2e-107   Glycine max [soybeans]
ref|XP_010668078.1|  PREDICTED: pentatricopeptide repeat-containi...    333   4e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008220989.1|  PREDICTED: pentatricopeptide repeat-containi...    333   4e-107   Prunus mume [ume]
ref|XP_008778816.1|  PREDICTED: pentatricopeptide repeat-containi...    332   2e-106   Phoenix dactylifera
ref|XP_003555735.1|  PREDICTED: pentatricopeptide repeat-containi...    331   2e-106   Glycine max [soybeans]
ref|XP_002521865.1|  pentatricopeptide repeat-containing protein,...    326   3e-106   
ref|XP_006420695.1|  hypothetical protein CICLE_v10006779mg             323   8e-106   
ref|XP_007153172.1|  hypothetical protein PHAVU_003G013000g             329   2e-105   Phaseolus vulgaris [French bean]
ref|XP_009351650.1|  PREDICTED: pentatricopeptide repeat-containi...    328   4e-105   Pyrus x bretschneideri [bai li]
ref|XP_004298632.1|  PREDICTED: pentatricopeptide repeat-containi...    327   7e-105   Fragaria vesca subsp. vesca
ref|XP_008340510.1|  PREDICTED: pentatricopeptide repeat-containi...    325   7e-104   Malus domestica [apple tree]
ref|XP_009400607.1|  PREDICTED: pentatricopeptide repeat-containi...    325   9e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006853735.1|  hypothetical protein AMTR_s00056p00173630          318   3e-101   Amborella trichopoda
dbj|BAB10598.1|  unnamed protein product                                314   3e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25604.1|  hypothetical protein AALP_AA8G136200                    315   3e-100   Arabis alpina [alpine rockcress]
ref|XP_004498165.1|  PREDICTED: pentatricopeptide repeat-containi...    315   9e-100   Cicer arietinum [garbanzo]
ref|NP_196881.2|  pentatricopeptide repeat-containing protein           314   9e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547300.1|  PREDICTED: pentatricopeptide repeat-containi...    313   2e-99    Tarenaya hassleriana [spider flower]
ref|XP_006576030.1|  PREDICTED: pentatricopeptide repeat-containi...    301   3e-99    Glycine max [soybeans]
ref|XP_010492155.1|  PREDICTED: pentatricopeptide repeat-containi...    313   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_006289562.1|  hypothetical protein CARUB_v10003108mg             312   6e-99    Capsella rubella
gb|KHN48767.1|  Pentatricopeptide repeat-containing protein, chlo...    299   6e-99    Glycine soja [wild soybean]
ref|XP_002871585.1|  pentatricopeptide repeat-containing protein        311   8e-99    Arabidopsis lyrata subsp. lyrata
emb|CDX91096.1|  BnaC02g05010D                                          311   1e-98    
ref|XP_010453475.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    311   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006399876.1|  hypothetical protein EUTSA_v10016019mg             311   2e-98    Eutrema salsugineum [saltwater cress]
ref|XP_009125945.1|  PREDICTED: pentatricopeptide repeat-containi...    311   2e-98    Brassica rapa
gb|KEH40726.1|  PPR containing plant-like protein                       310   5e-98    Medicago truncatula
gb|ABK95746.1|  unknown                                                 295   1e-97    Populus trichocarpa [western balsam poplar]
ref|XP_011025175.1|  PREDICTED: pentatricopeptide repeat-containi...    305   4e-96    Populus euphratica
ref|XP_002312498.2|  hypothetical protein POPTR_0008s14240g             304   6e-96    
ref|XP_008350824.1|  PREDICTED: pentatricopeptide repeat-containi...    298   7e-94    
emb|CCI55317.1|  PH01B001I13.13                                         296   2e-92    Phyllostachys edulis [kikko-chiku]
gb|EAY95290.1|  hypothetical protein OsI_17116                          291   8e-91    Oryza sativa Indica Group [Indian rice]
ref|NP_001174064.1|  Os04g0583150                                       291   9e-91    
ref|NP_001142291.1|  uncharacterized protein LOC100274460               283   6e-90    Zea mays [maize]
gb|EMT31983.1|  hypothetical protein F775_29312                         288   1e-89    
ref|XP_006652694.1|  PREDICTED: pentatricopeptide repeat-containi...    284   3e-88    Oryza brachyantha
gb|ACG27989.1|  hypothetical protein                                    284   4e-88    Zea mays [maize]
ref|XP_003580383.1|  PREDICTED: pentatricopeptide repeat-containi...    283   6e-88    Brachypodium distachyon [annual false brome]
tpg|DAA36322.1|  TPA: hypothetical protein ZEAMMB73_184989              282   1e-87    
ref|XP_004976594.1|  PREDICTED: pentatricopeptide repeat-containi...    282   2e-87    Setaria italica
gb|KDO42183.1|  hypothetical protein CISIN_1g044084mg                   249   1e-77    Citrus sinensis [apfelsine]
emb|CAN71209.1|  hypothetical protein VITISV_030057                     171   2e-50    Vitis vinifera
dbj|BAD95045.1|  putative protein                                       160   5e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783392.1|  predicted protein                                  170   1e-45    
gb|EPS59551.1|  hypothetical protein M569_15254                         148   3e-38    Genlisea aurea
ref|XP_009782000.1|  PREDICTED: pentatricopeptide repeat-containi...    127   6e-30    Nicotiana sylvestris
ref|XP_009781997.1|  PREDICTED: pentatricopeptide repeat-containi...    127   9e-30    Nicotiana sylvestris
ref|XP_009625746.1|  PREDICTED: pentatricopeptide repeat-containi...    124   6e-29    Nicotiana tomentosiformis
ref|XP_009625742.1|  PREDICTED: pentatricopeptide repeat-containi...    124   1e-28    Nicotiana tomentosiformis
ref|XP_004237581.1|  PREDICTED: pentatricopeptide repeat-containi...    116   8e-26    Solanum lycopersicum
emb|CDP08449.1|  unnamed protein product                                114   3e-25    Coffea canephora [robusta coffee]
dbj|BAK02704.1|  predicted protein                                      111   3e-25    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009792924.1|  PREDICTED: pentatricopeptide repeat-containi...    112   4e-25    Nicotiana sylvestris
ref|XP_011090170.1|  PREDICTED: pentatricopeptide repeat-containi...    114   5e-25    
ref|XP_009792923.1|  PREDICTED: pentatricopeptide repeat-containi...    112   5e-25    Nicotiana sylvestris
ref|XP_009593082.1|  PREDICTED: pentatricopeptide repeat-containi...    112   9e-25    
ref|XP_006338777.1|  PREDICTED: pentatricopeptide repeat-containi...    113   9e-25    
ref|XP_002971064.1|  hypothetical protein SELMODRAFT_95253              113   1e-24    
ref|XP_004233239.1|  PREDICTED: pentatricopeptide repeat-containi...    112   1e-24    Solanum lycopersicum
emb|CBI24234.3|  unnamed protein product                                111   2e-24    Vitis vinifera
emb|CAN63985.1|  hypothetical protein VITISV_001389                     112   2e-24    Vitis vinifera
ref|NP_001046025.1|  Os02g0170000                                       109   3e-24    
ref|NP_181058.1|  pentatricopeptide repeat-containing protein           110   3e-24    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002275790.2|  PREDICTED: pentatricopeptide repeat-containi...    111   3e-24    
ref|NP_001189682.1|  pentatricopeptide repeat-containing protein        110   3e-24    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509658.1|  PREDICTED: pentatricopeptide repeat-containi...    110   4e-24    
ref|XP_010494168.1|  PREDICTED: pentatricopeptide repeat-containi...    111   4e-24    
ref|XP_010505013.1|  PREDICTED: pentatricopeptide repeat-containi...    110   4e-24    Camelina sativa [gold-of-pleasure]
ref|XP_009353967.1|  PREDICTED: pentatricopeptide repeat-containi...    110   4e-24    
gb|KDO54847.1|  hypothetical protein CISIN_1g004758mg                   109   4e-24    Citrus sinensis [apfelsine]
ref|XP_009379098.1|  PREDICTED: pentatricopeptide repeat-containi...    110   4e-24    Pyrus x bretschneideri [bai li]
gb|AHC02079.1|  pentatricopeptide repeat-containing protein 123         108   5e-24    Aloysia peruviana
ref|XP_009353966.1|  PREDICTED: pentatricopeptide repeat-containi...    110   5e-24    Pyrus x bretschneideri [bai li]
ref|XP_010936410.1|  PREDICTED: pentatricopeptide repeat-containi...    110   6e-24    Elaeis guineensis
ref|XP_008370969.1|  PREDICTED: pentatricopeptide repeat-containi...    110   6e-24    
ref|XP_006446275.1|  hypothetical protein CICLE_v10017597mg             110   6e-24    Citrus clementina [clementine]
ref|XP_006365038.1|  PREDICTED: pentatricopeptide repeat-containi...    109   6e-24    Solanum tuberosum [potatoes]
ref|XP_011041249.1|  PREDICTED: pentatricopeptide repeat-containi...    110   7e-24    Populus euphratica
ref|XP_004172160.1|  PREDICTED: pentatricopeptide repeat-containi...    107   8e-24    
gb|AHX42025.1|  pentatricopeptide repeat-containing protein 11          106   8e-24    Campanula peregrina
ref|XP_002962027.1|  hypothetical protein SELMODRAFT_77588              110   8e-24    
gb|AHC02098.1|  pentatricopeptide repeat-containing protein 123         107   1e-23    Aloysia polygalifolia
gb|KDO54845.1|  hypothetical protein CISIN_1g004758mg                   109   1e-23    Citrus sinensis [apfelsine]
ref|XP_006470579.1|  PREDICTED: pentatricopeptide repeat-containi...    109   2e-23    
ref|XP_002306972.1|  hypothetical protein POPTR_0005s27160g             109   2e-23    Populus trichocarpa [western balsam poplar]
gb|AFK37759.1|  unknown                                                 107   2e-23    Lotus japonicus
ref|XP_010052528.1|  PREDICTED: pentatricopeptide repeat-containi...    108   2e-23    Eucalyptus grandis [rose gum]
gb|EMT10539.1|  Pentatricopeptide repeat-containing protein             109   2e-23    
gb|AHC02090.1|  pentatricopeptide repeat-containing protein 123         106   2e-23    Aloysia gratissima
gb|ACU25764.1|  pentatricopeptide repeat-containing protein             107   2e-23    Dipyrena glaberrima
gb|AHC02095.1|  pentatricopeptide repeat-containing protein 123         106   2e-23    Aloysia looseri
gb|AHC02101.1|  pentatricopeptide repeat-containing protein 123         106   2e-23    Aloysia scorodonioides
ref|XP_003610900.1|  Pentatricopeptide repeat-containing protein        110   2e-23    Medicago truncatula
emb|CDP11249.1|  unnamed protein product                                108   2e-23    Coffea canephora [robusta coffee]
gb|EAZ21897.1|  hypothetical protein OsJ_05550                          108   2e-23    Oryza sativa Japonica Group [Japonica rice]
gb|AHC02085.1|  pentatricopeptide repeat-containing protein 123         106   2e-23    Aloysia chamaedryfolia
gb|AHC02103.1|  pentatricopeptide repeat-containing protein 123         106   2e-23    Aloysia scorodonioides
ref|XP_002528160.1|  pentatricopeptide repeat-containing protein,...    108   2e-23    
gb|AHC02088.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia dusenii
gb|AHC02080.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia axillaris
gb|AHC02107.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia wrightii
gb|AHC02084.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia chamaedryfolia
gb|AHC02096.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia lycioides
gb|AHC02100.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia pulchra
gb|AHC02091.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia gratissima
gb|AHC02097.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia macrostachya
gb|EEC72578.1|  hypothetical protein OsI_06020                          108   3e-23    Oryza sativa Indica Group [Indian rice]
gb|AHC02106.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia wrightii
gb|AFV61114.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia lycioides
gb|ACU25763.1|  pentatricopeptide repeat-containing protein             106   3e-23    Aloysia virgata
ref|XP_010252754.1|  PREDICTED: pentatricopeptide repeat-containi...    108   3e-23    Nelumbo nucifera [Indian lotus]
gb|AHC02105.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia scorodonioides
gb|AHC02087.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia dusenii
gb|AHC02092.1|  pentatricopeptide repeat-containing protein 123         105   3e-23    Aloysia pulchra
gb|AHC02102.1|  pentatricopeptide repeat-containing protein 123         106   3e-23    Aloysia virgata
ref|XP_010442157.1|  PREDICTED: pentatricopeptide repeat-containi...    108   4e-23    Camelina sativa [gold-of-pleasure]
ref|XP_007213618.1|  hypothetical protein PRUPE_ppa002169mg             108   4e-23    Prunus persica
ref|XP_008224621.1|  PREDICTED: pentatricopeptide repeat-containi...    108   4e-23    Prunus mume [ume]
gb|AHC02094.1|  pentatricopeptide repeat-containing protein 123         105   4e-23    Aloysia hatschbachii
ref|XP_008459028.1|  PREDICTED: pentatricopeptide repeat-containi...    107   5e-23    Cucumis melo [Oriental melon]
gb|AHX42072.1|  pentatricopeptide repeat-containing protein 11          104   5e-23    Musschia aurea
ref|XP_010648592.1|  PREDICTED: pentatricopeptide repeat-containi...    106   5e-23    Vitis vinifera
gb|AFV61154.1|  pentatricopeptide repeat-containing protein 123         105   5e-23    Xeroaloysia ovatifolia
ref|XP_002865541.1|  pentatricopeptide repeat-containing protein        107   6e-23    Arabidopsis lyrata subsp. lyrata
dbj|BAB10204.1|  maize crp1 protein-like                                107   6e-23    Arabidopsis thaliana [mouse-ear cress]
gb|ACU25762.1|  pentatricopeptide repeat-containing protein             105   6e-23    Xeroaloysia ovatifolia
ref|XP_008790326.1|  PREDICTED: pentatricopeptide repeat-containi...    107   6e-23    
ref|XP_001777347.1|  predicted protein                                  107   6e-23    
ref|XP_010509657.1|  PREDICTED: pentatricopeptide repeat-containi...    107   6e-23    Camelina sativa [gold-of-pleasure]
ref|XP_002451617.1|  hypothetical protein SORBIDRAFT_04g004710          107   6e-23    
ref|XP_006295537.1|  hypothetical protein CARUB_v10024643mg             107   6e-23    
ref|NP_199046.1|  pentatricopeptide repeat-containing protein           107   6e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007211547.1|  hypothetical protein PRUPE_ppa004057mg             106   6e-23    
gb|ACN28178.1|  unknown                                                 107   6e-23    Zea mays [maize]
gb|KFK32934.1|  hypothetical protein AALP_AA6G308200                    107   7e-23    Arabis alpina [alpine rockcress]
gb|AHC02093.1|  pentatricopeptide repeat-containing protein 123         105   7e-23    Aloysia oblanceolata
gb|AFV61115.1|  pentatricopeptide repeat-containing protein 123         105   7e-23    Aloysia macrostachya
gb|AFV61116.1|  pentatricopeptide repeat-containing protein 123         105   7e-23    Aloysia virgata
ref|XP_006279580.1|  hypothetical protein CARUB_v10025981mg             107   7e-23    Capsella rubella
ref|XP_004145440.1|  PREDICTED: pentatricopeptide repeat-containi...    106   8e-23    Cucumis sativus [cucumbers]
ref|XP_010094587.1|  hypothetical protein L484_024883                   107   8e-23    
emb|CDX84260.1|  BnaC04g10220D                                          107   8e-23    
gb|AFV61120.1|  pentatricopeptide repeat-containing protein 123         104   1e-22    Lantana camara
gb|EEC80183.1|  hypothetical protein OsI_22045                          106   1e-22    Oryza sativa Indica Group [Indian rice]
gb|AFV61146.1|  pentatricopeptide repeat-containing protein 123         104   1e-22    Lippia rhodocnemis
gb|KDP36804.1|  hypothetical protein JCGZ_08095                         107   1e-22    Jatropha curcas
ref|XP_006473770.1|  PREDICTED: pentatricopeptide repeat-containi...    107   1e-22    Citrus sinensis [apfelsine]
gb|KDP26340.1|  hypothetical protein JCGZ_22312                         106   1e-22    Jatropha curcas
ref|XP_010648584.1|  PREDICTED: pentatricopeptide repeat-containi...    106   1e-22    Vitis vinifera
ref|XP_006605878.1|  PREDICTED: pentatricopeptide repeat-containi...    106   1e-22    Glycine max [soybeans]
ref|XP_008790496.1|  PREDICTED: pentatricopeptide repeat-containi...    104   1e-22    
ref|XP_007157017.1|  hypothetical protein PHAVU_002G036500g             107   1e-22    Phaseolus vulgaris [French bean]
ref|XP_006435342.1|  hypothetical protein CICLE_v10000451mg             107   1e-22    Citrus clementina [clementine]
emb|CBI27156.3|  unnamed protein product                                106   1e-22    Vitis vinifera
gb|AFV61121.1|  pentatricopeptide repeat-containing protein 123         104   1e-22    Lantana cujabensis
gb|AFV61141.1|  pentatricopeptide repeat-containing protein 123         104   1e-22    Lippia macrophylla
ref|XP_003555869.1|  PREDICTED: pentatricopeptide repeat-containi...    105   1e-22    Glycine max [soybeans]
gb|KHN08489.1|  Pentatricopeptide repeat-containing protein             104   1e-22    Glycine soja [wild soybean]
ref|XP_010276204.1|  PREDICTED: pentatricopeptide repeat-containi...    105   1e-22    Nelumbo nucifera [Indian lotus]
ref|XP_010246501.1|  PREDICTED: pentatricopeptide repeat-containi...    107   1e-22    
gb|AFV61125.1|  pentatricopeptide repeat-containing protein 123         104   2e-22    Lantana micrantha
gb|AFV61133.1|  pentatricopeptide repeat-containing protein 123         103   2e-22    Lippia brasiliensis
gb|ACU25737.1|  pentatricopeptide repeat-containing protein             104   2e-22    Verbena macdougalii [New Mexico vervain]
ref|XP_006405260.1|  hypothetical protein EUTSA_v10027665mg             106   2e-22    Eutrema salsugineum [saltwater cress]
gb|AFV61123.1|  pentatricopeptide repeat-containing protein 123         104   2e-22    Lantana urticoides
ref|XP_008347337.1|  PREDICTED: pentatricopeptide repeat-containi...    105   2e-22    
gb|AIU48580.1|  tetratricopeptide repeat-like superfamily protein       104   2e-22    Houttuynia cordata [chameleon-plant]
ref|XP_002510663.1|  pentatricopeptide repeat-containing protein,...    106   2e-22    Ricinus communis
ref|XP_008377072.1|  PREDICTED: pentatricopeptide repeat-containi...    106   2e-22    
ref|NP_001144813.1|  uncharacterized protein LOC100277891               105   2e-22    
ref|XP_006594568.1|  PREDICTED: pentatricopeptide repeat-containi...    104   2e-22    Glycine max [soybeans]
ref|XP_011459077.1|  PREDICTED: pentatricopeptide repeat-containi...    105   2e-22    Fragaria vesca subsp. vesca
ref|XP_002456617.1|  hypothetical protein SORBIDRAFT_03g039460          103   2e-22    Sorghum bicolor [broomcorn]
emb|CAN70089.1|  hypothetical protein VITISV_038171                     106   2e-22    Vitis vinifera
ref|XP_010227899.1|  PREDICTED: pentatricopeptide repeat-containi...    107   2e-22    Brachypodium distachyon [annual false brome]
gb|ACU25760.1|  pentatricopeptide repeat-containing protein             103   2e-22    Phyla dulcis
gb|KHN33805.1|  Pentatricopeptide repeat-containing protein, mito...    104   2e-22    Glycine soja [wild soybean]
ref|XP_007154040.1|  hypothetical protein PHAVU_003G086100g             105   2e-22    Phaseolus vulgaris [French bean]
gb|AFV61110.1|  pentatricopeptide repeat-containing protein 123         103   3e-22    Acantholippia seriphioides
gb|KJB61767.1|  hypothetical protein B456_009G379200                    105   3e-22    Gossypium raimondii
gb|KJB69895.1|  hypothetical protein B456_011G048600                    105   3e-22    Gossypium raimondii
gb|AHX42061.1|  pentatricopeptide repeat-containing protein 11          102   3e-22    Campanula lactiflora
ref|XP_006838107.1|  hypothetical protein AMTR_s00106p00044940          106   3e-22    Amborella trichopoda
ref|XP_004497161.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-22    Cicer arietinum [garbanzo]
ref|XP_002438011.1|  hypothetical protein SORBIDRAFT_10g006490          106   3e-22    
gb|EYU43675.1|  hypothetical protein MIMGU_mgv1a006780mg                103   3e-22    Erythranthe guttata [common monkey flower]
gb|KHN42271.1|  Pentatricopeptide repeat-containing protein, chlo...    105   3e-22    Glycine soja [wild soybean]
ref|XP_006584099.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-22    Glycine max [soybeans]
ref|XP_010670642.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-22    
ref|XP_007051141.1|  S uncoupled 1                                      105   3e-22    Theobroma cacao [chocolate]
gb|AFV61117.1|  pentatricopeptide repeat-containing protein 123         102   3e-22    Burroughsia fastigiata
ref|XP_009411130.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-22    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006856269.1|  hypothetical protein AMTR_s00047p00074820          105   3e-22    
ref|XP_010941649.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-22    Elaeis guineensis
gb|AFV61149.1|  pentatricopeptide repeat-containing protein 123         103   3e-22    Lippia salviifolia
gb|EEE65260.1|  hypothetical protein OsJ_20463                          106   4e-22    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009408746.1|  PREDICTED: pentatricopeptide repeat-containi...    105   4e-22    
gb|AHC02089.1|  pentatricopeptide repeat-containing protein 123         103   4e-22    Aloysia herrerae
gb|ACU25758.1|  pentatricopeptide repeat-containing protein             102   4e-22    Mulguraea scoparia
ref|XP_009602284.1|  PREDICTED: pentatricopeptide repeat-containi...    105   4e-22    Nicotiana tomentosiformis
gb|ACU25753.1|  pentatricopeptide repeat-containing protein             102   4e-22    Glandularia incisa
gb|AFV61137.1|  pentatricopeptide repeat-containing protein 123         102   4e-22    Lippia hederifolia
ref|NP_001057065.1|  Os06g0199100                                       106   4e-22    
emb|CDX71562.1|  BnaC04g17970D                                          105   4e-22    
gb|KHN35111.1|  Pentatricopeptide repeat-containing protein, chlo...    106   4e-22    Glycine soja [wild soybean]
gb|AFV61151.1|  pentatricopeptide repeat-containing protein 123         102   4e-22    Lippia velutina
gb|AFV61113.1|  pentatricopeptide repeat-containing protein 123         103   4e-22    Aloysia herrerae
ref|XP_004293389.1|  PREDICTED: pentatricopeptide repeat-containi...    105   5e-22    Fragaria vesca subsp. vesca
ref|XP_006491812.1|  PREDICTED: pentatricopeptide repeat-containi...    105   5e-22    Citrus sinensis [apfelsine]
gb|AHC02104.1|  pentatricopeptide repeat-containing protein 123         102   5e-22    Aloysia sonorensis
gb|EMS45043.1|  hypothetical protein TRIUR3_16364                       103   5e-22    Triticum urartu
ref|XP_006590462.1|  PREDICTED: pentatricopeptide repeat-containi...    105   5e-22    Glycine max [soybeans]
gb|AFV61153.1|  pentatricopeptide repeat-containing protein 123         102   5e-22    Phyla nodiflora
ref|XP_006491807.1|  PREDICTED: pentatricopeptide repeat-containi...    105   5e-22    Citrus sinensis [apfelsine]
gb|AFV61136.1|  pentatricopeptide repeat-containing protein 123         102   5e-22    Lippia filifolia
gb|AFV61150.1|  pentatricopeptide repeat-containing protein 123         102   5e-22    Lippia turbinata
ref|XP_003523110.1|  PREDICTED: pentatricopeptide repeat-containi...    104   6e-22    Glycine max [soybeans]
gb|AFV61119.1|  pentatricopeptide repeat-containing protein 123         102   6e-22    Junellia succulentifolia
gb|ACU25749.1|  pentatricopeptide repeat-containing protein             102   6e-22    Glandularia araucana
gb|AFV61147.1|  pentatricopeptide repeat-containing protein 123         102   6e-22    Lippia rotundifolia
ref|XP_010481999.1|  PREDICTED: pentatricopeptide repeat-containi...    104   6e-22    Camelina sativa [gold-of-pleasure]
gb|EMT18607.1|  hypothetical protein F775_09904                         103   6e-22    
gb|KJB61828.1|  hypothetical protein B456_009G384200                    105   6e-22    Gossypium raimondii
ref|XP_002975593.1|  hypothetical protein SELMODRAFT_103638             103   6e-22    
ref|XP_006577943.1|  PREDICTED: pentatricopeptide repeat-containi...    104   6e-22    
ref|XP_007135119.1|  hypothetical protein PHAVU_010G102600g             103   6e-22    Phaseolus vulgaris [French bean]
gb|ACU25757.1|  pentatricopeptide repeat-containing protein             102   6e-22    Mulguraea asparagoides
gb|AFV61134.1|  pentatricopeptide repeat-containing protein 123         102   6e-22    Lippia diamantinensis
gb|KDP42575.1|  hypothetical protein JCGZ_24349                         103   6e-22    Jatropha curcas
ref|XP_004966645.1|  PREDICTED: pentatricopeptide repeat-containi...    105   6e-22    
ref|XP_010925750.1|  PREDICTED: pentatricopeptide repeat-containi...    104   6e-22    Elaeis guineensis
gb|AFV61138.1|  pentatricopeptide repeat-containing protein 123         102   7e-22    Lippia hermannioides
gb|AFV61135.1|  pentatricopeptide repeat-containing protein 123         102   7e-22    Lippia duartei
gb|ACU25736.1|  pentatricopeptide repeat-containing protein             102   7e-22    Verbena bracteata [creeping vervain]
ref|XP_008221147.1|  PREDICTED: pentatricopeptide repeat-containi...    104   7e-22    Prunus mume [ume]
gb|ACU25750.1|  pentatricopeptide repeat-containing protein             102   7e-22    Glandularia flava
ref|XP_006448704.1|  hypothetical protein CICLE_v10015335mg             102   7e-22    
ref|XP_008225832.1|  PREDICTED: pentatricopeptide repeat-containi...    103   7e-22    Prunus mume [ume]
gb|ACU25754.1|  pentatricopeptide repeat-containing protein             102   7e-22    Junellia spathulata
gb|ACU25741.1|  pentatricopeptide repeat-containing protein             102   7e-22    Verbena hastata [American blue vervain]
gb|AFV61118.1|  pentatricopeptide repeat-containing protein 123         102   7e-22    Coelocarpum swinglei
ref|XP_007142837.1|  hypothetical protein PHAVU_007G021100g             103   7e-22    Phaseolus vulgaris [French bean]
gb|ACU25748.1|  pentatricopeptide repeat-containing protein             102   7e-22    Glandularia microphylla
gb|ACU25743.1|  pentatricopeptide repeat-containing protein             102   7e-22    Verbena bonariensis [purpletop]
gb|AHC02083.1|  pentatricopeptide repeat-containing protein 123         102   8e-22    Aloysia catamarcensis
gb|AFV61111.1|  pentatricopeptide repeat-containing protein 123         102   8e-22    Aloysia barbata
gb|ACU25742.1|  pentatricopeptide repeat-containing protein             102   8e-22    Verbena hispida
gb|ACU25735.1|  pentatricopeptide repeat-containing protein             102   8e-22    Verbena perennis
ref|XP_007225185.1|  hypothetical protein PRUPE_ppa002191mg             104   8e-22    Prunus persica
gb|AIU48553.1|  tetratricopeptide repeat-like superfamily protein       102   8e-22    Chimonanthus praecox [wintersweet]
ref|XP_007142838.1|  hypothetical protein PHAVU_007G021100g             103   8e-22    
ref|XP_002276556.1|  PREDICTED: pentatricopeptide repeat-containi...    104   8e-22    
ref|XP_007142836.1|  hypothetical protein PHAVU_007G021100g             103   9e-22    
gb|ACU25751.1|  pentatricopeptide repeat-containing protein             102   9e-22    
gb|AFV61130.1|  pentatricopeptide repeat-containing protein 123         101   9e-22    
gb|KEH44326.1|  PPR containing plant-like protein                       103   9e-22    
ref|XP_008798244.1|  PREDICTED: pentatricopeptide repeat-containi...    103   9e-22    
gb|AFV61142.1|  pentatricopeptide repeat-containing protein 123         102   1e-21    
gb|ACU25756.1|  pentatricopeptide repeat-containing protein             102   1e-21    
ref|XP_009795979.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
gb|KJB14273.1|  hypothetical protein B456_002G117100                    103   1e-21    
gb|ACU25744.1|  pentatricopeptide repeat-containing protein             102   1e-21    
ref|XP_004951770.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
gb|AFV61122.1|  pentatricopeptide repeat-containing protein 123         101   1e-21    
gb|ACU25746.1|  pentatricopeptide repeat-containing protein             102   1e-21    
ref|XP_002517447.1|  pentatricopeptide repeat-containing protein,...    103   1e-21    
gb|ACU25740.1|  pentatricopeptide repeat-containing protein             102   1e-21    
ref|XP_004513211.1|  PREDICTED: pentatricopeptide repeat-containi...    104   1e-21    
ref|XP_011460481.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
gb|AHX42088.1|  pentatricopeptide repeat-containing protein 11          100   1e-21    
ref|XP_006646938.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
gb|EYU42661.1|  hypothetical protein MIMGU_mgv1a020055mg                103   1e-21    
ref|XP_009143701.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
gb|ACU25759.1|  pentatricopeptide repeat-containing protein             102   1e-21    
gb|AHX42089.1|  pentatricopeptide repeat-containing protein 11          100   1e-21    
ref|XP_011034889.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
gb|AFV61143.1|  pentatricopeptide repeat-containing protein 123         101   1e-21    
gb|KDO72432.1|  hypothetical protein CISIN_1g038401mg                   103   1e-21    
gb|AFV61145.1|  pentatricopeptide repeat-containing protein 123         101   1e-21    
gb|AFV61127.1|  pentatricopeptide repeat-containing protein 123         101   1e-21    
ref|XP_010048714.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
ref|XP_011096896.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
ref|XP_002964319.1|  hypothetical protein SELMODRAFT_63559              101   1e-21    
ref|XP_002967714.1|  hypothetical protein SELMODRAFT_63558              101   1e-21    
gb|AFV61132.1|  pentatricopeptide repeat-containing protein 123         101   1e-21    
gb|KHG22213.1|  hypothetical protein F383_28108                         103   1e-21    
ref|XP_006449413.1|  hypothetical protein CICLE_v10015063mg             102   1e-21    
gb|ACU25770.1|  pentatricopeptide repeat-containing protein             101   1e-21    
emb|CDY31666.1|  BnaA05g08810D                                          103   1e-21    
ref|XP_004511471.1|  PREDICTED: pentatricopeptide repeat-containi...    104   1e-21    
ref|XP_006467725.1|  PREDICTED: pentatricopeptide repeat-containi...    102   1e-21    
ref|XP_010233879.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-21    
gb|AFV61131.1|  pentatricopeptide repeat-containing protein 123         101   1e-21    
gb|ACU25776.1|  pentatricopeptide repeat-containing protein             101   1e-21    
ref|XP_006656740.1|  PREDICTED: pentatricopeptide repeat-containi...    104   1e-21    
gb|AIU48532.1|  tetratricopeptide repeat-like superfamily protein       102   2e-21    
ref|XP_007157658.1|  hypothetical protein PHAVU_002G087700g             103   2e-21    
gb|ACU25761.1|  pentatricopeptide repeat-containing protein             101   2e-21    
gb|AFV61126.1|  pentatricopeptide repeat-containing protein 123         101   2e-21    
emb|CDY31603.1|  BnaA03g54490D                                          103   2e-21    
ref|XP_009149376.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-21    
ref|XP_009138557.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-21    
ref|XP_004232248.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-21    
emb|CDY26713.1|  BnaA06g13090D                                          103   2e-21    
ref|XP_004295757.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    103   2e-21    
gb|ACU25755.1|  pentatricopeptide repeat-containing protein             101   2e-21    
ref|XP_007018011.1|  Pentatricopeptide repeat (PPR-like) superfam...    103   2e-21    
gb|AHC02099.1|  pentatricopeptide repeat-containing protein 123         100   2e-21    
ref|XP_007018010.1|  Pentatricopeptide repeat (PPR-like) superfam...    103   2e-21    
ref|XP_006482520.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-21    
ref|XP_006431055.1|  hypothetical protein CICLE_v10011224mg             103   2e-21    
gb|AHX41978.1|  pentatricopeptide repeat-containing protein 11        99.8    2e-21    
gb|AIU48544.1|  tetratricopeptide repeat-like superfamily protein       100   2e-21    
ref|XP_002976767.1|  hypothetical protein SELMODRAFT_105248             103   2e-21    
gb|KHN01932.1|  Pentatricopeptide repeat-containing protein             103   2e-21    
ref|XP_010109831.1|  hypothetical protein L484_018488                   102   2e-21    
ref|XP_003527053.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-21    
gb|AHC02077.1|  pentatricopeptide repeat-containing protein 123         101   2e-21    
ref|XP_002973100.1|  hypothetical protein SELMODRAFT_442013             103   2e-21    
ref|XP_002318901.2|  hypothetical protein POPTR_0012s14970g             102   2e-21    
gb|AHX42011.1|  pentatricopeptide repeat-containing protein 11        99.8    2e-21    
ref|XP_006338491.1|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-21    
ref|XP_002318900.2|  hypothetical protein POPTR_0012s12330g             102   2e-21    
emb|CDX85855.1|  BnaC06g22790D                                          101   2e-21    
emb|CDX68166.1|  BnaA07g22060D                                          102   3e-21    
ref|XP_004970535.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-21    
ref|XP_006646472.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-21    
ref|NP_001150085.1|  EMB2745                                            100   3e-21    
gb|AFV61129.1|  pentatricopeptide repeat-containing protein 123         100   3e-21    
gb|AFV61144.1|  pentatricopeptide repeat-containing protein 123         100   3e-21    
gb|ACU25752.1|  pentatricopeptide repeat-containing protein             100   3e-21    
ref|XP_002881377.1|  pentatricopeptide repeat-containing protein        102   3e-21    
ref|XP_011001362.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-21    
ref|XP_009631369.1|  PREDICTED: putative pentatricopeptide repeat...    102   3e-21    
ref|XP_003527377.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-21    
gb|ACU25768.1|  pentatricopeptide repeat-containing protein             100   3e-21    
gb|KHN20117.1|  Pentatricopeptide repeat-containing protein, mito...    102   3e-21    
gb|ACU25747.1|  pentatricopeptide repeat-containing protein             100   3e-21    
gb|AFV61124.1|  pentatricopeptide repeat-containing protein 123         100   3e-21    
gb|ACU25765.1|  pentatricopeptide repeat-containing protein             100   3e-21    
gb|KEH36300.1|  PPR containing plant-like protein                       102   3e-21    
ref|XP_006428510.1|  hypothetical protein CICLE_v100138542mg            103   4e-21    
gb|AFV61152.1|  pentatricopeptide repeat-containing protein 123         100   4e-21    
gb|AFV61128.1|  pentatricopeptide repeat-containing protein 123       99.8    4e-21    
ref|XP_004231646.1|  PREDICTED: putative pentatricopeptide repeat...    102   4e-21    
gb|KHN24013.1|  Pentatricopeptide repeat-containing protein, chlo...    101   4e-21    
gb|AHX42084.1|  pentatricopeptide repeat-containing protein 11        99.0    4e-21    
gb|KHN19370.1|  Pentatricopeptide repeat-containing protein             101   4e-21    
ref|XP_011001361.1|  PREDICTED: pentatricopeptide repeat-containi...    101   4e-21    
emb|CDY16026.1|  BnaC08g40970D                                          101   4e-21    
ref|XP_010244205.1|  PREDICTED: pentatricopeptide repeat-containi...    102   4e-21    
gb|EYU17498.1|  hypothetical protein MIMGU_mgv1a002335mg                102   4e-21    
gb|KJB61743.1|  hypothetical protein B456_009G377200                    101   4e-21    
ref|XP_003563115.2|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    100   4e-21    
ref|XP_006578590.1|  PREDICTED: pentatricopeptide repeat-containi...    102   4e-21    
ref|XP_003523047.2|  PREDICTED: pentatricopeptide repeat-containi...    102   5e-21    
gb|AIU48578.1|  tetratricopeptide repeat-like superfamily protein       100   5e-21    
ref|XP_006578589.1|  PREDICTED: pentatricopeptide repeat-containi...    102   5e-21    
ref|XP_002878256.1|  pentatricopeptide repeat-containing protein        101   5e-21    
ref|XP_007032420.1|  Tetratricopeptide repeat (TPR)-like superfam...    102   5e-21    
ref|XP_009374903.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    101   5e-21    
ref|XP_002271180.1|  PREDICTED: pentatricopeptide repeat-containi...    102   5e-21    
ref|XP_011001360.1|  PREDICTED: pentatricopeptide repeat-containi...    101   5e-21    
gb|KJB09252.1|  hypothetical protein B456_001G131600                    100   5e-21    
gb|KEH33453.1|  PPR containing plant-like protein                       101   5e-21    
ref|XP_007024950.1|  Tetratricopeptide repeat-like superfamily pr...    102   5e-21    
ref|XP_010091910.1|  hypothetical protein L484_010474                   102   6e-21    
gb|AFV61109.1|  pentatricopeptide repeat-containing protein 123         100   6e-21    
ref|XP_010087216.1|  hypothetical protein L484_009725                   102   6e-21    
gb|ACU25766.1|  pentatricopeptide repeat-containing protein           99.8    6e-21    
ref|XP_004141071.1|  PREDICTED: pentatricopeptide repeat-containi...    101   6e-21    
ref|XP_007026347.1|  Pentatricopeptide (PPR) repeat-containing pr...    102   6e-21    
gb|KJB71862.1|  hypothetical protein B456_011G145000                    101   6e-21    
ref|XP_002301924.1|  hypothetical protein POPTR_0002s01200g             102   6e-21    
ref|XP_004157939.1|  PREDICTED: pentatricopeptide repeat-containi...    101   6e-21    
gb|ABN08713.1|  Pentatricopeptide repeat                                100   6e-21    
ref|XP_010271739.1|  PREDICTED: pentatricopeptide repeat-containi...    102   6e-21    
gb|AIU48547.1|  tetratricopeptide repeat-like superfamily protein       100   6e-21    
gb|KDP45457.1|  hypothetical protein JCGZ_09706                         101   6e-21    
ref|XP_010540669.1|  PREDICTED: pentatricopeptide repeat-containi...    101   6e-21    
gb|AHX42085.1|  pentatricopeptide repeat-containing protein 11        98.6    7e-21    
ref|XP_009336548.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    7e-21    
gb|KJB57489.1|  hypothetical protein B456_009G166600                    100   7e-21    
gb|KFK22083.1|  hypothetical protein AALP_AAs52369U000300               100   7e-21    
ref|XP_001781632.1|  predicted protein                                  102   7e-21    
ref|XP_010540668.1|  PREDICTED: pentatricopeptide repeat-containi...    101   7e-21    
ref|XP_010259252.1|  PREDICTED: pentatricopeptide repeat-containi...    102   7e-21    
emb|CDX96689.1|  BnaA08g22320D                                          102   7e-21    
ref|XP_006841446.1|  hypothetical protein AMTR_s00003p00075520          102   7e-21    
ref|XP_009110309.1|  PREDICTED: pentatricopeptide repeat-containi...    101   7e-21    
ref|XP_008790694.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    102   8e-21    
gb|KJB11399.1|  hypothetical protein B456_001G256500                    101   8e-21    
emb|CDY19261.1|  BnaC05g14620D                                          101   8e-21    
gb|AIU48549.1|  tetratricopeptide repeat-like superfamily protein       100   8e-21    
gb|ACU25734.1|  pentatricopeptide repeat-containing protein           99.4    9e-21    
ref|XP_009104746.1|  PREDICTED: pentatricopeptide repeat-containi...    101   9e-21    
ref|XP_010414872.1|  PREDICTED: pentatricopeptide repeat-containi...    101   9e-21    
ref|XP_004502213.1|  PREDICTED: pentatricopeptide repeat-containi...    101   9e-21    
ref|XP_006858935.1|  hypothetical protein AMTR_s00068p00078600          101   9e-21    
gb|KDO54367.1|  hypothetical protein CISIN_1g002549mg                   101   9e-21    
gb|AHC02086.1|  pentatricopeptide repeat-containing protein 123       98.6    1e-20    
ref|XP_003552765.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
gb|ACU25769.1|  pentatricopeptide repeat-containing protein           99.4    1e-20    
ref|XP_010275891.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20    
ref|XP_007215021.1|  hypothetical protein PRUPE_ppa003340mg             100   1e-20    
gb|AFV61112.1|  pentatricopeptide repeat-containing protein 123       99.4    1e-20    
ref|XP_008464651.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20    
gb|KHN44490.1|  Pentatricopeptide repeat-containing protein, chlo...    100   1e-20    
ref|XP_010467733.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_007136014.1|  hypothetical protein PHAVU_009G010700g             100   1e-20    
ref|XP_008659164.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_009794371.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_002459436.1|  hypothetical protein SORBIDRAFT_02g004626          100   1e-20    
ref|XP_008659162.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_008670014.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_010498297.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_004507605.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20    
ref|XP_008792260.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    1e-20    
gb|KJB61746.1|  hypothetical protein B456_009G377400                    100   1e-20    
ref|XP_010459542.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_010459537.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_008659165.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_009358293.1|  PREDICTED: putative pentatricopeptide repeat...    100   1e-20    
ref|XP_006847029.1|  hypothetical protein AMTR_s00017p00176770          100   1e-20    
gb|AHX42020.1|  pentatricopeptide repeat-containing protein 11        97.4    1e-20    
ref|XP_008245022.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_010658789.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    1e-20    
ref|XP_008443439.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20    
ref|XP_009371172.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    101   1e-20    
ref|XP_008233573.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-20    
ref|XP_009358292.1|  PREDICTED: putative pentatricopeptide repeat...    100   1e-20    
ref|XP_003538522.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20    
ref|XP_010932394.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    101   1e-20    
tpg|DAA39479.1|  TPA: chloroplast RNA splicing4                         101   1e-20    
ref|XP_010099493.1|  hypothetical protein L484_000446                   100   1e-20    
gb|ACU25774.1|  pentatricopeptide repeat-containing protein           99.0    1e-20    
ref|XP_010542482.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    2e-20    
ref|XP_011008363.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_006467283.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
gb|KDO78532.1|  hypothetical protein CISIN_1g005474mg                   100   2e-20    
ref|XP_010527103.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_009409629.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_008362810.1|  PREDICTED: pentatricopeptide repeat-containi...    101   2e-20    
gb|AHC02076.1|  pentatricopeptide repeat-containing protein 123       99.0    2e-20    
gb|AHX42010.1|  pentatricopeptide repeat-containing protein 11        97.4    2e-20    
ref|XP_010108616.1|  hypothetical protein L484_000854                   100   2e-20    
gb|KJB61745.1|  hypothetical protein B456_009G377400                    100   2e-20    
ref|XP_010554024.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_010658788.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    2e-20    
gb|AHX42060.1|  pentatricopeptide repeat-containing protein 11        97.4    2e-20    
ref|XP_006444532.1|  hypothetical protein CICLE_v10018807mg             100   2e-20    
gb|ACU25777.1|  pentatricopeptide repeat-containing protein           98.6    2e-20    
gb|KJB22459.1|  hypothetical protein B456_004G048700                    100   2e-20    
ref|XP_006492356.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
gb|KDO86953.1|  hypothetical protein CISIN_1g002814mg                   100   2e-20    
gb|KIY94758.1|  Pentatricopeptide repeat-containing protein             100   2e-20    
ref|XP_004486551.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_008464650.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_006444533.1|  hypothetical protein CICLE_v10018807mg             100   2e-20    
ref|XP_006420675.1|  hypothetical protein CICLE_v10004591mg             100   2e-20    
ref|XP_010556048.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_004491497.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_007224855.1|  hypothetical protein PRUPE_ppa022880mg             100   2e-20    
ref|XP_001769572.1|  predicted protein                                  100   2e-20    
ref|XP_002265372.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    2e-20    
gb|KJB41784.1|  hypothetical protein B456_007G121300                    100   2e-20    
ref|XP_002272226.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20    
ref|XP_010529542.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    2e-20    
ref|XP_004149531.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    2e-20    
ref|XP_010673748.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    2e-20    
gb|ACU25767.1|  pentatricopeptide repeat-containing protein           98.2    2e-20    



>ref|XP_009801460.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana sylvestris]
Length=641

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG + A  VYE + SQGCEPGQVTYAS+LN+YCR+G+YS AEM FSEMEQKGFDKC+VA
Sbjct  415  KRGLKSAVKVYEDICSQGCEPGQVTYASVLNLYCRLGLYSNAEMVFSEMEQKGFDKCVVA  474

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYGKTGR K+A +LVAKMKERGC+PNVW+YN LLDIHG+  N++QVEK+WKEMK
Sbjct  475  YSSMIAMYGKTGRPKDAMKLVAKMKERGCQPNVWVYNALLDIHGKVLNLRQVEKIWKEMK  534

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK+ PDRVSYTS+ISAYS+A+E + C+ YYQ+F LNGGK DRAMAGIMVGVFSKMN+VD
Sbjct  535  RRKIFPDRVSYTSIISAYSRAREFDKCLTYYQEFTLNGGKIDRAMAGIMVGVFSKMNRVD  594

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            EL+ LLQ++K + TKLD RL+RSALN+LRDAGL+I+AKW+QESF 
Sbjct  595  ELIGLLQNMKREGTKLDGRLHRSALNSLRDAGLQIQAKWMQESFG  639



>emb|CBI27495.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG R AA VY++L+ QGCEPGQVTYASI+N+YCR+ +YSKAEM FSEME+KGF+KC+VA
Sbjct  315  KRGLRAAAKVYDELILQGCEPGQVTYASIINVYCRMELYSKAEMVFSEMEKKGFNKCVVA  374

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGKTGR +EA RLVAKMKERGCEPNVW+YN+L+D+HGR  N++QVEK+WKEMK
Sbjct  375  YSSMVVMYGKTGRLREAMRLVAKMKERGCEPNVWVYNSLMDMHGRVKNLRQVEKLWKEMK  434

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  435  RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  494

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  495  ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  538


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 83/206 (40%), Gaps = 38/206 (18%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMV  196
             VY+++ S G  P   +Y  I+  Y +I  Y K    F E E +  D    +   Y  + 
Sbjct  145  AVYDRMKSAGVVPNSESYYRIMEAYIKIRDYEKVVTLFQEFESRKIDSSPFSTQIYRILC  204

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
               GK GR  EA      M ++G   +  +Y++L+        +K  E++++E + +K++
Sbjct  205  ESLGKMGRAFEALEFFRDMTKKGILEDSAVYSSLICSFASIREVKVAEELFREAEEKKIL  264

Query  377  PD--------------------------------RVS---YTSVISAYSKAKELESCVKY  451
             D                                RVS   + ++++ ++K + L +  K 
Sbjct  265  RDPEVFLKLVLMYVEEGLMERTLEIVKAMKNVEIRVSDCIFCAIVNGFAKKRGLRAAAKV  324

Query  452  YQDFKLNGGKTDRAMAGIMVGVFSKM  529
            Y +  L G +  +     ++ V+ +M
Sbjct  325  YDELILQGCEPGQVTYASIINVYCRM  350



>ref|XP_004237182.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Solanum lycopersicum]
Length=642

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG R A  VYE L SQGCEPGQVTYAS+LN+YCR+G+YS AEM FSEMEQKGFDKC+VA
Sbjct  416  KRGLRSAVQVYEDLTSQGCEPGQVTYASVLNLYCRLGLYSNAEMVFSEMEQKGFDKCVVA  475

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYGKTGR K+A +LVA MKERGC+PNVW+YN LLDIHG+  N++QVEK+WKEMK
Sbjct  476  YSSMIAMYGKTGRPKDAMKLVAIMKERGCQPNVWVYNALLDIHGKVLNLRQVEKIWKEMK  535

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK+ PDRVSYTS+ISAYSKA+E + C+ YYQ+F LNGG+ DRAMAGIMVGVFSKMN+VD
Sbjct  536  RRKIFPDRVSYTSIISAYSKAREFDKCLIYYQEFTLNGGRLDRAMAGIMVGVFSKMNRVD  595

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            EL+ LLQ++K + TKLD RL +SALN+LRDAGL+I+AKWLQESF 
Sbjct  596  ELISLLQNMKREGTKLDGRLQKSALNSLRDAGLQIQAKWLQESFG  640



>ref|XP_002269531.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=603

 Score =   371 bits (952),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG R AA VY++L+ QGCEPGQVTYASI+N+YCR+ +YSKAEM FSEME+KGF+KC+VA
Sbjct  377  KRGLRAAAKVYDELILQGCEPGQVTYASIINVYCRMELYSKAEMVFSEMEKKGFNKCVVA  436

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGKTGR +EA RLVAKMKERGCEPNVW+YN+L+D+HGR  N++QVEK+WKEMK
Sbjct  437  YSSMVVMYGKTGRLREAMRLVAKMKERGCEPNVWVYNSLMDMHGRVKNLRQVEKLWKEMK  496

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  497  RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  556

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  557  ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  600


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 83/205 (40%), Gaps = 38/205 (19%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVN  199
            VY+++ S G  P   +Y  I+  Y +I  Y K    F E E +  D    +   Y  +  
Sbjct  208  VYDRMKSAGVVPNSESYYRIMEAYIKIRDYEKVVTLFQEFESRKIDSSPFSTQIYRILCE  267

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK GR  EA      M ++G   +  +Y++L+        +K  E++++E + +K++ 
Sbjct  268  SLGKMGRAFEALEFFRDMTKKGILEDSAVYSSLICSFASIREVKVAEELFREAEEKKILR  327

Query  380  D--------------------------------RVS---YTSVISAYSKAKELESCVKYY  454
            D                                RVS   + ++++ ++K + L +  K Y
Sbjct  328  DPEVFLKLVLMYVEEGLMERTLEIVKAMKNVEIRVSDCIFCAIVNGFAKKRGLRAAAKVY  387

Query  455  QDFKLNGGKTDRAMAGIMVGVFSKM  529
             +  L G +  +     ++ V+ +M
Sbjct  388  DELILQGCEPGQVTYASIINVYCRM  412



>emb|CBI24106.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG R AA VY++L+ QGCEPGQVTYASI+N+YCR+ +YSKAEM FSEME+KGF+KC+VA
Sbjct  301  KRGLRAAAKVYDELILQGCEPGQVTYASIINVYCRMELYSKAEMMFSEMEKKGFNKCVVA  360

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGKTGR +EA RLVAKMKERGC+PNVW+YN+L+D+HGR  N++QVEK+WKEMK
Sbjct  361  YSSMVVMYGKTGRLREAMRLVAKMKERGCKPNVWVYNSLMDMHGRVKNLRQVEKLWKEMK  420

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  421  RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  480

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  481  ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  524


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 83/206 (40%), Gaps = 38/206 (18%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMV  196
             VY+++ S G  P   +Y  I+  Y +I  Y K    F E E +  D    +   Y  + 
Sbjct  131  AVYDRMKSAGVVPNSESYYRIMEAYIKIRDYEKVVTLFQEFESRKIDSSPFSTQIYRILC  190

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
               GK GR  EA      M ++G   +  +Y++L+        +K  E++++E + +K++
Sbjct  191  ESLGKMGRAFEALEFFRDMTKKGILEDSAVYSSLICSFASIREVKVAEELFREAEEKKIL  250

Query  377  PD--------------------------------RVS---YTSVISAYSKAKELESCVKY  451
             D                                RVS   + ++++ ++K + L +  K 
Sbjct  251  RDPEVFLKLVLMYVEEGLMERTIEIVKAMKNVKIRVSDCIFCAIVNGFAKKRGLRAAAKV  310

Query  452  YQDFKLNGGKTDRAMAGIMVGVFSKM  529
            Y +  L G +  +     ++ V+ +M
Sbjct  311  YDELILQGCEPGQVTYASIINVYCRM  336



>ref|XP_009601923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana tomentosiformis]
Length=619

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG R A  VYE L SQGCEPGQVTYAS+LN+YCR+G+YS AEM FSEMEQKGFDKC+VA
Sbjct  393  KRGLRSAVKVYEDLCSQGCEPGQVTYASVLNLYCRLGLYSNAEMVFSEMEQKGFDKCVVA  452

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYGKT R K+A +LVAKMKERGC+PNVW+YN LLDIHG+  N++QVEK+WKEMK
Sbjct  453  YSSMIAMYGKTERPKDAMKLVAKMKERGCQPNVWVYNALLDIHGKVLNLRQVEKIWKEMK  512

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK+ PDRVSYTS+I+AYS+A+E + C+ YYQ+F LNGG+ DRAMAGIMVGVFSKMN+VD
Sbjct  513  RRKIFPDRVSYTSIITAYSRAREFDKCLTYYQEFTLNGGRIDRAMAGIMVGVFSKMNRVD  572

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            EL+ LLQ++K + TKLD RL+RSALN+LRDAGL+I+AKW+QESF 
Sbjct  573  ELIGLLQNMKREGTKLDGRLHRSALNSLRDAGLQIQAKWMQESFG  617



>emb|CDP07966.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   370 bits (949),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE L+ QGCEPGQVTYASI NIY R+G Y KAEM FSEME+KGFDKC+VA
Sbjct  389  RRGLNAAVKVYEDLILQGCEPGQVTYASIQNIYFRLGQYFKAEMIFSEMEEKGFDKCVVA  448

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y+SMV MYGKTGR  +A RLVAKMKERGCEPNVWIYN+LLD+HGRA N++QVEK+WKEM 
Sbjct  449  YASMVAMYGKTGRVGDAMRLVAKMKERGCEPNVWIYNSLLDMHGRAVNLRQVEKIWKEMN  508

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV+PDRVSYTSVISAYS+A+E E+C++YYQ F+LNGG  DRAMA IMV VFSK+N+ D
Sbjct  509  RRKVLPDRVSYTSVISAYSRAREFETCMRYYQKFRLNGGAIDRAMAAIMVAVFSKLNRAD  568

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            ELVKLLQD+KT+ TKLD RLYRSALNALRDAGL ++AKWLQESF 
Sbjct  569  ELVKLLQDMKTEGTKLDVRLYRSALNALRDAGLHVQAKWLQESFG  613



>ref|XP_002273494.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=609

 Score =   368 bits (945),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG R AA VY++L+ QGCEPGQVTYASI+N+YCR+ +YSKAEM FSEME+KGF+KC+VA
Sbjct  378  KRGLRAAAKVYDELILQGCEPGQVTYASIINVYCRMELYSKAEMMFSEMEKKGFNKCVVA  437

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGKTGR +EA RLVAKMKERGC+PNVW+YN+L+D+HGR  N++QVEK+WKEMK
Sbjct  438  YSSMVVMYGKTGRLREAMRLVAKMKERGCKPNVWVYNSLMDMHGRVKNLRQVEKLWKEMK  497

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +VD
Sbjct  498  RKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGRVD  557

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  558  ELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  601


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 83/206 (40%), Gaps = 38/206 (18%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMV  196
             VY+++ S G  P   +Y  I+  Y +I  Y K    F E E +  D    +   Y  + 
Sbjct  208  AVYDRMKSAGVVPNSESYYRIMEAYIKIRDYEKVVTLFQEFESRKIDSSPFSTQIYRILC  267

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
               GK GR  EA      M ++G   +  +Y++L+        +K  E++++E + +K++
Sbjct  268  ESLGKMGRAFEALEFFRDMTKKGILEDSAVYSSLICSFASIREVKVAEELFREAEEKKIL  327

Query  377  PD--------------------------------RVS---YTSVISAYSKAKELESCVKY  451
             D                                RVS   + ++++ ++K + L +  K 
Sbjct  328  RDPEVFLKLVLMYVEEGLMERTIEIVKAMKNVKIRVSDCIFCAIVNGFAKKRGLRAAAKV  387

Query  452  YQDFKLNGGKTDRAMAGIMVGVFSKM  529
            Y +  L G +  +     ++ V+ +M
Sbjct  388  YDELILQGCEPGQVTYASIINVYCRM  413



>ref|XP_010270795.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nelumbo nucifera]
Length=636

 Score =   367 bits (943),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRGP+VA  VYE LVSQGCEPGQVTYAS+++IYC IG+++KAEMT+ EMEQKGFDKCIVA
Sbjct  382  KRGPKVAIRVYEDLVSQGCEPGQVTYASVISIYCGIGLHTKAEMTYFEMEQKGFDKCIVA  441

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y++MV+MYGK GR ++A +LVAKMKERGCEPNVWIYN+L+D+HGRA N++QVEK+WKEMK
Sbjct  442  YATMVSMYGKVGRLRDAMKLVAKMKERGCEPNVWIYNSLIDMHGRAQNLRQVEKLWKEMK  501

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+VSYTS+I+AYSKA E E+C+K YQ+F+ NGGK DRA+AGIMVGVFSK ++++
Sbjct  502  RRKVAPDKVSYTSLITAYSKAGEFEACIKLYQEFRFNGGKLDRALAGIMVGVFSKSSRIN  561

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            EL+KLLQD+K + T LD +LYRSALNALRDAGL+++ KW +ESFA
Sbjct  562  ELMKLLQDMKLEGTGLDVKLYRSALNALRDAGLQVQVKWFEESFA  606



>ref|XP_011021682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X2 [Populus euphratica]
Length=413

 Score =   353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 198/224 (88%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L   GCEPGQVTYAS++N YCR G+YSKAEM FSEME+KGFDKC+VA
Sbjct  187  RRGFSAAVKVYEELKYDGCEPGQVTYASVINAYCRAGLYSKAEMVFSEMEEKGFDKCVVA  246

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM++MYGKTGR ++A RLVAKMK +GCEPNVWIYN+LLD+HGRA N++QVEK+WKEMK
Sbjct  247  YSSMISMYGKTGRARDAMRLVAKMKLKGCEPNVWIYNSLLDMHGRAKNLRQVEKLWKEMK  306

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM GVFSK++++D
Sbjct  307  RRKVTPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRID  366

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  367  ELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  410


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/217 (23%), Positives = 100/217 (46%), Gaps = 5/217 (2%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD-KCIV---AYSSM  193
            +V+EK++  G       Y  I+  Y ++G   K    F+E E +  D K ++    Y  +
Sbjct  15   SVHEKMILAGIPLDSRCYCQIMKAYYKLGDAEKVVALFNEFESRKLDSKPMILRQIYKIL  74

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
                G++G+  +A      M+++G   +  IY++L+        +K  E+++KE + +++
Sbjct  75   CLSLGRSGQAFQALEYSRDMRKKGILEDSSIYSSLICSFANIREVKVAEELFKEAQEKRM  134

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGG-KTDRAMAGIMVGVFSKMNKVDELV  550
            + D      ++  Y +  ++E  ++  +  K     K    +   +V  FSK       V
Sbjct  135  LRDPEIVLRLVLMYIEEGKMEKTIELVKVMKDTANLKVSDCIFCAIVNGFSKRRGFSAAV  194

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
            K+ ++LK D  +  +  Y S +NA   AGL  +A+ +
Sbjct  195  KVYEELKYDGCEPGQVTYASVINAYCRAGLYSKAEMV  231


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 74/151 (49%), Gaps = 2/151 (1%)
 Frame = +2

Query  170  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  349
            CI  + ++VN + K      A ++  ++K  GCEP    Y ++++ + RA    + E V+
Sbjct  175  CI--FCAIVNGFSKRRGFSAAVKVYEELKYDGCEPGQVTYASVINAYCRAGLYSKAEMVF  232

Query  350  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  529
             EM+ +      V+Y+S+IS Y K       ++     KL G + +  +   ++ +  + 
Sbjct  233  SEMEEKGFDKCVVAYSSMISMYGKTGRARDAMRLVAKMKLKGCEPNVWIYNSLLDMHGRA  292

Query  530  NKVDELVKLLQDLKTDETKLDERLYRSALNA  622
              + ++ KL +++K  +   D+  Y S ++A
Sbjct  293  KNLRQVEKLWKEMKRRKVTPDKVTYSSVISA  323



>ref|XP_002314741.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
 gb|EEF00912.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
Length=582

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L   GC+PGQVTYAS++N YCR G+YSKAEM FSEME+KGFDKC+VA
Sbjct  356  RRGFSAAVKVYEELKYDGCDPGQVTYASVINAYCRAGLYSKAEMVFSEMEEKGFDKCVVA  415

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM++MYGKTGR ++ATRLVAKMK +GCEPNVWIYN+LLD+HGRA N++QVEK+WKEMK
Sbjct  416  YSSMISMYGKTGRARDATRLVAKMKLKGCEPNVWIYNSLLDMHGRAKNLRQVEKLWKEMK  475

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM GVFSK++++D
Sbjct  476  RRKVAPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRID  535

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  536  ELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  579


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/151 (23%), Positives = 73/151 (48%), Gaps = 2/151 (1%)
 Frame = +2

Query  170  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  349
            CI  + ++VN + K      A ++  ++K  GC+P    Y ++++ + RA    + E V+
Sbjct  344  CI--FCAIVNGFSKRRGFSAAVKVYEELKYDGCDPGQVTYASVINAYCRAGLYSKAEMVF  401

Query  350  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  529
             EM+ +      V+Y+S+IS Y K        +     KL G + +  +   ++ +  + 
Sbjct  402  SEMEEKGFDKCVVAYSSMISMYGKTGRARDATRLVAKMKLKGCEPNVWIYNSLLDMHGRA  461

Query  530  NKVDELVKLLQDLKTDETKLDERLYRSALNA  622
              + ++ KL +++K  +   D+  Y S ++A
Sbjct  462  KNLRQVEKLWKEMKRRKVAPDKVTYSSVISA  492


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 95/215 (44%), Gaps = 5/215 (2%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNM-  202
            +V+EK++  G       Y  I+  Y ++G   K    F+E E +  D   +    +  + 
Sbjct  184  SVHEKMILAGIPLDSRCYCQIMKAYYKLGDAEKVVALFNEFESRKLDSKPMILRQIFKIL  243

Query  203  ---YGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
                G++G+  +A      M+++G   +  IY++L+        ++  E+++KE   +++
Sbjct  244  CLSLGRSGQAFQALEYSRDMRKKGILEDSSIYSSLICSFANIREVEVAEELFKEALEKRM  303

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGG-KTDRAMAGIMVGVFSKMNKVDELV  550
            + D      ++  Y +  ++E  ++  +  K     K    +   +V  FSK       V
Sbjct  304  LRDPEIVLRLVLMYIEEGQMEKTIEIVKVMKGTANLKVSDCIFCAIVNGFSKRRGFSAAV  363

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            K+ ++LK D     +  Y S +NA   AGL  +A+
Sbjct  364  KVYEELKYDGCDPGQVTYASVINAYCRAGLYSKAE  398



>ref|XP_011021681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X1 [Populus euphratica]
Length=613

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 198/224 (88%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L   GCEPGQVTYAS++N YCR G+YSKAEM FSEME+KGFDKC+VA
Sbjct  387  RRGFSAAVKVYEELKYDGCEPGQVTYASVINAYCRAGLYSKAEMVFSEMEEKGFDKCVVA  446

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM++MYGKTGR ++A RLVAKMK +GCEPNVWIYN+LLD+HGRA N++QVEK+WKEMK
Sbjct  447  YSSMISMYGKTGRARDAMRLVAKMKLKGCEPNVWIYNSLLDMHGRAKNLRQVEKLWKEMK  506

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D AMAGIM GVFSK++++D
Sbjct  507  RRKVTPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDGAMAGIMAGVFSKISRID  566

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+SF
Sbjct  567  ELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDSF  610


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/215 (23%), Positives = 99/215 (46%), Gaps = 5/215 (2%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD-KCIV---AYSSM  193
            +V+EK++  G       Y  I+  Y ++G   K    F+E E +  D K ++    Y  +
Sbjct  215  SVHEKMILAGIPLDSRCYCQIMKAYYKLGDAEKVVALFNEFESRKLDSKPMILRQIYKIL  274

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
                G++G+  +A      M+++G   +  IY++L+        +K  E+++KE + +++
Sbjct  275  CLSLGRSGQAFQALEYSRDMRKKGILEDSSIYSSLICSFANIREVKVAEELFKEAQEKRM  334

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGG-KTDRAMAGIMVGVFSKMNKVDELV  550
            + D      ++  Y +  ++E  ++  +  K     K    +   +V  FSK       V
Sbjct  335  LRDPEIVLRLVLMYIEEGKMEKTIELVKVMKDTANLKVSDCIFCAIVNGFSKRRGFSAAV  394

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            K+ ++LK D  +  +  Y S +NA   AGL  +A+
Sbjct  395  KVYEELKYDGCEPGQVTYASVINAYCRAGLYSKAE  429


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 74/151 (49%), Gaps = 2/151 (1%)
 Frame = +2

Query  170  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  349
            CI  + ++VN + K      A ++  ++K  GCEP    Y ++++ + RA    + E V+
Sbjct  375  CI--FCAIVNGFSKRRGFSAAVKVYEELKYDGCEPGQVTYASVINAYCRAGLYSKAEMVF  432

Query  350  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  529
             EM+ +      V+Y+S+IS Y K       ++     KL G + +  +   ++ +  + 
Sbjct  433  SEMEEKGFDKCVVAYSSMISMYGKTGRARDAMRLVAKMKLKGCEPNVWIYNSLLDMHGRA  492

Query  530  NKVDELVKLLQDLKTDETKLDERLYRSALNA  622
              + ++ KL +++K  +   D+  Y S ++A
Sbjct  493  KNLRQVEKLWKEMKRRKVTPDKVTYSSVISA  523



>ref|XP_006470889.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Citrus sinensis]
Length=603

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L+SQGC PGQVTYASI+N YCRIG+YSKAE  F EM+ KGFDKC+VA
Sbjct  377  RRGYWAAVKVYEQLISQGCIPGQVTYASIINAYCRIGLYSKAEKVFIEMQLKGFDKCVVA  436

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS+MV MYGKTGR ++A RLVAKMK +GCEPNVWIYN+L+D+HGRA N++QVEK+WKEM+
Sbjct  437  YSTMVAMYGKTGRIRDAMRLVAKMKAKGCEPNVWIYNSLMDMHGRAKNLRQVEKLWKEME  496

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRA+AGIMVGVFSK+++++
Sbjct  497  RRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAIAGIMVGVFSKLSQIE  556

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  557  ELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 92/212 (43%), Gaps = 3/212 (1%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVN  199
            VYEK+ S G       Y  I+  Y +IG   K    F E E +  D    +   Y  + +
Sbjct  208  VYEKMKSAGIVLDSGCYCQIMEAYYKIGDSEKVAALFLECESRELDSTPFSTHMYKILCD  267

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK+GR  EA +    MKE+G   +  IY +L+      + +K  E+++KE + + ++ 
Sbjct  268  SLGKSGRAFEALKFFRDMKEKGILEDPSIYASLICSFASITEVKLAEELFKEAEEKGMLR  327

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D   +  ++  Y +   +E  +   +  K    K    ++  +V  FSK       VK+ 
Sbjct  328  DPEVFLKLVLMYIEEGLVEKTLDVVESMKNAKLKISDCISCAIVNGFSKRRGYWAAVKVY  387

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            + L +      +  Y S +NA    GL  +A+
Sbjct  388  EQLISQGCIPGQVTYASIINAYCRIGLYSKAE  419



>ref|XP_006420692.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
 gb|ESR33932.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
Length=603

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L+SQGC PGQVTYASI+N YCRI +YSKAE  F EM+QKGFDKC+VA
Sbjct  377  RRGYWAAVKVYEQLISQGCIPGQVTYASIINAYCRIALYSKAEKVFIEMQQKGFDKCVVA  436

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGKTGR ++A  LVAKMK +GCEPNVWIYN+L+D+HGRA N++QVEK+WKEM+
Sbjct  437  YSSMVAMYGKTGRIRDAMWLVAKMKAKGCEPNVWIYNSLMDMHGRAKNLRQVEKLWKEME  496

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRAMAGIMVGVFSK+++++
Sbjct  497  RRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAMAGIMVGVFSKLSQIE  556

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  557  ELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 86/201 (43%), Gaps = 3/201 (1%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVN  199
            VYEK+ S G       Y  I+  Y +IG   K    F E + +  D    +   Y  + +
Sbjct  208  VYEKMKSAGIVLDSGCYCQIMEAYYKIGDSEKVAALFLECKSRKLDSTPFSTHMYKILCD  267

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK+GR  EA +    MKE+G   +  IY +L+      + +K  E+++KE + + ++ 
Sbjct  268  SLGKSGRAFEALKFFRDMKEKGILEDPSIYASLICSFASITEVKLAEELFKEAEEKGMLR  327

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D      ++  Y +   +E  +   +  K    K    ++  +V  FSK       VK+ 
Sbjct  328  DPEVCLKLVLMYIEEGLVEKTLDVVESMKNAKLKISDCISCAIVNGFSKRRGYWAAVKVY  387

Query  560  QDLKTDETKLDERLYRSALNA  622
            + L +      +  Y S +NA
Sbjct  388  EQLISQGCIPGQVTYASIINA  408



>gb|KDO57832.1| hypothetical protein CISIN_1g007461mg [Citrus sinensis]
Length=603

 Score =   351 bits (900),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L+SQGC PGQVTYASI+N YCRI +YSKAE  F EM+QKGFDKC+VA
Sbjct  377  RRGYWAAVKVYEQLISQGCIPGQVTYASIINAYCRIALYSKAEKVFIEMQQKGFDKCVVA  436

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGKTGR ++A  LVAKMK +GCEPNVWIYN+L+D+HGRA N++QVEK+WKEM+
Sbjct  437  YSSMVAMYGKTGRIRDAMWLVAKMKAKGCEPNVWIYNSLMDMHGRAKNLRQVEKLWKEME  496

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+VSYT+VISAY++A+E + CVK+Y +F++NGG  DRA+AGIMVGVFSK+++++
Sbjct  497  RRKVTPDKVSYTTVISAYNRAREFDMCVKFYNEFRMNGGVIDRAIAGIMVGVFSKLSQIE  556

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLLQD+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  557  ELVKLLQDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  600


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 86/201 (43%), Gaps = 3/201 (1%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVN  199
            VYEK+ S G       Y  I+  Y +IG   K    F E + +  D    +   Y  + +
Sbjct  208  VYEKMKSAGIVLDSGCYCQIMEAYYKIGDSEKVAALFLECKSRKLDSTPFSTHMYKILCD  267

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK+GR  EA +    MKE+G   +  IY +L+      + +K  E+++KE + + ++ 
Sbjct  268  SLGKSGRAFEALKFFRDMKEKGILEDPSIYASLICSFASITEVKLAEELFKEAEEKGMLR  327

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D      ++  Y +   +E  +   +  K    K    ++  +V  FSK       VK+ 
Sbjct  328  DPEVCLKLVLMYIEEGLVEKTLDVVESMKNAKLKISDCISCAIVNGFSKRRGYWAAVKVY  387

Query  560  QDLKTDETKLDERLYRSALNA  622
            + L +      +  Y S +NA
Sbjct  388  EQLISQGCIPGQVTYASIINA  408



>ref|XP_007015128.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY32747.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=608

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 197/224 (88%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A  VYE+L+SQGC+PGQVTYASI+N+YCR G+ SKAE  FSEME+KGFDKC+VA
Sbjct  382  RRGYQSAIVVYEELLSQGCKPGQVTYASIINVYCRSGLNSKAETVFSEMEEKGFDKCVVA  441

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYGKTGR ++A +LVAKMK +GC+PNVWIYN+L+D+HGR  N++QVEK+WKEMK
Sbjct  442  YSSMIAMYGKTGRIRDAMKLVAKMKHKGCQPNVWIYNSLMDMHGRVKNLRQVEKLWKEMK  501

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK  PD+VSYT++ISAYS+A+E E C+K YQ+F+LNGG  D+AMAGIMVG+FSK +++D
Sbjct  502  RRKTAPDKVSYTTIISAYSRAREYEMCLKCYQEFRLNGGLIDKAMAGIMVGIFSKTSRID  561

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLLQD+K + T+LD RLY SA+NALRDAGLE +AKWLQ++F
Sbjct  562  ELVKLLQDMKAEGTQLDGRLYHSAMNALRDAGLETQAKWLQKNF  605



>gb|KDP38220.1| hypothetical protein JCGZ_04863 [Jatropha curcas]
Length=415

 Score =   342 bits (878),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 192/224 (86%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG R A  VYE+L S  CEPGQVTYASI+N YCR+G+YSKAE+ F EM++KGFDKC+VA
Sbjct  186  RRGFRAAVRVYEELKSDDCEPGQVTYASIINAYCRVGLYSKAEIVFLEMQEKGFDKCVVA  245

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSS++ MYGKTGR ++A RLVAKMK  GCEPNVWIYN+LLD+HGR  N++QVEK+ KEMK
Sbjct  246  YSSIIAMYGKTGRLRDAMRLVAKMKVNGCEPNVWIYNSLLDMHGRVKNLRQVEKLRKEMK  305

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK+ PD+V+YTSVISAY+K KE ++CV YY ++++NGG  D+AMAGIMVGVFSK+ ++D
Sbjct  306  RRKIAPDKVTYTSVISAYNKVKEFDTCVSYYHEYRINGGAIDKAMAGIMVGVFSKIGRID  365

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            EL++LL D+K + T LD RLYRSA NALRDAGL+++AKWLQESF
Sbjct  366  ELLRLLHDMKIEGTPLDGRLYRSAFNALRDAGLQMQAKWLQESF  409


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/151 (22%), Positives = 76/151 (50%), Gaps = 2/151 (1%)
 Frame = +2

Query  170  CIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVW  349
            CI  + ++VN + +    + A R+  ++K   CEP    Y ++++ + R     + E V+
Sbjct  174  CI--FCAIVNGFARRRGFRAAVRVYEELKSDDCEPGQVTYASIINAYCRVGLYSKAEIVF  231

Query  350  KEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM  529
             EM+ +      V+Y+S+I+ Y K   L   ++     K+NG + +  +   ++ +  ++
Sbjct  232  LEMQEKGFDKCVVAYSSIIAMYGKTGRLRDAMRLVAKMKVNGCEPNVWIYNSLLDMHGRV  291

Query  530  NKVDELVKLLQDLKTDETKLDERLYRSALNA  622
              + ++ KL +++K  +   D+  Y S ++A
Sbjct  292  KNLRQVEKLRKEMKRRKIAPDKVTYTSVISA  322


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 94/213 (44%), Gaps = 4/213 (2%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDK----CIVAYSSMV  196
            VYEK+   G       Y  I+  Y +IG   +    F+E E + F+      I  Y  + 
Sbjct  16   VYEKMKLAGIFMDSGGYCQIMKAYQKIGDTERVLALFNEFESRKFENSRTSLIQIYRILC  75

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
               GK+GR  EA      M ++G   +  IY++L+        +   E ++KE ++ K++
Sbjct  76   ESLGKSGRAFEALEYFRDMGKKGIFGDSRIYSSLICSFASIREINVAEDLFKEAEKNKML  135

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
             D   +  +I  Y +   +E  ++  +  K    +    +   +V  F++       V++
Sbjct  136  RDPEIFLKLILMYVEEGLIEEILEIVKAMKRVKMRMSDCIFCAIVNGFARRRGFRAAVRV  195

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             ++LK+D+ +  +  Y S +NA    GL  +A+
Sbjct  196  YEELKSDDCEPGQVTYASIINAYCRVGLYSKAE  228



>gb|KJB35742.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=441

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 194/224 (87%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A  VYE+L+ QGC+PGQVTYASI+N YCRIG+ SKAEM FSEM+QKGFDKC+VA
Sbjct  209  RRGFQSAIVVYEQLILQGCKPGQVTYASIINAYCRIGLNSKAEMVFSEMQQKGFDKCVVA  268

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYGK G  ++A +++A+MK +GC+PNVWIYN+L+D+HGR  N++QVEK+WKEMK
Sbjct  269  YSSMIAMYGKAGMIRDAMKVLAQMKAKGCQPNVWIYNSLMDMHGRVKNLRQVEKLWKEMK  328

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK+ PD+VSYT+VISAY++ +E E CVK+YQ+F+LNGG  D+AMAG MVGVFSK +++D
Sbjct  329  RRKLAPDKVSYTTVISAYNRVRECEMCVKFYQEFRLNGGSIDKAMAGTMVGVFSKTSRID  388

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELV+LLQD+K + T+LD RLY SA+NALRDAGLE + KWLQ++F
Sbjct  389  ELVRLLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNF  432


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 91/219 (42%), Gaps = 3/219 (1%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---Y  184
            R     YE + S G  P   +Y  I+  Y RIG   K    F E E    +   +A   Y
Sbjct  35   RSTIAAYETMKSNGISPDSESYCQIMEAYHRIGDMDKVSSLFDEFESSKLNLTPLAPRAY  94

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            S + +   K+GR  EA      MK++G   +  +Y++L+       ++  VEK+ +E + 
Sbjct  95   SILCDSLAKSGRPYEALEYFGDMKKKGLFVSSLVYSSLIISFASIRDITIVEKLLEEAEE  154

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            RK+V D   +  ++  Y +   LE  +   +       K    +   +V  FSK      
Sbjct  155  RKMVRDPELFLKLVLMYIEEGLLEKTLDVVRVMNDANVKVSDCIFCTIVNGFSKRRGFQS  214

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
             + + + L     K  +  Y S +NA    GL  +A+ +
Sbjct  215  AIVVYEQLILQGCKPGQVTYASIINAYCRIGLNSKAEMV  253



>ref|XP_004151188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
 gb|KGN49761.1| hypothetical protein Csa_5G114580 [Cucumis sativus]
Length=608

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYEKL+  GCEPGQVTYAS +N YCR+G+YSKAE  F EME+KGFDKC+VA
Sbjct  378  RRGYEAAVKVYEKLIEDGCEPGQVTYASAINAYCRVGLYSKAEDIFGEMEEKGFDKCVVA  437

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSS+++MYGKTGR K+A RL+AKMKE+GC+PNVWIYN L+++HG+A N+KQVEK+WKEMK
Sbjct  438  YSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEMHGKAKNLKQVEKLWKEMK  497

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R+K+ PD+VSYTS+ISAY KA E E C +YY++F++NGG  D+A  GIMVGVFSK ++VD
Sbjct  498  RKKIAPDKVSYTSIISAYVKASEFEKCEQYYREFRMNGGTIDKAFGGIMVGVFSKTSRVD  557

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            ELVKLL+D+K + T+LDERLYR+ALNAL DAGL+++AKWLQ+ +A
Sbjct  558  ELVKLLRDMKLEGTRLDERLYRTALNALMDAGLQVQAKWLQDHYA  602


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 76/155 (49%), Gaps = 2/155 (1%)
 Frame = +2

Query  158  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  337
            G   CI  + ++VN Y     ++ A ++  K+ E GCEP    Y + ++ + R     + 
Sbjct  362  GVSDCI--FCAIVNGYATRRGYEAAVKVYEKLIEDGCEPGQVTYASAINAYCRVGLYSKA  419

Query  338  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  517
            E ++ EM+ +      V+Y+S+IS Y K   L+  ++     K  G + +  +  I++ +
Sbjct  420  EDIFGEMEEKGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEM  479

Query  518  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  622
              K   + ++ KL +++K  +   D+  Y S ++A
Sbjct  480  HGKAKNLKQVEKLWKEMKRKKIAPDKVSYTSIISA  514


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/217 (24%), Positives = 96/217 (44%), Gaps = 13/217 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQK-----GFDKCIVAYSSM  193
            V+++L S   E     Y  ++  Y ++G   +    F+E+E +      F   I  Y  +
Sbjct  209  VFQRLKSARIEADSGCYCRVMEAYLKLGDSERVMELFNEVESRISVSTPFSTKI--YGIL  266

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
                 K+GR  E+      M+++G   +  IY+ L+        +K  E ++ E K +K+
Sbjct  267  CESLAKSGRVFESLEFFRDMRKKGIAEDYTIYSALICTFASIQEVKLAEDLYNEAKAKKL  326

Query  374  VPDRVSYTSVISAYSKAKELESC---VKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + D   +  +I  Y +   LE     V+  +DFK+  G +D     I+ G ++     + 
Sbjct  327  LRDPAMFLKLILMYVQQGSLEKALEIVEVMKDFKI--GVSDCIFCAIVNG-YATRRGYEA  383

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             VK+ + L  D  +  +  Y SA+NA    GL  +A+
Sbjct  384  AVKVYEKLIEDGCEPGQVTYASAINAYCRVGLYSKAE  420



>ref|XP_004172063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
Length=608

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYEKL+  GCEPGQVTYAS +N YCR+G+YSKAE  F EME+KGFDKC+VA
Sbjct  378  RRGYEAAVKVYEKLIEDGCEPGQVTYASAINAYCRVGLYSKAEDIFGEMEEKGFDKCVVA  437

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSS+++MYGKTGR K+A RL+AKMKE+GC+PNVWIYN L+++HG+A N+KQVEK+WKEMK
Sbjct  438  YSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEMHGKAKNLKQVEKLWKEMK  497

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R+K+ PD+VSYTS+ISAY KA E E C +YY++F++NGG  D+A  GIMVGVFSK ++VD
Sbjct  498  RKKIAPDKVSYTSIISAYVKASEFEKCEQYYREFRMNGGTIDKAFGGIMVGVFSKTSRVD  557

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            ELVKLL+D+K + T+LDERLYR+ALNAL DAGL+++AKWLQ+ +A
Sbjct  558  ELVKLLRDMKLEGTRLDERLYRTALNALMDAGLQVQAKWLQDHYA  602


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/215 (24%), Positives = 96/215 (45%), Gaps = 9/215 (4%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVN  199
            V+++L S   E     Y  ++  Y ++G   +    F+E+E +  D    +   Y  +  
Sbjct  209  VFQRLKSARIEADSGCYCRVMEAYLKLGDSERVMELFNEVESRISDSTPFSTKIYGILCE  268

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K+GR  E+      M+++G   +  IY+ L+        +K  E ++ E K +K++ 
Sbjct  269  SLAKSGRVFESLEFFRDMRKKGIAEDYTIYSALICTFASIQEVKLAEDLYNEAKAKKLLR  328

Query  380  DRVSYTSVISAYSKAKELESC---VKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            D   +  +I  Y +   LE     V+  +DFK+  G +D     I+ G ++     +  V
Sbjct  329  DPAMFLKLILMYVQQGSLEKALEIVEVMKDFKI--GVSDCIFCAIVNG-YATRRGYEAAV  385

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            K+ + L  D  +  +  Y SA+NA    GL  +A+
Sbjct  386  KVYEKLIEDGCEPGQVTYASAINAYCRVGLYSKAE  420


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 76/155 (49%), Gaps = 2/155 (1%)
 Frame = +2

Query  158  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  337
            G   CI  + ++VN Y     ++ A ++  K+ E GCEP    Y + ++ + R     + 
Sbjct  362  GVSDCI--FCAIVNGYATRRGYEAAVKVYEKLIEDGCEPGQVTYASAINAYCRVGLYSKA  419

Query  338  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  517
            E ++ EM+ +      V+Y+S+IS Y K   L+  ++     K  G + +  +  I++ +
Sbjct  420  EDIFGEMEEKGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEM  479

Query  518  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  622
              K   + ++ KL +++K  +   D+  Y S ++A
Sbjct  480  HGKAKNLKQVEKLWKEMKRKKIAPDKVSYTSIISA  514



>ref|XP_008465506.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Cucumis melo]
Length=608

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYEKL+  GCEPGQVTYAS +N YCR+G+YSKAE  F EME+KGFDKC+VA
Sbjct  378  RRGYDAAVKVYEKLIGDGCEPGQVTYASAINAYCRVGLYSKAEDIFGEMEEKGFDKCVVA  437

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSS+++MYGKTGR K+A RL+AKMKE+GC+PNVWIYN L+++HG+A N+KQVEK+WKEMK
Sbjct  438  YSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEMHGKAKNLKQVEKLWKEMK  497

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R+K+ PD+VSYTS+I+AY KA E E C +YY++F++NGG  D+A+ GIMVGVFSK ++VD
Sbjct  498  RKKIAPDKVSYTSIINAYVKASEFEKCEQYYREFRMNGGTIDKAIGGIMVGVFSKTSRVD  557

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            ELVKLL+D+K + T+LDERLYRSALNAL DAGL+++AKWLQ+ +A
Sbjct  558  ELVKLLRDMKLEGTRLDERLYRSALNALMDAGLQVQAKWLQDHYA  602


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/215 (24%), Positives = 96/215 (45%), Gaps = 9/215 (4%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVN  199
            V+++L S   E     Y  ++  Y ++G   +    F+E+E +  +    +   Y  +  
Sbjct  209  VFQRLKSARIEADSGCYFRVMEAYLKLGDSERVMELFNEVESRISNLTPFSTKIYGILCE  268

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K+GR  E+      M+++G   +  IY+ L+        +K  E ++ E K +K++ 
Sbjct  269  SLAKSGRVFESLEFFRDMRKKGIAEDYTIYSALICTFASIREVKLAEDLYNEAKAKKLLR  328

Query  380  DRVSYTSVISAYSKAKELESC---VKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            D   +  +I  Y +   LE     V+  +DFK+  G +D     I+ G ++     D  V
Sbjct  329  DPAMFLKLILMYIQQGSLEKALEIVEVMKDFKI--GVSDCIFCAIVNG-YATRRGYDAAV  385

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            K+ + L  D  +  +  Y SA+NA    GL  +A+
Sbjct  386  KVYEKLIGDGCEPGQVTYASAINAYCRVGLYSKAE  420


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 74/155 (48%), Gaps = 2/155 (1%)
 Frame = +2

Query  158  GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  337
            G   CI  + ++VN Y     +  A ++  K+   GCEP    Y + ++ + R     + 
Sbjct  362  GVSDCI--FCAIVNGYATRRGYDAAVKVYEKLIGDGCEPGQVTYASAINAYCRVGLYSKA  419

Query  338  EKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGV  517
            E ++ EM+ +      V+Y+S+IS Y K   L+  ++     K  G + +  +  I++ +
Sbjct  420  EDIFGEMEEKGFDKCVVAYSSLISMYGKTGRLKDAMRLLAKMKEKGCQPNVWIYNILMEM  479

Query  518  FSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  622
              K   + ++ KL +++K  +   D+  Y S +NA
Sbjct  480  HGKAKNLKQVEKLWKEMKRKKIAPDKVSYTSIINA  514



>ref|XP_011090005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Sesamum indicum]
Length=621

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 193/224 (86%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG + AA VYE+LV QGCEPGQVTYASIL+ Y R+G YSKAE  F+EME+KGFD CIVA
Sbjct  395  KRGAKAAARVYEELVLQGCEPGQVTYASILSAYIRLGRYSKAESVFAEMERKGFDNCIVA  454

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV  Y K GR ++A RLVAKMKERGCEPNVW YN+LLD++GRA N++ VEK WKEMK
Sbjct  455  YSSMVAAYAKMGRTRDAMRLVAKMKERGCEPNVWTYNSLLDMNGRALNLRFVEKTWKEMK  514

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK++PDRVSYT+VISAY++A+E E+CVKYY++FKL GGK DRAMAG MV VFSKMN+V+
Sbjct  515  RRKIIPDRVSYTTVISAYNRAREFETCVKYYEEFKLTGGKMDRAMAGTMVAVFSKMNRVE  574

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            E+++LL+D+K   T+LD R YRSA+NALRDAGL+ +A+WLQE+F
Sbjct  575  EVIELLRDMKLQGTELDARFYRSAMNALRDAGLQSQARWLQETF  618



>gb|KJB35743.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=585

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 194/224 (87%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A  VYE+L+ QGC+PGQVTYASI+N YCRIG+ SKAEM FSEM+QKGFDKC+VA
Sbjct  353  RRGFQSAIVVYEQLILQGCKPGQVTYASIINAYCRIGLNSKAEMVFSEMQQKGFDKCVVA  412

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYGK G  ++A +++A+MK +GC+PNVWIYN+L+D+HGR  N++QVEK+WKEMK
Sbjct  413  YSSMIAMYGKAGMIRDAMKVLAQMKAKGCQPNVWIYNSLMDMHGRVKNLRQVEKLWKEMK  472

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK+ PD+VSYT+VISAY++ +E E CVK+YQ+F+LNGG  D+AMAG MVGVFSK +++D
Sbjct  473  RRKLAPDKVSYTTVISAYNRVRECEMCVKFYQEFRLNGGSIDKAMAGTMVGVFSKTSRID  532

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELV+LLQD+K + T+LD RLY SA+NALRDAGLE + KWLQ++F
Sbjct  533  ELVRLLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNF  576


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 91/219 (42%), Gaps = 3/219 (1%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---Y  184
            R     YE + S G  P   +Y  I+  Y RIG   K    F E E    +   +A   Y
Sbjct  179  RSTIAAYETMKSNGISPDSESYCQIMEAYHRIGDMDKVSSLFDEFESSKLNLTPLAPRAY  238

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            S + +   K+GR  EA      MK++G   +  +Y++L+       ++  VEK+ +E + 
Sbjct  239  SILCDSLAKSGRPYEALEYFGDMKKKGLFVSSLVYSSLIISFASIRDITIVEKLLEEAEE  298

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            RK+V D   +  ++  Y +   LE  +   +       K    +   +V  FSK      
Sbjct  299  RKMVRDPELFLKLVLMYIEEGLLEKTLDVVRVMNDANVKVSDCIFCTIVNGFSKRRGFQS  358

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
             + + + L     K  +  Y S +NA    GL  +A+ +
Sbjct  359  AIVVYEQLILQGCKPGQVTYASIINAYCRIGLNSKAEMV  397



>ref|XP_010043883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85901.1| hypothetical protein EUGRSUZ_B02618 [Eucalyptus grandis]
Length=615

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 197/227 (87%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG   A  VYE L+S+GCEPGQVTYAS+++ YCR+ +YS+AE  FSEME KG+DKC+VA
Sbjct  382  KRGSMAAVRVYETLISRGCEPGQVTYASVISAYCRVRLYSRAEALFSEMETKGYDKCVVA  441

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGK G+ +EA +LVAKMK RGC+PNVW+YNTLL+IHGRA N++QV+K+WKEMK
Sbjct  442  YSSMVAMYGKRGKIREAMKLVAKMKARGCKPNVWVYNTLLEIHGRAKNLRQVDKIWKEMK  501

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R+KV PD+VSYTS+I+AY++A+E E+C+K+Y++F+ NGG  DRAM GIMVGVFSK ++++
Sbjct  502  RKKVAPDKVSYTSLIAAYNRAREFETCIKFYEEFRANGGSIDRAMGGIMVGVFSKSSRIE  561

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++ LQD+K++ T+LD RLY SALNALRD+GL ++A+W QESF++A
Sbjct  562  ELIRFLQDMKSEGTELDGRLYGSALNALRDSGLLVQARWFQESFSMA  608



>ref|XP_007222296.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
 gb|EMJ23495.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
Length=583

 Score =   335 bits (858),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++ LV  GCEPGQVTYASI+N+YCR+G++SKAEM F EME+KGFDKC+VAYSSMV 
Sbjct  363  AVKVFKDLVLMGCEPGQVTYASIINVYCRLGLHSKAEMIFREMEEKGFDKCVVAYSSMVV  422

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR +N++QV K+W EMKRRKV P
Sbjct  423  MYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDNNLRQVSKLWTEMKRRKVAP  482

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D+VSYT+VI AY+KA + E C++YY +F+++GG  D+AMAG+MVGVFSK  +VDELVKLL
Sbjct  483  DKVSYTTVIGAYNKAGDFEMCMRYYHEFRIHGGVLDKAMAGMMVGVFSKTGRVDELVKLL  542

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +D+K++ T LD RLYRSALNAL D+GL+ + KWLQ SF V 
Sbjct  543  RDMKSEGTGLDGRLYRSALNALTDSGLQTQVKWLQGSFKVT  583



>gb|KHN38588.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=601

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG   A  V+E+L+S+G EPGQVTYAS++N Y R+G YSKAE  F EMEQKGFDKC+ A
Sbjct  375  KRGFSAAVKVFEELISKGNEPGQVTYASVINAYWRLGQYSKAEEVFLEMEQKGFDKCVYA  434

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS+M+ MYG+TGR + A +LVAKMKERGC+PNVWIYN+L+D+HGR  N+KQ+EK+WKEMK
Sbjct  435  YSTMIVMYGRTGRVRSAMKLVAKMKERGCKPNVWIYNSLIDMHGRDKNLKQLEKLWKEMK  494

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR+V PD+VSYTS+I AYSKA E E+CVK + ++++NGG  DRA+AGIMVGVFSK+ +VD
Sbjct  495  RRRVAPDKVSYTSIIGAYSKAGEFETCVKLFNEYRMNGGLIDRALAGIMVGVFSKVGQVD  554

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            ELVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++A+W++ESF V 
Sbjct  555  ELVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQARWMKESFLVT  601



>gb|EYU36097.1| hypothetical protein MIMGU_mgv1a020159mg [Erythranthe guttata]
Length=573

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 187/224 (83%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG + A  VYE L+SQGCEPGQVTYAS L+IYCR+G+YSK E  FSEME+KG+  C+VA
Sbjct  348  KRGAKAAVQVYEDLISQGCEPGQVTYASALSIYCRLGLYSKGETVFSEMEKKGYRNCVVA  407

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+  Y KTGR KEA  LVAKMK+RGCEPNVWIYN++LD++GRASNM+ VEK WKEMK
Sbjct  408  YSSMIAAYAKTGRTKEANMLVAKMKQRGCEPNVWIYNSILDMNGRASNMRLVEKTWKEMK  467

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR++VPDRVSYTSVIS Y++ KE + C++YY++FK+ GGK D+AMAG+MV V+SK N+V 
Sbjct  468  RRRIVPDRVSYTSVISGYNRVKEFDKCIEYYEEFKMTGGKIDKAMAGVMVAVYSKTNRVA  527

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELV+LLQD+K +   LD R Y SA++ALRDAGL+++ +WLQE F
Sbjct  528  ELVELLQDMKMEGAVLDARFYSSAMSALRDAGLQVQTRWLQEMF  571



>ref|XP_003529243.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=631

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG   A  V+E+L+S+G EPGQVTYAS++N Y R+G YSKAE  F EMEQKGFDKC+ A
Sbjct  405  KRGFSAAVKVFEELISKGNEPGQVTYASVINAYWRLGQYSKAEEVFLEMEQKGFDKCVYA  464

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS+M+ MYG+TGR + A +LVAKMKERGC+PNVWIYN+L+D+HGR  N+KQ+EK+WKEMK
Sbjct  465  YSTMIVMYGRTGRVRSAMKLVAKMKERGCKPNVWIYNSLIDMHGRDKNLKQLEKLWKEMK  524

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR+V PD+VSYTS+I AYSKA E E+CVK + ++++NGG  DRA+AGIMVGVFSK+ +VD
Sbjct  525  RRRVAPDKVSYTSIIGAYSKAGEFETCVKLFNEYRMNGGLIDRALAGIMVGVFSKVGQVD  584

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            ELVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++A+W++ESF V 
Sbjct  585  ELVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQARWMKESFLVT  631



>ref|XP_010668078.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   333 bits (855),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 193/224 (86%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG +VAA VY++LVSQGCEPGQVTY+SI+N+Y R+ ++ KA+  F EM+++GFDKC+VA
Sbjct  384  KRGLKVAARVYQELVSQGCEPGQVTYSSIINVYFRLALFYKAKKVFDEMQERGFDKCVVA  443

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS+M+ MYGK G+ +EA  L+AKMKE+GCEPNVW+YN L+D HGR  NM+QV+K+WKEMK
Sbjct  444  YSTMIVMYGKMGQLREAMTLLAKMKEKGCEPNVWVYNALIDSHGRVKNMRQVDKIWKEMK  503

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PDRVSYTS+I AYS+A+E E+C  +Y +++ +GG  D A+AGIMVGVFSK+N++D
Sbjct  504  RRKVEPDRVSYTSIIGAYSRAREYETCTIFYDEYRKSGGVIDLALAGIMVGVFSKINRID  563

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            E++KLLQDLK + TK+D RLYRSALNALRDAGL+++ +WL+E+F
Sbjct  564  EIIKLLQDLKAEGTKMDTRLYRSALNALRDAGLQMQVRWLEENF  607


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 47/217 (22%), Positives = 92/217 (42%), Gaps = 4/217 (2%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEME----QKGFDKCIVAY  184
            V   +YEK++S G       Y  I+  Y ++G + K    FSE+E     +  +     Y
Sbjct  210  VTIQLYEKMISSGVVLDSGGYVLIMEAYKKVGNFMKVVEIFSELEGSEQLENVENYTQIY  269

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              +++  G+ G+  +A     +M  +G   N  IY TL+     A  +  VE++ +E + 
Sbjct  270  GILLHALGRLGQSSKALEQYKEMGGKGVPRNASIYATLIGSLAEAKEISMVEQLVEEAES  329

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            ++++ D   +  ++  Y K   LE  +      K    K    +   +V  ++K   +  
Sbjct  330  KQMLKDPALFLKLVIMYVKEGLLERTLDVVNKMKSANLKISDCIFCAIVNGYAKKRGLKV  389

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
              ++ Q+L +   +  +  Y S +N      L  +AK
Sbjct  390  AARVYQELVSQGCEPGQVTYSSIINVYFRLALFYKAK  426


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/182 (19%), Positives = 87/182 (48%), Gaps = 0/182 (0%)
 Frame = +2

Query  77   YASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMK  256
            +  ++ +Y + G+  +     ++M+          + ++VN Y K    K A R+  ++ 
Sbjct  339  FLKLVIMYVKEGLLERTLDVVNKMKSANLKISDCIFCAIVNGYAKKRGLKVAARVYQELV  398

Query  257  ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
             +GCEP    Y+++++++ R +   + +KV+ EM+ R      V+Y+++I  Y K  +L 
Sbjct  399  SQGCEPGQVTYSSIINVYFRLALFYKAKKVFDEMQERGFDKCVVAYSTMIVMYGKMGQLR  458

Query  437  SCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSAL  616
              +      K  G + +  +   ++    ++  + ++ K+ +++K  + + D   Y S +
Sbjct  459  EAMTLLAKMKEKGCEPNVWVYNALIDSHGRVKNMRQVDKIWKEMKRRKVEPDRVSYTSII  518

Query  617  NA  622
             A
Sbjct  519  GA  520



>ref|XP_008220989.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
 ref|XP_008220990.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
Length=615

 Score =   333 bits (854),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++ LV  GCEPGQVTYASI+N+YCR+G++SKAEM F EME+KGFDKC+VAYSSMV 
Sbjct  395  AVKVFKDLVLMGCEPGQVTYASIINVYCRLGLHSKAEMIFREMEEKGFDKCVVAYSSMVV  454

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR +N++QV K+W EMKRRKV P
Sbjct  455  MYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDNNLRQVSKLWTEMKRRKVAP  514

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D+VSYT+VI AY+KA + E C++YY +F+++GG  D+AMAG+MVGVFSK  +VDELVKLL
Sbjct  515  DKVSYTTVIGAYNKAGDFEMCMRYYHEFRIHGGVLDKAMAGMMVGVFSKTGQVDELVKLL  574

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +D+K++ T LD RLYRSALNAL D+GL+ + KWLQ SF V 
Sbjct  575  RDMKSEGTGLDGRLYRSALNALTDSGLQTQVKWLQGSFKVT  615



>ref|XP_008778816.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Phoenix dactylifera]
Length=614

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG + +   Y++ +  GCEPGQVTYASI+N+Y R+G++ KAEM F EM +KGFDKC+VA
Sbjct  381  KRGLKASVWAYDQCIFNGCEPGQVTYASIINVYGRLGLFQKAEMVFLEMMEKGFDKCVVA  440

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS+M++MYGK GR ++A RL+AKMKE+GCEPNV++YN+L+D+HGR  N++QVEKVWKEMK
Sbjct  441  YSNMISMYGKVGRVRDAMRLLAKMKEKGCEPNVYVYNSLIDMHGRRLNLRQVEKVWKEMK  500

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR+V PD++SYTS+ISAY+KA++L+ C+++Y++FK+N GK DRA+AGIMVGVFSK ++ D
Sbjct  501  RRRVXPDKISYTSIISAYNKARKLDECIRFYEEFKMNRGKVDRALAGIMVGVFSKGSRFD  560

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  679
            ELVKLLQD+K++ T LDERLY SALNALRDAGL++  KW ++SF +
Sbjct  561  ELVKLLQDMKSEGTGLDERLYESALNALRDAGLQVHMKWFEKSFGL  606



>ref|XP_003555735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
 gb|KHM98995.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=609

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG   A  V+E+L+S+G E GQVTYAS++N Y R+G YSKAE  F EMEQKGFDKC+ A
Sbjct  383  KRGFLAAVKVFEELISKGYESGQVTYASVINAYWRLGQYSKAEEVFLEMEQKGFDKCVYA  442

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS+M+ MYG+TGR + A +LVAKMKERGC+PNVWIYN+L+D+HGR  N+KQ+EK+WKEMK
Sbjct  443  YSTMIVMYGRTGRVRSAMKLVAKMKERGCKPNVWIYNSLIDMHGRDKNLKQLEKLWKEMK  502

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR+V PD+VSYTS+I AYSKA E E+CVK++ ++++NGG  DRAMAGIMVGVFSK+  VD
Sbjct  503  RRRVAPDKVSYTSIIGAYSKAGEFETCVKFFNEYRMNGGLIDRAMAGIMVGVFSKVGLVD  562

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            ELVKLLQD+K + T+LD+RLY+SA NA +DAGL+I+A+W++ESF V 
Sbjct  563  ELVKLLQDMKAEGTRLDQRLYQSAWNAFKDAGLQIQARWMKESFLVT  609



>ref|XP_002521865.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40501.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=449

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +2

Query  65   GQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLV  244
            G+VTYASI+N YCR G+YSKAEM F EM+ KGFDKC+VAYSS+V MYGKTGR ++A RLV
Sbjct  244  GKVTYASIINAYCRTGLYSKAEMVFLEMQGKGFDKCVVAYSSIVAMYGKTGRTRDAMRLV  303

Query  245  AKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKA  424
            AKMK +GCEPNVWIYN+LLD+HGR  N++QVEK+WKEMKRRKV PD+V+YTSVI+AY+KA
Sbjct  304  AKMKVKGCEPNVWIYNSLLDMHGRVKNLRQVEKLWKEMKRRKVAPDKVTYTSVIAAYNKA  363

Query  425  KELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLY  604
            KE E+CV+YY +++ NGG  D+A+AG+MVGVFSK+ ++DEL+KLLQD+KT+ T+LD RLY
Sbjct  364  KEFETCVRYYHEYRFNGGVIDKAVAGVMVGVFSKIGRIDELLKLLQDIKTEGTQLDGRLY  423

Query  605  RSALNALRDAGLEIRAKWLQESF  673
            RSA NALRDAGL+++AKW+QESF
Sbjct  424  RSAFNALRDAGLQMQAKWMQESF  446



>ref|XP_006420695.1| hypothetical protein CICLE_v10006779mg [Citrus clementina]
 gb|ESR33935.1| hypothetical protein CICLE_v10006779mg [Citrus clementina]
Length=382

 Score =   323 bits (827),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 187/224 (83%), Gaps = 10/224 (4%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L+SQGC PGQVTYASI+N YCRIG+YSKAE  F EM+QKGFDKC+VA
Sbjct  166  RRGYWAAVKVYEQLISQGCIPGQVTYASIINAYCRIGLYSKAEKVFIEMQQKGFDKCVVA  225

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGKTGR ++A RLVAKMK +GCEPNVWIYN+L+D+HGRA N++QVEK+WKEMK
Sbjct  226  YSSMVAMYGKTGRIRDAMRLVAKMKAKGCEPNVWIYNSLMDMHGRAKNLRQVEKLWKEMK  285

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV P+          Y+ A+  +  VK+Y +FK+NGG  DRAMAGIMVGVFSK+++++
Sbjct  286  RRKVTPE----------YNMARGFDMFVKFYNEFKMNGGVIDRAMAGIMVGVFSKLSQIE  335

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            ELVKLL D+K++ TKLDERLY SA+NALRDAGL+++A+WLQ++F
Sbjct  336  ELVKLLGDMKSEGTKLDERLYHSAMNALRDAGLQMQAQWLQQNF  379



>ref|XP_007153172.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
 gb|ESW25166.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
Length=609

 Score =   329 bits (843),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG   A  V+E LVS+G EPGQVTYAS++N Y R+G Y+KAE  F EMEQKGFDKC+ A
Sbjct  383  KRGFLAAVKVFEDLVSKGYEPGQVTYASVINAYWRLGQYNKAEEVFLEMEQKGFDKCVYA  442

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYG+TGR + ATRLVAKMKERGC+PNVWIYN+L+D+HGR  N+KQ+EK+W+EMK
Sbjct  443  YSSMIVMYGRTGRVRSATRLVAKMKERGCKPNVWIYNSLIDMHGRDKNLKQLEKLWREMK  502

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+V+YTS+ISAY+KA E ESC+K + ++++ GG  DRAMAG MVGV++K+ +VD
Sbjct  503  RRKVAPDKVTYTSIISAYNKAGEFESCMKLFDEYRMKGGLIDRAMAGTMVGVYTKVGQVD  562

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +LVKLLQD+KT+ T+LD+RLY+SA NA +DAGL+++AKW++E F VA
Sbjct  563  DLVKLLQDMKTEGTRLDQRLYQSAWNAFKDAGLQLQAKWMKEIFLVA  609



>ref|XP_009351650.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Pyrus x bretschneideri]
Length=608

 Score =   328 bits (840),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E+LVS GC+PGQVTYASI+N+YC +G++SKAE  F EME+KGF KC+VAYSSMV 
Sbjct  388  AVKVFEELVSMGCQPGQVTYASIINVYCSLGLHSKAEKVFEEMEEKGFGKCVVAYSSMVV  447

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR  N++QV ++W EMKRRK+VP
Sbjct  448  MYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDKNLRQVSRIWTEMKRRKIVP  507

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D+VSYT++I AY+KA E E C+KYY +F+++GG  D+A+AG+MVG+FSK  ++DELVKLL
Sbjct  508  DKVSYTTIIGAYNKAGEYEMCMKYYHEFRVHGGVLDKALAGMMVGIFSKTGRIDELVKLL  567

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +D+K + T+LD RLYRSAL AL D+GLE++ KWLQ SF V 
Sbjct  568  RDMKAEGTELDGRLYRSALKALSDSGLEMQVKWLQGSFKVT  608



>ref|XP_004298632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=604

 Score =   327 bits (839),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E L+  GCEPGQVTYAS++N+YCR+G+YSKAEM F EME+KGFDKC+VAYSSMV 
Sbjct  384  AVKVFEDLILMGCEPGQVTYASVINVYCRLGLYSKAEMVFREMEEKGFDKCVVAYSSMVV  443

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGKTGR +EA RLVAKMKERGC+PNVWIYN+L+D++GR +N + V K+W EMKRRKV P
Sbjct  444  MYGKTGRPREAMRLVAKMKERGCKPNVWIYNSLMDMYGRDNNTRHVAKLWSEMKRRKVAP  503

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D+VSYT+VI AY+KA + E C+++Y +++++GG  D+ MA +MVGVFSK  +VDELVKLL
Sbjct  504  DKVSYTTVIGAYNKAGDFEMCLRFYNEYRIHGGVLDKTMAAMMVGVFSKSGRVDELVKLL  563

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +D+K + T LD RLYRSALNAL D+GLE++ KWLQ SF V 
Sbjct  564  RDMKAEGTGLDVRLYRSALNALADSGLEMQVKWLQSSFEVT  604


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/215 (21%), Positives = 96/215 (45%), Gaps = 1/215 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            R   +V+E+++S G  P    Y  I+  Y R G + K    F +++ +  D   ++   +
Sbjct  206  RSTMSVFEEMISAGIGPDSGCYCRIMEAYFRKGDHKKVVELFQDLKSRQLDLTPLSIQIL  265

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVW-IYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
                 K G+  EA  +   + + G   +   IY+ L+       ++K  E+++KE + +K
Sbjct  266  CQSLAKLGKPLEALEIFRSVTKEGVSLDSSKIYSVLISSFASIRDVKVAEELFKEAETKK  325

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            ++ D   +  +I+ Y +   L+  ++  +  K    +    +   +V  FS+ + +   V
Sbjct  326  MLRDPTVFLRLITMYVEEGLLDMTLEVVKAMKGANIRVSDNICCAVVSGFSRKSTLLNAV  385

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            K+ +DL     +  +  Y S +N     GL  +A+
Sbjct  386  KVFEDLILMGCEPGQVTYASVINVYCRLGLYSKAE  420



>ref|XP_008340510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Malus domestica]
Length=608

 Score =   325 bits (832),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E+LVS GC+PGQVTYASI+N+YCR+G++SKAE  F EME+KGF KC+VAYSSMV 
Sbjct  388  AVKVFEELVSMGCQPGQVTYASIINVYCRLGLHSKAEKVFEEMEEKGFGKCVVAYSSMVV  447

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR  N++QV K+W EMKRRK+ P
Sbjct  448  MYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDKNLRQVSKIWTEMKRRKIAP  507

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D+VSYT++I AY+KA E E C+KYY +F++ GG  D+A+AG+MV +FSK  ++DELVKLL
Sbjct  508  DKVSYTTIIGAYNKAGEYEMCMKYYHEFRVQGGVLDKALAGMMVAIFSKTGRIDELVKLL  567

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +D+K +  +LD RLYRSAL AL D+GLE++ KWLQ SF V 
Sbjct  568  RDMKAEGAELDGRLYRSALKALTDSGLEMQVKWLQGSFKVT  608



>ref|XP_009400607.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=614

 Score =   325 bits (832),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 189/224 (84%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG R A   Y +L+S+GCEPGQVTYASI+N+YCR+G+   AE TF+EM  KGFDKC+VA
Sbjct  383  KRGLRSAVAAYGQLLSEGCEPGQVTYASIINVYCRLGLPRMAESTFAEMIDKGFDKCVVA  442

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS+M++MYGK G+ K+A RL+AKMKE+GC+PNVW+YN+LLDIHGR  N++QVEK+W+EMK
Sbjct  443  YSNMISMYGKMGKVKDAMRLLAKMKEKGCKPNVWVYNSLLDIHGRLMNLRQVEKLWQEMK  502

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR++ PD+VSYTS+ISAYSKA+ ++ C+ ++++FK NGGK DRAMAGIMVGVFSK +++D
Sbjct  503  RRQIAPDKVSYTSIISAYSKARRIDECIDFFEEFKGNGGKVDRAMAGIMVGVFSKGSRLD  562

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            EL+KLLQD++   T LD RL+ SALNALRDAGL++     ++SF
Sbjct  563  ELIKLLQDMELAGTGLDARLHESALNALRDAGLQVHMNGFRKSF  606



>ref|XP_006853735.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
 gb|ERN15202.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
Length=616

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG R A   Y+ L+S  C+PGQVTYAS++N+Y R+G+YSKAE  F EM+ +GF++CI+A
Sbjct  383  KRGVRSAIEAYDHLISNSCQPGQVTYASVINLYYRLGLYSKAETIFLEMQNQGFNECIIA  442

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++V +YGKTGR K+A +LVA+MK+ GC PNVW+YN+LLD+HG+A N++QVEK WKEMK
Sbjct  443  YSNVVAIYGKTGRIKDAMKLVAQMKQVGCSPNVWVYNSLLDMHGKAMNLRQVEKTWKEMK  502

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR+V PDRVSYTSVI AYSKA E E C++++++F++NGG+ D+ M GIMVGVFSK N++D
Sbjct  503  RRRVQPDRVSYTSVILAYSKAGECEECMRFFKEFRMNGGRIDKIMGGIMVGVFSKSNRID  562

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            ELV LLQD+K + T LDERL RSA NALRDAGL+ +  WL ESF 
Sbjct  563  ELVTLLQDMKLEGTLLDERLKRSAANALRDAGLQAQVGWLNESFG  607


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 95/214 (44%), Gaps = 5/214 (2%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIV---AYSSMV  196
            +VYEK+   G  P    +  I+  Y ++G        F + E +  D  +     Y+ + 
Sbjct  213  SVYEKMKLAGISPDSNGFYQIMEAYHKLGQPENVMEVFRQFEGQSMDVSMSEKKIYAVLC  272

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +  GK+G+  EA     +M+ +G +P+   Y +L+    +  ++K  E ++KE K + +V
Sbjct  273  DSLGKSGKVDEALGYFREMRAKGIKPDNSFYTSLICSSAKVKDVKLAETLFKEGKSKGLV  332

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFK-LNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
             D   +  ++  Y +   ++  +      K LN   +D  +  I+ G ++K   V   ++
Sbjct  333  KDPSIFLKLVLMYIEVGLVDKTLGIVDSMKELNIRVSDCVLCAIVNG-YAKKRGVRSAIE  391

Query  554  LLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
                L ++  +  +  Y S +N     GL  +A+
Sbjct  392  AYDHLISNSCQPGQVTYASVINLYYRLGLYSKAE  425



>dbj|BAB10598.1| unnamed protein product [Arabidopsis thaliana]
Length=563

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE  + + CE GQVTYA  +N YCR+  Y+KAEM F EM +KGFDKC+VA
Sbjct  320  QRGFAEAVKVYEWAMKEECEAGQVTYAIAINAYCRLEKYNKAEMLFDEMVKKGFDKCVVA  379

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A RL+AKMK+RGC+PN+WIYN+L+D+HGRA ++++ EK+WKEMK
Sbjct  380  YSNIMDMYGKTRRLSDAVRLMAKMKQRGCKPNIWIYNSLIDMHGRAMDLRRAEKIWKEMK  439

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  440  RAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  499

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  500  ELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  546



>gb|KFK25604.1| hypothetical protein AALP_AA8G136200 [Arabis alpina]
Length=606

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 186/227 (82%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE L  Q CE GQVTYA I+N YCR+  Y KAE  F +M +KGFDKC+VA
Sbjct  361  QRGFAEAVRVYEWLTKQECEAGQVTYAIIINAYCRLQEYDKAETLFEDMVKKGFDKCVVA  420

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A +L+AKMK+RGC PN+WIYN+L+D+HGRA ++++VEK+WKEMK
Sbjct  421  YSNIMDMYGKTRRLSDAVKLMAKMKQRGCRPNIWIYNSLIDMHGRAMDLRRVEKIWKEMK  480

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R +V+PD+VSYTS+ISAY++AKE E CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  481  RMRVLPDKVSYTSMISAYNRAKEFEQCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  540

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD+K + TKLD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  541  ELMRLLQDMKAERTKLDVRLYTSALNALRDAGLNSQIRWLQESFDSA  587



>ref|XP_004498165.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
 ref|XP_004517308.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
Length=632

 Score =   315 bits (807),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   +  V+EKL+ QG EPGQVTYASI+N Y R+G   KAE  FSEMEQKGFDKC+VA
Sbjct  406  RRGFSSSVKVFEKLIFQGYEPGQVTYASIINAYIRLGQNIKAEKVFSEMEQKGFDKCVVA  465

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYGKTGR   A RLVAKMKERGC+PNVWIYN+L+D+HG+  N++Q+EK+WKEMK
Sbjct  466  YSSMIVMYGKTGRLSNAMRLVAKMKERGCKPNVWIYNSLIDMHGKEKNLRQLEKLWKEMK  525

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+++YTS+I AY K  E + C++ Y +++LN G  D+AMAG MVGV+SK+ +VD
Sbjct  526  RRKVAPDKITYTSIIGAYCKIGEFDKCIELYNEYRLNKGVIDKAMAGTMVGVYSKVGQVD  585

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            ELVKLLQD+K++ T+LD+RLY+SA NA  +AG++++ KW++ESF V 
Sbjct  586  ELVKLLQDMKSEGTRLDQRLYQSAWNAFAEAGMQVQVKWMKESFHVT  632



>ref|NP_196881.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q66GP4.1|PP379_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAU05481.1| At5g13770 [Arabidopsis thaliana]
 gb|AAU95422.1| At5g13770 [Arabidopsis thaliana]
 gb|AED91939.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=609

 Score =   314 bits (805),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE  + + CE GQVTYA  +N YCR+  Y+KAEM F EM +KGFDKC+VA
Sbjct  366  QRGFAEAVKVYEWAMKEECEAGQVTYAIAINAYCRLEKYNKAEMLFDEMVKKGFDKCVVA  425

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A RL+AKMK+RGC+PN+WIYN+L+D+HGRA ++++ EK+WKEMK
Sbjct  426  YSNIMDMYGKTRRLSDAVRLMAKMKQRGCKPNIWIYNSLIDMHGRAMDLRRAEKIWKEMK  485

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  546  ELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  592



>ref|XP_010547300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Tarenaya hassleriana]
Length=632

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 189/229 (83%), Gaps = 1/229 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLV-SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIV  178
            ++G   A  VYE L+  + CEPGQVTYA I+N YCR+ +Y KAE +F EME+KGFDKC+V
Sbjct  386  QKGFGSAIRVYENLIEHEECEPGQVTYALIINAYCRLELYDKAEKSFEEMERKGFDKCVV  445

Query  179  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  358
            AYS+MV+MYGKT R  +A +LVAKMK +GC+PN+++YN+L+D+H RA N+++VEK+WKEM
Sbjct  446  AYSNMVDMYGKTRRLSDAMKLVAKMKLKGCKPNIYVYNSLIDMHARAKNVRRVEKIWKEM  505

Query  359  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  538
            KR KVVPD+V+YTS+ISAY+K KE E CV+ Y +F++N G+ DRAMAGIMVGVFSK+++ 
Sbjct  506  KRMKVVPDKVTYTSMISAYNKTKEFERCVELYHEFRMNRGEIDRAMAGIMVGVFSKISRF  565

Query  539  DELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  685
            DEL++LLQD+K   T+LD RLY SALNALRDAGL+++ +WLQE+F   T
Sbjct  566  DELMRLLQDMKVQGTRLDGRLYSSALNALRDAGLQVQIRWLQENFEATT  614


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 92/204 (45%), Gaps = 5/204 (2%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA----YSSM  193
            TV+E++ S G +P    Y  ++    RIG   K    F E+  K     ++     Y  +
Sbjct  215  TVFERMRSAGIDPSFGCYCKVMEANKRIGNPDKVLELFQEVRSKNMSFLMMESGHMYVIL  274

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
             +   K+GR  EA +   +M E+G   N  +Y+T++     A  ++ VE+++ E   +K+
Sbjct  275  CSSLAKSGRVSEALKHFEEMMEKGIPANPALYSTMICAFAAAREVEIVEELFGEAAEKKM  334

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
            + D      V+  Y + +E+E       + + +  +    +   +V  FSK       ++
Sbjct  335  LTDPEMCLKVVLMYIQEREMEKTPDVVSEMRKSKVRVTDCILCAIVNGFSKQKGFGSAIR  394

Query  554  LLQDL-KTDETKLDERLYRSALNA  622
            + ++L + +E +  +  Y   +NA
Sbjct  395  VYENLIEHEECEPGQVTYALIINA  418



>ref|XP_006576030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=258

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            K G  V   V+++L+ +G E GQVTYAS++N Y  +  YSKAE  F EMEQKGFDKC+ A
Sbjct  32   KIGILVMVKVFKELIFKGYESGQVTYASVINAYFHLEQYSKAEEVFLEMEQKGFDKCVYA  91

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS+M+ MYG+ GR   A +LVAKMK+RGC+PNVWIYN+L+D+H R +N+KQ+EK+WKEMK
Sbjct  92   YSTMIVMYGRMGRVTSAMKLVAKMKQRGCKPNVWIYNSLIDMHRRDNNLKQLEKLWKEMK  151

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR+V PD+VSYT++I AYSKA E E+CVK + ++++NGG  DRAMAGIMVGVFSK+  VD
Sbjct  152  RRRVAPDKVSYTTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVGVFSKVGLVD  211

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL+KLLQD+K +  +LD+RLY+SA NA +D GL+I+A+W++E F V 
Sbjct  212  ELLKLLQDMKAEGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT  258



>ref|XP_010492155.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Camelina sativa]
Length=614

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE  + Q CE GQVTYA  +N YCR+  Y KAEM F+EM +KGFDKC+VA
Sbjct  363  QRGFAEAIRVYEWAMKQECEAGQVTYAIAINAYCRLEKYDKAEMLFNEMVKKGFDKCVVA  422

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++VEK+WKEMK
Sbjct  423  YSNIMDMYGKTRRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAMDIRRVEKIWKEMK  482

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+ISAY++AKELE C++ YQ+F++N GK DRAM GIMVGVFSK +++D
Sbjct  483  RAKVLPDKVSYTSMISAYNRAKELERCMELYQEFRMNRGKIDRAMGGIMVGVFSKTSRID  542

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  543  ELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  589


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 90/203 (44%), Gaps = 5/203 (2%)
 Frame = +2

Query  29   VYEKLVSQGC-EPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD----KCIVAYSSM  193
            V++++   G  EP    Y  I+  + RIG   K    F E + +       +    Y+ +
Sbjct  192  VFDRMKQSGAVEPSPGCYCRIMEAHERIGDKQKVVELFQEFKSQRLSFLAKESGSIYTIL  251

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
             +   K+GR  EA  ++ +MK++G   +  +Y+TL+     A  ++  EK++KE  R+K+
Sbjct  252  CSSLAKSGRAIEALEVLEEMKDKGIPESSELYSTLIRAFAEALEVEIAEKLFKEAGRKKL  311

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
            + D      V+  Y +  ++E  ++     +    K    +   +V  F K     E ++
Sbjct  312  LKDPEMCLKVVLMYVREGKMERTLEVVAAMRKAELKVTDCILCAIVNGFCKQRGFAEAIR  371

Query  554  LLQDLKTDETKLDERLYRSALNA  622
            + +     E +  +  Y  A+NA
Sbjct  372  VYEWAMKQECEAGQVTYAIAINA  394



>ref|XP_006289562.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
 gb|EOA22460.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
Length=612

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 187/227 (82%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE  + Q CE GQVTYA  +N YCRI  Y KAE  F EM +KGFDKC+VA
Sbjct  367  QRGFAEAVRVYEWAMKQECEAGQVTYAIAINAYCRIEKYDKAENLFDEMVKKGFDKCVVA  426

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++VEK+WKEMK
Sbjct  427  YSNIMDMYGKTRRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAMDIRRVEKIWKEMK  486

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+ISAY++AKEL+ CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  487  RAKVLPDKVSYTSMISAYNRAKELDRCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  546

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  547  ELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  593



>gb|KHN48767.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=221

 Score =   299 bits (766),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V+++L+ +G E GQVTYAS++N Y  +  YSKAE  F EMEQKGFDKC+ AYS+M+ MYG
Sbjct  4    VFKELIFKGYESGQVTYASVINAYFHLEQYSKAEEVFLEMEQKGFDKCVYAYSTMIVMYG  63

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + GR   A +LVAKMK+RGC+PNVWIYN+L+D+H R +N+KQ+EK+WKEMKRR+V PD+V
Sbjct  64   RMGRVTSAMKLVAKMKQRGCKPNVWIYNSLIDMHRRDNNLKQLEKLWKEMKRRRVAPDKV  123

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SYT++I AYSKA E E+CVK + ++++NGG  DRAMAGIMVGVFSK+  VDEL+KLLQD+
Sbjct  124  SYTTIIGAYSKAGEFETCVKLFNEYRMNGGLIDRAMAGIMVGVFSKVGLVDELLKLLQDM  183

Query  569  KTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            K +  +LD+RLY+SA NA +D GL+I+A+W++E F V 
Sbjct  184  KAEGKRLDQRLYQSAWNAFKDVGLQIQARWMKEIFFVT  221



>ref|XP_002871585.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47844.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=609

 Score =   311 bits (798),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 186/227 (82%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE  + Q CE GQVTYA  +N YCR+    KAEM F EM +KGFDKC+VA
Sbjct  366  QRGFAEAIKVYEWAMKQECEAGQVTYAIAINAYCRLEQDDKAEMLFDEMVKKGFDKCVVA  425

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++ EK+WKEMK
Sbjct  426  YSNIMDMYGKTQRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAKDLRRAEKIWKEMK  485

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+ISAY++AKELE CV+ YQ+F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RAKVLPDKVSYTSMISAYNRAKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  546  ELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  592



>emb|CDX91096.1| BnaC02g05010D [Brassica napus]
Length=613

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A   YE L  Q CE GQVTYA  +N YCR+  + KAE  F EM +KGFDKC+VA
Sbjct  366  QRGFAEAVKAYEWLKKQECEAGQVTYAITINAYCRLEEHDKAEKLFEEMVKKGFDKCVVA  425

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A +L+AKMK+RGC PN+WIYN+L+D+HGRA ++++VEK+WKEMK
Sbjct  426  YSNIIDMYGKTRRLSDAVKLMAKMKQRGCRPNIWIYNSLIDMHGRAMDLRRVEKIWKEMK  485

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+ISAY++AKE E+CV+ Y +F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RMKVLPDKVSYTSMISAYNRAKEFETCVELYHEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD++ + T+LD RLY SALNALRDAGL  + +WLQESF +A
Sbjct  546  ELMRLLQDMRVERTRLDARLYSSALNALRDAGLNSQIRWLQESFDIA  592


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 87/203 (43%), Gaps = 5/203 (2%)
 Frame = +2

Query  29   VYEKL-VSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD----KCIVAYSSM  193
            V+++L  S G EP    Y  I+  + RIG   K    F E   K       +    Y+ +
Sbjct  195  VFDRLKQSVGVEPSPGCYCRIMEAHERIGDSQKVVELFQEFNSKRLSFLAKESGSIYTVL  254

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
             +   ++GR  EA   + +MK++G   +  +Y+TL+     A  +  VEK++K+   +K+
Sbjct  255  CSSLARSGRALEALEFLEEMKDKGIPQSSALYSTLIRALAEAREVVVVEKLFKDAGEKKM  314

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
            + D      V+  Y +   +E  ++     +    K    +   +V  F K     E VK
Sbjct  315  LKDPEMCLKVVLMYVREGNMERTLEVVAAMRKGELKVTDCILCAIVNGFCKQRGFAEAVK  374

Query  554  LLQDLKTDETKLDERLYRSALNA  622
              + LK  E +  +  Y   +NA
Sbjct  375  AYEWLKKQECEAGQVTYAITINA  397



>ref|XP_010453475.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g13770, chloroplastic-like [Camelina sativa]
Length=602

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE  + Q CE GQVTYA  +N YCR+  Y KAEM F EM +KGFDKC+VA
Sbjct  363  QRGFAEAIKVYEWAMKQECEAGQVTYAIAINAYCRLEKYDKAEMLFDEMVKKGFDKCVVA  422

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++VEK+WKEMK
Sbjct  423  YSNIMDMYGKTRRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAMDIRRVEKIWKEMK  482

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+ISAY++AKELE C++ YQ+F+++ G+ DRAMAGIMVGVFSK +++D
Sbjct  483  RAKVLPDKVSYTSMISAYNRAKELERCMELYQEFRMSRGEIDRAMAGIMVGVFSKTSRID  542

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  543  ELMRLLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAA  589



>ref|XP_006399876.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
 gb|ESQ41329.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
Length=611

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 183/227 (81%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A   YE L  Q CE GQVTYA  +N YCR+  Y KAEM F EM  KGFDKC+VA
Sbjct  366  QRGFAEAVRAYEWLKKQECEAGQVTYAITINAYCRLEEYEKAEMLFDEMVNKGFDKCVVA  425

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A +L+AKMK+RGC+PN+WIYN+L+D+HGRA ++++VEK+WKEMK
Sbjct  426  YSNIIDMYGKTRRLSDAVKLMAKMKQRGCKPNIWIYNSLIDMHGRAMDLRRVEKIWKEMK  485

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+I A ++AKELE CV+ Y +F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RMKVLPDKVSYTSMIGACNRAKELERCVELYNEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD+K + TKLD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  546  ELMRLLQDMKVERTKLDARLYSSALNALRDAGLNSQIRWLQESFDTA  592


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/194 (25%), Positives = 84/194 (43%), Gaps = 4/194 (2%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD----KCIVAYSSMVNMYGKTGR  220
            G EP    Y  I+  + RIG   K    F E + K       +    Y+ +     K+GR
Sbjct  204  GVEPSPGCYCRIMEAHERIGDNQKVVELFQEFKSKRLSFLAKESGSIYTILCTSLAKSGR  263

Query  221  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  400
              EA   + +MK++G +    +Y+TL+     A  +  VEK++KE   +K++ D      
Sbjct  264  AFEALEFLEEMKDKGIQETSALYSTLIRALAGAREVTTVEKLFKEAGEKKLLKDPEMCLK  323

Query  401  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  580
            V+  Y +  ++E  ++     + N  +    +   +V  FSK     E V+  + LK  E
Sbjct  324  VVLMYVREGKMERTLEVVAAMRKNDLRVSDCILCAIVNGFSKQRGFAEAVRAYEWLKKQE  383

Query  581  TKLDERLYRSALNA  622
             +  +  Y   +NA
Sbjct  384  CEAGQVTYAITINA  397



>ref|XP_009125945.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brassica rapa]
 emb|CDX85626.1| BnaA02g01870D [Brassica napus]
Length=613

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 183/227 (81%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A   YE L  Q CE GQVTYA  +N YCR+  + KAE  F EM  KGFDKC+VA
Sbjct  366  QRGFTEAVKAYEWLTKQECEAGQVTYAITINAYCRLEEHDKAEKLFEEMVNKGFDKCVVA  425

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YS++++MYGKT R  +A +L+AKMK+RGC PN+WIYN+L+D+HGR  ++++VEK+WKEMK
Sbjct  426  YSNIIDMYGKTRRLSDAVKLMAKMKQRGCRPNIWIYNSLIDMHGRGMDLRRVEKIWKEMK  485

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R KV+PD+VSYTS+ISAY++AKE E+CV+ Y +F++N GK DRAMAGIMVGVFSK +++D
Sbjct  486  RMKVLPDKVSYTSMISAYNRAKEFEACVELYHEFRMNRGKIDRAMAGIMVGVFSKTSRID  545

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            EL++LLQD++ + T+LD RLY SALNALRDAGL  + +WLQESF +A
Sbjct  546  ELMRLLQDMRVERTRLDARLYSSALNALRDAGLNSQIRWLQESFDIA  592


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/202 (24%), Positives = 86/202 (43%), Gaps = 4/202 (2%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD----KCIVAYSSMV  196
            V++++  Q  EP    Y  I+  + RIG   K    F E + K       +    Y+ + 
Sbjct  196  VFDRMKQQEVEPSPGCYCRIMEAHERIGDSQKVVELFQEFKSKRLSFLAKESGSIYTVLC  255

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +   K+GR  EA   + +MK++G   +  +Y+TL+     A  +  VEK++KE   +K++
Sbjct  256  SSLAKSGRALEALEFLEEMKDKGIPQSSALYSTLIRALAEAREVMVVEKLFKEAGEKKML  315

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
             D      V+  Y +   +E  ++     +    K    +   +V  F K     E VK 
Sbjct  316  KDPEMCLKVVLMYVREGNMERTLEVVAAMRKGELKVTDCILCAIVNGFCKQRGFTEAVKA  375

Query  557  LQDLKTDETKLDERLYRSALNA  622
             + L   E +  +  Y   +NA
Sbjct  376  YEWLTKQECEAGQVTYAITINA  397



>gb|KEH40726.1| PPR containing plant-like protein [Medicago truncatula]
Length=605

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 184/227 (81%), Gaps = 0/227 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG      ++EKL+ +G EPGQVTYAS++N+YCR+G   KAE  F EM QKGFDKC+VA
Sbjct  379  RRGFSSTVKIFEKLILKGYEPGQVTYASMINVYCRLGQNIKAEKIFDEMMQKGFDKCVVA  438

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSM+ MYG+TGR + A +LVAKMKE+GC+PNVWIYN+L+D+HG+  N++Q+EK+W EMK
Sbjct  439  YSSMIVMYGRTGRLRNAMKLVAKMKEKGCKPNVWIYNSLIDMHGKEKNLRQIEKLWNEMK  498

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+++YTS+I AY KA+E + C+K Y +++LN G  D+AMAG MVGV+SK+  VD
Sbjct  499  RRKVAPDKITYTSIIGAYCKAQEFDKCIKLYNEYRLNKGAIDKAMAGTMVGVYSKVGMVD  558

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            ELVKLLQD+K + T+LD+RLY+SA NA  +AG++++ KW++ESF V 
Sbjct  559  ELVKLLQDMKMEGTRLDQRLYQSAWNAFTEAGMQLQVKWMKESFIVT  605



>gb|ABK95746.1| unknown [Populus trichocarpa]
Length=184

 Score =   295 bits (754),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  131  MTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIH  310
            M FSEME+KGFDKC+VAYSSM++MYGKTGR ++ATRLVAKMK +GCEPNVWIYN+LLD+H
Sbjct  1    MVFSEMEEKGFDKCVVAYSSMISMYGKTGRARDATRLVAKMKLKGCEPNVWIYNSLLDMH  60

Query  311  GRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDR  490
            GRA N++QVEK+WKEMKRRKV PD+V+Y+SVISAY+K+KE E CV+YY ++++NGG  D 
Sbjct  61   GRAKNLRQVEKLWKEMKRRKVAPDKVTYSSVISAYNKSKEYEMCVRYYHEYRINGGVIDG  120

Query  491  AMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  670
            AMAGIM GVFSK++++DELVKLL+D+K++ T +DERLYRSA NA+RDAGL+I+AKWLQ+S
Sbjct  121  AMAGIMAGVFSKISRIDELVKLLRDMKSEGTPIDERLYRSATNAMRDAGLDIQAKWLQDS  180

Query  671  F  673
            F
Sbjct  181  F  181



>ref|XP_011025175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Populus euphratica]
Length=603

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 183/218 (84%), Gaps = 2/218 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L   GCEPGQVTYAS++N YCR+G+YSKAE+ F EME KGFDKC+VA
Sbjct  386  RRGFDAAVKVYEELKYDGCEPGQVTYASVINAYCRVGLYSKAEIVFFEMEAKGFDKCVVA  445

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSS+++MYGKTGR ++A RLVAKMK +GC+PN WIYN+L+D+HGRA ++++VEK+WKEMK
Sbjct  446  YSSIISMYGKTGRPRDAMRLVAKMKLKGCQPNTWIYNSLVDMHGRAKDLRRVEKLWKEMK  505

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+V+YTS+ISAYSK+KE E CV+++ ++++NGG  D A+AGIMVGVFSK++++D
Sbjct  506  RRKVAPDKVTYTSIISAYSKSKEYEMCVRFFHEYRINGGVIDGAIAGIMVGVFSKISRID  565

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            EL+KLL+D+K++   +DERLY SA NA+     E+R K
Sbjct  566  ELLKLLRDMKSEGAPIDERLYISATNAM--VAKELRGK  601


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/215 (23%), Positives = 98/215 (46%), Gaps = 5/215 (2%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMY  205
            +V EK+   G       Y   +  + ++G   +    F+E E +  D   +  S M  + 
Sbjct  214  SVQEKMKLAGIPLDSGCYFQTMKAHHKLGDAGRVVEMFNEFESRKIDSKPMILSQMYKIL  273

Query  206  ----GKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
                G++G+  EA      MK++G   +  IY++L+        +K  E+++KE + +++
Sbjct  274  CESLGRSGQVFEALEYFRDMKKKGILEDSSIYSSLICSLVNIREVKLAEELYKEAQEKRM  333

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGG-KTDRAMAGIMVGVFSKMNKVDELV  550
            + D  ++  ++  Y +  ++E  V+  ++ K     K    +   +V  FSK    D  V
Sbjct  334  LKDPETFLKLVLIYMEEGQMEKTVQIVKEMKGTAKLKVSDCIFCAIVNGFSKRRGFDAAV  393

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            K+ ++LK D  +  +  Y S +NA    GL  +A+
Sbjct  394  KVYEELKYDGCEPGQVTYASVINAYCRVGLYSKAE  428


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/186 (24%), Positives = 85/186 (46%), Gaps = 5/186 (3%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVNMYGKTGRHKEATRLV  244
            T+  ++ IY   G   K      EM  KG  K  V+   + ++VN + K      A ++ 
Sbjct  339  TFLKLVLIYMEEGQMEKTVQIVKEM--KGTAKLKVSDCIFCAIVNGFSKRRGFDAAVKVY  396

Query  245  AKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKA  424
             ++K  GCEP    Y ++++ + R     + E V+ EM+ +      V+Y+S+IS Y K 
Sbjct  397  EELKYDGCEPGQVTYASVINAYCRVGLYSKAEIVFFEMEAKGFDKCVVAYSSIISMYGKT  456

Query  425  KELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLY  604
                  ++     KL G + +  +   +V +  +   +  + KL +++K  +   D+  Y
Sbjct  457  GRPRDAMRLVAKMKLKGCQPNTWIYNSLVDMHGRAKDLRRVEKLWKEMKRRKVAPDKVTY  516

Query  605  RSALNA  622
             S ++A
Sbjct  517  TSIISA  522



>ref|XP_002312498.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
 gb|EEE89865.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
Length=603

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 183/218 (84%), Gaps = 2/218 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG   A  VYE+L   GCEPGQVTYAS++N YCR+G+YSKAE+ F EME KGFDKC+VA
Sbjct  386  RRGFDAAVKVYEELKYDGCEPGQVTYASVINAYCRVGLYSKAEVVFFEMEAKGFDKCVVA  445

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSS+++MYGKTGR ++A RLVAKMK +GC+PN WIYN+L+D+HGRA ++++VEK+WKEMK
Sbjct  446  YSSIISMYGKTGRPRDAMRLVAKMKLKGCQPNTWIYNSLVDMHGRAKDLRRVEKLWKEMK  505

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD+V+YTS+ISAYSK+KE E CV+++ ++++NGG  D A+AGIMVGVFSK++++D
Sbjct  506  RRKVAPDKVTYTSIISAYSKSKEYEMCVRFFHEYRINGGVIDGAIAGIMVGVFSKISRID  565

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            EL+KLL+D+K++   +DERLY SA NA+     E+R K
Sbjct  566  ELLKLLRDMKSEGAPIDERLYVSATNAM--VAKELRGK  601


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 98/215 (46%), Gaps = 5/215 (2%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMY  205
            +V+EK+   G       Y   +    ++G   +    F+E E +  D   +  S M  + 
Sbjct  214  SVHEKMKLAGIPLDSGCYFQTMKARHKLGDAERVVEMFNEFESRKIDSKPMILSQMYKIL  273

Query  206  ----GKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
                G++G+  EA      MK++G   +  +Y++L+        +K  E+++KE + +++
Sbjct  274  CESLGRSGQVFEALEYFRDMKKKGILEDSSMYSSLICSLVNIREVKLAEELYKEAQEKRM  333

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGG-KTDRAMAGIMVGVFSKMNKVDELV  550
            + D  ++  ++  Y +  ++E  V+  ++ K     K    +   +V  FSK    D  V
Sbjct  334  LKDPETFLKLVLIYMEEGQMEKTVEIVKEMKGTAKLKVSDCIFCAVVNGFSKRRGFDAAV  393

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            K+ ++LK D  +  +  Y S +NA    GL  +A+
Sbjct  394  KVYEELKYDGCEPGQVTYASVINAYCRVGLYSKAE  428


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/186 (24%), Positives = 85/186 (46%), Gaps = 5/186 (3%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVNMYGKTGRHKEATRLV  244
            T+  ++ IY   G   K      EM  KG  K  V+   + ++VN + K      A ++ 
Sbjct  339  TFLKLVLIYMEEGQMEKTVEIVKEM--KGTAKLKVSDCIFCAVVNGFSKRRGFDAAVKVY  396

Query  245  AKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKA  424
             ++K  GCEP    Y ++++ + R     + E V+ EM+ +      V+Y+S+IS Y K 
Sbjct  397  EELKYDGCEPGQVTYASVINAYCRVGLYSKAEVVFFEMEAKGFDKCVVAYSSIISMYGKT  456

Query  425  KELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLY  604
                  ++     KL G + +  +   +V +  +   +  + KL +++K  +   D+  Y
Sbjct  457  GRPRDAMRLVAKMKLKGCQPNTWIYNSLVDMHGRAKDLRRVEKLWKEMKRRKVAPDKVTY  516

Query  605  RSALNA  622
             S ++A
Sbjct  517  TSIISA  522



>ref|XP_008350824.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like, partial [Malus domestica]
Length=585

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +E LVS GC+PGQVTYASI+N+YCR+G+ SKAEM F EME+KGF KC VAYSSMV 
Sbjct  388  AVKFFEDLVSMGCQPGQVTYASIINVYCRLGLNSKAEMVFEEMEEKGFGKCAVAYSSMVV  447

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGKTGR ++A RLVAKMKERGC+PNVWIYN+L+D+HGR  N++QV K+W  MKRRKVVP
Sbjct  448  MYGKTGRPRDAMRLVAKMKERGCKPNVWIYNSLMDMHGRDKNLRQVSKIWTXMKRRKVVP  507

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D+VSYT+VISAY+KA E E C+KYY +F+++GG  D+A+AG+MVG+FSK  ++DELVKLL
Sbjct  508  DKVSYTTVISAYNKAGEFEMCMKYYHEFRVHGGVLDKALAGMMVGIFSKTGRIDELVKLL  567

Query  560  QDLKTDETKLDERLYRSA  613
            +D+K++   LD RLYRSA
Sbjct  568  RDMKSEGMALDGRLYRSA  585



>emb|CCI55317.1| PH01B001I13.13 [Phyllostachys edulis]
Length=636

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KLV+ GCEPGQVTYAS++N+YCR+G   +AE  FSEM  +G+DKC+VA
Sbjct  374  RRGLKPAIRAYDKLVALGCEPGQVTYASVINVYCRLGRSDRAESIFSEMIDRGYDKCVVA  433

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYGK  R  +A RL+A MK++GCEPNVW+YN+LLD+HGR  + +Q EK+WKEM 
Sbjct  434  YGNMISMYGKIRRASDAMRLLALMKQKGCEPNVWVYNSLLDMHGRLGDSRQAEKIWKEMM  493

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RR V PDRVSYT++ISA++++ EL+ C+  YQ+F+  GGK D+A+AG+M GVFSK ++ +
Sbjct  494  RRTVQPDRVSYTAIISAFNRSGELDRCMDLYQEFRETGGKVDKALAGLMAGVFSKCSRFN  553

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            EL+ LL+D+K +  KLD RLY S LN+LR+AGLE+  KWLQ +F+
Sbjct  554  ELIDLLKDMKLEGAKLDRRLYMSVLNSLREAGLEVHVKWLQSNFS  598



>gb|EAY95290.1| hypothetical protein OsI_17116 [Oryza sativa Indica Group]
Length=608

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KL++ GCEPGQVTYAS++N+YC++G   +AE  FSEM  +GFDKC+VA
Sbjct  380  RRGLKPAIRAYDKLIALGCEPGQVTYASVINVYCQLGRSDRAESVFSEMIDRGFDKCVVA  439

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYGK  R  +A RL+A MK++GCEPN+W+YN+LLD+HGR  N +Q EK+WKEM 
Sbjct  440  YGNMISMYGKISRASDAMRLLAVMKKKGCEPNIWVYNSLLDMHGRLGNSRQAEKIWKEMM  499

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK+ PDR+SYT++I+A++++ EL+ C+  YQ+F+  GGK D A+AG+MVGVFSK ++ +
Sbjct  500  RRKIQPDRISYTAIINAFNRSGELDRCMDLYQEFRETGGKVDTALAGLMVGVFSKCSRFN  559

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            EL++LL+D++   T+LD RLY + L +LRDAGLE+  KWLQ +F+
Sbjct  560  ELIELLKDMQG--TRLDRRLYLTVLRSLRDAGLEVHVKWLQTNFS  602



>ref|NP_001174064.1| Os04g0583150 [Oryza sativa Japonica Group]
 emb|CAE04154.2| OSJNBa0088A01.11 [Oryza sativa Japonica Group]
 gb|EAZ31756.1| hypothetical protein OsJ_15910 [Oryza sativa Japonica Group]
 dbj|BAG89668.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92792.1| Os04g0583150 [Oryza sativa Japonica Group]
Length=606

 Score =   291 bits (744),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KL++ GCEPGQVTYAS++N+YC++G   +AE  FSEM  +GFDKC+VA
Sbjct  378  RRGLKPAIRAYDKLIALGCEPGQVTYASVINVYCQLGRSDRAESVFSEMIDRGFDKCVVA  437

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYGK  R  +A RL+A MK++GCEPN+W+YN+LLD+HGR  N +Q EK+WKEM 
Sbjct  438  YGNMISMYGKISRASDAMRLLAVMKKKGCEPNIWVYNSLLDMHGRLGNSRQAEKIWKEMM  497

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRK+ PDR+SYT++I+A++++ EL+ C+  YQ+F+  GGK D A+AG+MVGVFSK ++ +
Sbjct  498  RRKIQPDRISYTAIINAFNRSGELDRCMDLYQEFRETGGKVDTALAGLMVGVFSKCSRFN  557

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            EL++LL+D++   T+LD RLY + L +LRDAGLE+  KWLQ +F+
Sbjct  558  ELIELLKDMQG--TRLDRRLYLTVLRSLRDAGLEVHVKWLQTNFS  600



>ref|NP_001142291.1| uncharacterized protein LOC100274460 [Zea mays]
 gb|ACF78649.1| unknown [Zea mays]
 gb|ACF88108.1| unknown [Zea mays]
Length=419

 Score =   283 bits (724),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 174/224 (78%), Gaps = 2/224 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KLV  GCEPGQVTYAS++N+YCR+G   +AE  FSEM ++GFD+C+VA
Sbjct  191  RRGLKPAIRAYDKLVLIGCEPGQVTYASVINVYCRLGRSDRAEAIFSEMIERGFDRCVVA  250

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYGK  R  EATRL+A MK++GCEPNV +YN+LLD+HGR  N KQ EK+WKEM 
Sbjct  251  YGNMISMYGKIRRASEATRLLALMKQKGCEPNVLVYNSLLDMHGRLGNSKQAEKIWKEMV  310

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D  MAG+MVGV SK ++ +
Sbjct  311  RRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDMVMAGLMVGVLSKTSRFN  370

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  371  ELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  412



>gb|EMT31983.1| hypothetical protein F775_29312 [Aegilops tauschii]
Length=609

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 175/224 (78%), Gaps = 0/224 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KLV+ GCEPGQVTYAS +N+YCR+G   +AE  FSEM  +GFDKC+VA
Sbjct  379  RRGLKPAIRAYDKLVAMGCEPGQVTYASAINVYCRLGRSDRAESVFSEMIDRGFDKCVVA  438

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYG+  R  +ATRL+A MK++GCEPNVW+YN+LLD+ G+  + +Q EK+WKEM 
Sbjct  439  YGNMISMYGQIRRASDATRLLALMKQKGCEPNVWVYNSLLDMRGKLGDSRQAEKIWKEMM  498

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PDRVSYT+++ A++++ EL+ C+ YYQ+F+  GG  D+ +AG+MVGVF K ++ +
Sbjct  499  RRKVQPDRVSYTAIVGAFNRSGELDRCMDYYQEFRETGGTVDKTLAGLMVGVFCKTSRFN  558

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            +L++LL+D+K   TKLD RLY   LN+LR+AGLE+  +WLQ+ F
Sbjct  559  DLIQLLRDMKLQGTKLDRRLYMIVLNSLREAGLEVHVRWLQDYF  602



>ref|XP_006652694.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Oryza brachyantha]
Length=608

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 178/224 (79%), Gaps = 2/224 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KL++ GCEPGQVTYAS++N+YC++G   +AE  FSEM  +GFDKC+VA
Sbjct  380  RRGLKPAIRAYDKLIALGCEPGQVTYASVINVYCQLGRSDRAESVFSEMIDRGFDKCVVA  439

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYGK  R  +ATRL+A MK++GCEPNVW+YN+LLD+HGR  + +Q EK+WKEM 
Sbjct  440  YGNMISMYGKIRRASDATRLLAVMKKKGCEPNVWVYNSLLDMHGRLGSSRQAEKIWKEMM  499

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PDRVSYT++I++++++ EL+ C+  YQ+F+  GG  D+A+ G+MVGVFSK ++ +
Sbjct  500  RRKVQPDRVSYTAIINSFNRSGELDRCMDLYQEFRETGGNVDKALGGLMVGVFSKCSRFN  559

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            EL++L++D++   T+LD RLY + L +LRDAGLE+  KWL+ +F
Sbjct  560  ELIELMKDMQG--TRLDRRLYLTVLRSLRDAGLEVHEKWLETNF  601



>gb|ACG27989.1| hypothetical protein [Zea mays]
Length=603

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 175/224 (78%), Gaps = 2/224 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KLV  GCEPGQVTYAS++N+YCR+G   +AE  FSEM ++GFD+C+VA
Sbjct  375  RRGLKPAIRAYDKLVLIGCEPGQVTYASVINVYCRLGRSDRAEAIFSEMIERGFDRCVVA  434

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYGK  R  EATRL+A MK++GCEPNV +YN+LLD+HGR  N KQ EK+WKEM 
Sbjct  435  YGNMISMYGKIRRASEATRLLALMKQKGCEPNVLVYNSLLDMHGRLGNSKQAEKIWKEML  494

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D+ MAG+MVGV SK ++ +
Sbjct  495  RRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDKVMAGLMVGVLSKTSRFN  554

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  555  ELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  596



>ref|XP_003580383.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brachypodium distachyon]
Length=612

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG + A   Y+KL++ GCEPGQVTYAS +N+YCR+G   +AE  FSEM  +GFDKC+VA
Sbjct  382  KRGLKPAIRAYDKLIAMGCEPGQVTYASAINVYCRLGRSDRAEAVFSEMIDRGFDKCVVA  441

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYG+  R  +ATRL+A MK++GCEPNVW+YN+LLD+ G+  + +Q EK+WKEM 
Sbjct  442  YGNMISMYGQIRRASDATRLLALMKQKGCEPNVWVYNSLLDMRGKLGDSRQAEKIWKEMV  501

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PDR+SYT++I A++++ EL+ C+ +YQ+F+  G K D+ MA +MVGVF K ++ +
Sbjct  502  RRKVQPDRISYTAIIGAFNRSGELDRCMNFYQEFRETGMKVDQTMASLMVGVFCKSSRFN  561

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            EL++LL+D+K    KLD RLY   LN+LR+AGLE+  KWLQ  F+
Sbjct  562  ELIELLRDMKLQGIKLDRRLYMIVLNSLREAGLEVHVKWLQNYFS  606



>tpg|DAA36322.1| TPA: hypothetical protein ZEAMMB73_184989 [Zea mays]
Length=603

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 174/224 (78%), Gaps = 2/224 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KLV  GCEPGQVTYAS++N+YCR+G   +AE  FSEM ++GFD+C+VA
Sbjct  375  RRGLKPAIRAYDKLVLIGCEPGQVTYASVINVYCRLGRSDRAEAIFSEMIERGFDRCVVA  434

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYGK  R  EATRL+A MK++GCEPNV +YN+LLD+HGR  N KQ EK+WKEM 
Sbjct  435  YGNMISMYGKIRRASEATRLLALMKQKGCEPNVLVYNSLLDMHGRLGNSKQAEKIWKEMV  494

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PDR+SYT++I A ++A EL+ C++ YQ+F+  G K D  MAG+MVGV SK ++ +
Sbjct  495  RRKVRPDRISYTAIILANNRAGELDRCMELYQEFRETGRKVDMVMAGLMVGVLSKTSRFN  554

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            EL++LL+++  + TKLD RLY S L +LRDAGLE+  KWLQ +F
Sbjct  555  ELIELLKEM--NGTKLDRRLYMSVLRSLRDAGLEVHVKWLQSNF  596



>ref|XP_004976594.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Setaria italica]
Length=607

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 173/224 (77%), Gaps = 2/224 (1%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +RG + A   Y+KLV  GCEPGQVTYAS++N+YCR+G   +AE  FSEM  +GF+KC+VA
Sbjct  379  RRGLKPAIRAYDKLVFIGCEPGQVTYASVINVYCRLGRSDRAEAVFSEMIGRGFEKCVVA  438

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y +M++MYGK  R  EA +L+A MK++GCEPNV +YN+LLD+HGR  N KQ EK+WKEM 
Sbjct  439  YGNMISMYGKIRRASEAMKLLAMMKQKGCEPNVLVYNSLLDMHGRLGNAKQAEKIWKEMA  498

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            RRKV PD++SYT +I A ++A EL  CV+ YQ+F+  GGK D++MAG+M GVFSK ++ +
Sbjct  499  RRKVRPDQISYTGIILANNRAGELHRCVELYQEFREAGGKVDKSMAGLMAGVFSKCSRFN  558

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            EL++LL+D+  + TKLD RLY S L +LRDAGLE+  KWL+ +F
Sbjct  559  ELIELLKDM--NATKLDRRLYMSVLRSLRDAGLEVHVKWLKSNF  600



>gb|KDO42183.1| hypothetical protein CISIN_1g044084mg, partial [Citrus sinensis]
Length=343

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 144/182 (79%), Gaps = 16/182 (9%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +R    A  VYE+L+SQGC PGQVTYASI+N YCRIG+YSKAE  F EM+QKGFDKC+VA
Sbjct  178  RRAYWAAVKVYEQLISQGCIPGQVTYASIINAYCRIGLYSKAEKVFIEMQQKGFDKCVVA  237

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            YSSMV MYGKTGR ++A RLVAKMK +GCEPNVWIYN+L+D+HGRA N++Q+EK      
Sbjct  238  YSSMVAMYGKTGRIRDAMRLVAKMKPKGCEPNVWIYNSLMDMHGRAKNLRQLEK------  291

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
                      YT+VISAY+ A+E + CVK+Y +F++NGG  DRAMAGIMVGVFSK+++++
Sbjct  292  ----------YTTVISAYNMAREFDMCVKFYNEFRMNGGVIDRAMAGIMVGVFSKLSQIE  341

Query  542  EL  547
            EL
Sbjct  342  EL  343


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/211 (23%), Positives = 90/211 (43%), Gaps = 3/211 (1%)
 Frame = +2

Query  32   YEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD---KCIVAYSSMVNM  202
            YEK+ S G       Y  I+  + +IG   K    F E E +  D        Y  + + 
Sbjct  10   YEKMKSAGIVLDSGCYCQIMEAFYKIGDSEKVAALFLECESRKLDLTPSSTHMYKILCDS  69

Query  203  YGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  382
             GK+GR  E  +    MKE+G   +  +Y +L+      + +K  E+++KE + + ++ D
Sbjct  70   LGKSGRAFEILKFFRDMKEKGILEDPSVYASLICSFASIAEVKVAEELFKEAEEKGMLRD  129

Query  383  RVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQ  562
               +  ++  Y +   +E  ++  +  K         ++ ++V  FSK       VK+ +
Sbjct  130  LEVFLKLVLMYIEEGMVEKTLEVVESMKNAELNISDCISCVIVNGFSKRRAYWAAVKVYE  189

Query  563  DLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L +      +  Y S +NA    GL  +A+
Sbjct  190  QLISQGCIPGQVTYASIINAYCRIGLYSKAE  220



>emb|CAN71209.1| hypothetical protein VITISV_030057 [Vitis vinifera]
Length=109

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +2

Query  356  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  535
            MKR+KVVPDRVSYTSVISAYSKA + E+C+++Y +F++NGG  DR +AGIMVG+FSK  +
Sbjct  1    MKRKKVVPDRVSYTSVISAYSKAGDFETCMRFYHEFRMNGGVIDRVIAGIMVGIFSKSGR  60

Query  536  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            VDELVKLLQD+KT+ T LDERLYRSALNALRDAGL+++A+WLQESF
Sbjct  61   VDELVKLLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESF  106



>dbj|BAD95045.1| putative protein [Arabidopsis thaliana]
Length=126

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  356  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  535
            MKR KV+PD+VSYTS+ISAY+++KELE CV+ YQ+F++N GK DRAMAGIMVGVFSK ++
Sbjct  1    MKRAKVLPDKVSYTSMISAYNRSKELERCVELYQEFRMNRGKIDRAMAGIMVGVFSKTSR  60

Query  536  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +DEL++LLQD+K + T+LD RLY SALNALRDAGL  + +WLQESF  A
Sbjct  61   IDELMRLLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAA  109



>ref|XP_001783392.1| predicted protein [Physcomitrella patens]
 gb|EDQ51786.1| predicted protein [Physcomitrella patens]
Length=540

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 135/210 (64%), Gaps = 0/210 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A  ++E++    C  G+ TY ++LN+Y + G +S AE   ++M Q GF + +VAYS+
Sbjct  285  PMGAIKLFEEMQESNCRFGESTYITMLNVYSKAGFHSAAEELLAKMRQLGFRRNVVAYST  344

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +++MYGK G+ +EATRL + MK++GC+ N+ +YNT+LD++G+A  +   E++  E+K  K
Sbjct  345  LIDMYGKVGKLQEATRLFSTMKQQGCKGNLIVYNTMLDMYGKAGRINDAERLMAELKDSK  404

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            +VPD V+YT++I+AY++    E C++ ++  + +G K DR +  IM+ V+ K  +  +L 
Sbjct  405  LVPDTVTYTTLINAYNRLGRFEECIRVFEQHRADGLKLDRILVAIMINVYGKARQYSKLA  464

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGL  640
            +LL+ +     + D R+ ++ +    D G+
Sbjct  465  ELLEVMPKSGIQPDTRILKTVVEIYEDGGM  494


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 106/223 (48%), Gaps = 5/223 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   + +L  +G  P   TY ++L+   ++G   K   T  EM + G     VAYS +++
Sbjct  113  AMKYFSQLKDEGLLPDSGTYCAVLSACRKVGNIDKGNETLKEMREAGIKPDQVAYSILID  172

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            M+GK GRH++A     +++  G  P+   YNTL+    +   + Q   V+KE +R   + 
Sbjct  173  MFGKAGRHEDAAATFRELQMSGYLPDSVAYNTLIHAFAKVGMVDQATLVFKEAQRSFCLD  232

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V + ++I  Y+KA+  +  +   +  K  G + +    G ++  F + N+    +KL 
Sbjct  233  DPVIFYTMIQVYAKARMADQALHVLKLMKEIGLQPNELGYGSVLNAFMRANQPMGAIKLF  292

Query  560  QDLKTDETKLDERLYRSALNALRDAGL-----EIRAKWLQESF  673
            ++++    +  E  Y + LN    AG      E+ AK  Q  F
Sbjct  293  EEMQESNCRFGESTYITMLNVYSKAGFHSAAEELLAKMRQLGF  335


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 108/232 (47%), Gaps = 5/232 (2%)
 Frame = +2

Query  14   RVAATVYEKLVSQ-GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            +V+   Y+ + SQ G EP    Y +  +   R+  +   E+   EM  K     I  Y+ 
Sbjct  5    QVSVEFYKWVKSQDGFEPHFHLYVAFAHCLMRVQKWVALEILVDEMIGKNCPPDIKFYAL  64

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++     TGR + A    +KMK  GC P++ IYN L+  +G+  N  Q  K + ++K   
Sbjct  65   VIKEAINTGRFQTAQHWFSKMKLLGCPPDIVIYNILILEYGKRGNFSQAMKYFSQLKDEG  124

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            ++PD  +Y +V+SA  K   ++   +  ++ +  G K D+    I++ +F K  + ++  
Sbjct  125  LLPDSGTYCAVLSACRKVGNIDKGNETLKEMREAGIKPDQVAYSILIDMFGKAGRHEDAA  184

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRA----KWLQESFAVAT*II  694
               ++L+      D   Y + ++A    G+  +A    K  Q SF +   +I
Sbjct  185  ATFRELQMSGYLPDSVAYNTLIHAFAKVGMVDQATLVFKEAQRSFCLDDPVI  236


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 103/207 (50%), Gaps = 0/207 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            + A   + K+   GC P  V Y  ++  Y + G +S+A   FS+++ +G       Y ++
Sbjct  76   QTAQHWFSKMKLLGCPPDIVIYNILILEYGKRGNFSQAMKYFSQLKDEGLLPDSGTYCAV  135

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            ++   K G   +    + +M+E G +P+   Y+ L+D+ G+A   +     ++E++    
Sbjct  136  LSACRKVGNIDKGNETLKEMREAGIKPDQVAYSILIDMFGKAGRHEDAAATFRELQMSGY  195

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
            +PD V+Y ++I A++K   ++     +++ + +    D  +   M+ V++K    D+ + 
Sbjct  196  LPDSVAYNTLIHAFAKVGMVDQATLVFKEAQRSFCLDDPVIFYTMIQVYAKARMADQALH  255

Query  554  LLQDLKTDETKLDERLYRSALNALRDA  634
            +L+ +K    + +E  Y S LNA   A
Sbjct  256  VLKLMKEIGLQPNELGYGSVLNAFMRA  282


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/206 (20%), Positives = 97/206 (47%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+++     C    V + +++ +Y +  +  +A      M++ G     + Y S++N
Sbjct  218  ATLVFKEAQRSFCLDDPVIFYTMIQVYAKARMADQALHVLKLMKEIGLQPNELGYGSVLN  277

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + +  +   A +L  +M+E  C      Y T+L+++ +A      E++  +M++     
Sbjct  278  AFMRANQPMGAIKLFEEMQESNCRFGESTYITMLNVYSKAGFHSAAEELLAKMRQLGFRR  337

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + V+Y+++I  Y K  +L+   + +   K  G K +  +   M+ ++ K  ++++  +L+
Sbjct  338  NVVAYSTLIDMYGKVGKLQEATRLFSTMKQQGCKGNLIVYNTMLDMYGKAGRINDAERLM  397

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             +LK  +   D   Y + +NA    G
Sbjct  398  AELKDSKLVPDTVTYTTLINAYNRLG  423



>gb|EPS59551.1| hypothetical protein M569_15254, partial [Genlisea aurea]
Length=412

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KRG + A  V+E++VSQG EPGQVTY+SIL+IY R+G+YS AE  FSEME++G DK + A
Sbjct  301  KRGSKAAVKVFEEMVSQGHEPGQVTYSSILSIYIRLGLYSNAESVFSEMEKRGLDKSVFA  360

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQV  337
            YSSMV+ Y K GR  +A RLVA+MK  GC PNVW YN+LL+++ RA+++K++
Sbjct  361  YSSMVSAYAKAGRTGDALRLVARMKAEGCGPNVWTYNSLLELYSRAADLKRL  412



>ref|XP_009782000.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X2 [Nicotiana sylvestris]
Length=608

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 111/202 (55%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A    +++  +G  P  VTY +++N YC +G+  +A    + M+  G   C++ Y+S++N
Sbjct  135  ANPFIKEMEEKGIFPDMVTYNTLINAYCHVGLLEEAYEVINLMKVTGLRPCLLTYNSIIN  194

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G+++ A +L+ +M E G  P+   YNTLL    R  N+++ E V+KEM  R ++P
Sbjct  195  GLCKNGQYRRARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMSCRAIIP  254

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D VSY+S+I  +S+   L   + YY+D K  G   D  +  I++G F ++  + E +K+ 
Sbjct  255  DLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKEAMKMR  314

Query  560  QDLKTDETKLDERLYRSALNAL  625
             ++      +D   Y + LN L
Sbjct  315  DEMLEQGLHMDVVTYNTILNGL  336


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++++++  G +P  VT  SI+  YCR G  S+A+   + M  +      V Y+++++
Sbjct  450  ALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYPDSVTYNTLLD  509

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + +     +A  LV +M  RG  P+V  YNT+LD   +   MK+   ++++M  R + P
Sbjct  510  GFIREENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINP  569

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            D+ +YTS+I+ +     L+   +++ +    G   D
Sbjct  570  DKSTYTSLINGHVSQDNLKEAFRFHDEMLQRGFVPD  605


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 92/208 (44%), Gaps = 0/208 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            R A  +  ++V  G  P   +Y ++L   CR G   +AE  F EM  +     +V+YSS+
Sbjct  203  RRARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMSCRAIIPDLVSYSSL  262

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            + ++ +TGR   +      MK +G  P+  +Y  L+    R  +MK+  K+  EM  + +
Sbjct  263  IGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKEAMKMRDEMLEQGL  322

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
              D V+Y ++++   K K L    + + +    G   D      ++    K   +D+ + 
Sbjct  323  HMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTVINGCCKCGNMDKALT  382

Query  554  LLQDLKTDETKLDERLYRSALNALRDAG  637
            L + +     K D   Y S ++     G
Sbjct  383  LFEAMLLRNLKPDVVTYNSLIDGFCKVG  410


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 100/206 (49%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V++++  +   P  V+Y+S++ ++ R G    +   + +M+ KG     V Y+ ++ 
Sbjct  240  AESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIG  299

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  KEA ++  +M E+G   +V  YNT+L+   +   + + ++++ EM  R V P
Sbjct  300  GFCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNP  359

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T+VI+   K   ++  +  ++   L   K D      ++  F K+  +++   L 
Sbjct  360  DFYTFTTVINGCCKCGNMDKALTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLR  419

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++ +     +   Y   +N   + G
Sbjct  420  DEMISVNISPNYITYSIFINGFCNKG  445


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/201 (21%), Positives = 93/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY S+++ +C++G   KA     EM         + YS  +N
Sbjct  380  ALTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSIFIN  439

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +   G   +A RL  +M + G +P +   N+++  + R+ +  + +K    M+ +++ P
Sbjct  440  GFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYP  499

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+Y +++  + + + ++  +    +    G   D      ++  F K  ++ E   L 
Sbjct  500  DSVTYNTLLDGFIREENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLY  559

Query  560  QDLKTDETKLDERLYRSALNA  622
            + +       D+  Y S +N 
Sbjct  560  RKMVERGINPDKSTYTSLING  580


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/202 (20%), Positives = 92/202 (46%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + ++++ QG     VTY +ILN  C+  +  +A+  F+EM ++G +     +++++N
Sbjct  310  AMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTVIN  369

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G   +A  L   M  R  +P+V  YN+L+D   +  +M++   +  EM    + P
Sbjct  370  GCCKCGNMDKALTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISP  429

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+  I+ +     +   ++ + +    G K        ++  + +        K L
Sbjct  430  NYITYSIFINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFL  489

Query  560  QDLKTDETKLDERLYRSALNAL  625
             ++++     D   Y + L+  
Sbjct  490  NNMRSQRIYPDSVTYNTLLDGF  511


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/206 (22%), Positives = 89/206 (43%), Gaps = 0/206 (0%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P  +TY SI+N  C+ G Y +A     EM + G      +Y++++    +TG  +EA
Sbjct  181  GLRPCLLTYNSIINGLCKNGQYRRARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQEA  240

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
              +  +M  R   P++  Y++L+ +  R   +      +++MK + + PD V YT +I  
Sbjct  241  ESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGG  300

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
            + +   ++  +K   +    G   D      ++    K   + E  +L  ++       D
Sbjct  301  FCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPD  360

Query  593  ERLYRSALNALRDAGLEIRAKWLQES  670
               + + +N     G   +A  L E+
Sbjct  361  FYTFTTVINGCCKCGNMDKALTLFEA  386


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 85/202 (42%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++V +G  P   T+ +++N  C+ G   KA   F  M  +     +V Y+S+++
Sbjct  345  ADELFNEMVERGVNPDFYTFTTVINGCCKCGNMDKALTLFEAMLLRNLKPDVVTYNSLID  404

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A  L  +M      PN   Y+  ++       +    ++W EM    + P
Sbjct  405  GFCKVGDMEKAFSLRDEMISVNISPNYITYSIFINGFCNKGCVSDALRLWDEMIDLGIKP  464

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+  S+I  Y ++ +     K+  + +      D      ++  F +   +D+ + L+
Sbjct  465  TIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYPDSVTYNTLLDGFIREENMDKALDLV  524

Query  560  QDLKTDETKLDERLYRSALNAL  625
             ++       D   Y + L+  
Sbjct  525  NEMGNRGLSPDVITYNTILDGF  546



>ref|XP_009781997.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009781998.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana sylvestris]
Length=726

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 107/192 (56%), Gaps = 0/192 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G  P  VTY +++N YC +G+  +A    + M+  G   C++ Y+S++N   K G+++ 
Sbjct  263  KGIFPDMVTYNTLINAYCHVGLLEEAYEVINLMKVTGLRPCLLTYNSIINGLCKNGQYRR  322

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A +L+ +M E G  P+   YNTLL    R  N+++ E V+KEM  R ++PD VSY+S+I 
Sbjct  323  ARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMSCRAIIPDLVSYSSLIG  382

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             +S+   L   + YY+D K  G   D  +  I++G F ++  + E +K+  ++      +
Sbjct  383  LFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKEAMKMRDEMLEQGLHM  442

Query  590  DERLYRSALNAL  625
            D   Y + LN L
Sbjct  443  DVVTYNTILNGL  454


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++++++  G +P  VT  SI+  YCR G  S+A+   + M  +      V Y+++++
Sbjct  568  ALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYPDSVTYNTLLD  627

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + +     +A  LV +M  RG  P+V  YNT+LD   +   MK+   ++++M  R + P
Sbjct  628  GFIREENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINP  687

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            D+ +YTS+I+ +     L+   +++ +    G   D
Sbjct  688  DKSTYTSLINGHVSQDNLKEAFRFHDEMLQRGFVPD  723


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 92/208 (44%), Gaps = 0/208 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            R A  +  ++V  G  P   +Y ++L   CR G   +AE  F EM  +     +V+YSS+
Sbjct  321  RRARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMSCRAIIPDLVSYSSL  380

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            + ++ +TGR   +      MK +G  P+  +Y  L+    R  +MK+  K+  EM  + +
Sbjct  381  IGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGGFCRIGSMKEAMKMRDEMLEQGL  440

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
              D V+Y ++++   K K L    + + +    G   D      ++    K   +D+ + 
Sbjct  441  HMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTVINGCCKCGNMDKALT  500

Query  554  LLQDLKTDETKLDERLYRSALNALRDAG  637
            L + +     K D   Y S ++     G
Sbjct  501  LFEAMLLRNLKPDVVTYNSLIDGFCKVG  528


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 100/206 (49%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V++++  +   P  V+Y+S++ ++ R G    +   + +M+ KG     V Y+ ++ 
Sbjct  358  AESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIG  417

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  KEA ++  +M E+G   +V  YNT+L+   +   + + ++++ EM  R V P
Sbjct  418  GFCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNP  477

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T+VI+   K   ++  +  ++   L   K D      ++  F K+  +++   L 
Sbjct  478  DFYTFTTVINGCCKCGNMDKALTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLR  537

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++ +     +   Y   +N   + G
Sbjct  538  DEMISVNISPNYITYSIFINGFCNKG  563


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/201 (21%), Positives = 93/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY S+++ +C++G   KA     EM         + YS  +N
Sbjct  498  ALTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSIFIN  557

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +   G   +A RL  +M + G +P +   N+++  + R+ +  + +K    M+ +++ P
Sbjct  558  GFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYP  617

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+Y +++  + + + ++  +    +    G   D      ++  F K  ++ E   L 
Sbjct  618  DSVTYNTLLDGFIREENMDKALDLVNEMGNRGLSPDVITYNTILDGFCKFGRMKEANMLY  677

Query  560  QDLKTDETKLDERLYRSALNA  622
            + +       D+  Y S +N 
Sbjct  678  RKMVERGINPDKSTYTSLING  698


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/202 (20%), Positives = 92/202 (46%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + ++++ QG     VTY +ILN  C+  +  +A+  F+EM ++G +     +++++N
Sbjct  428  AMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTVIN  487

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G   +A  L   M  R  +P+V  YN+L+D   +  +M++   +  EM    + P
Sbjct  488  GCCKCGNMDKALTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISP  547

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+  I+ +     +   ++ + +    G K        ++  + +        K L
Sbjct  548  NYITYSIFINGFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFL  607

Query  560  QDLKTDETKLDERLYRSALNAL  625
             ++++     D   Y + L+  
Sbjct  608  NNMRSQRIYPDSVTYNTLLDGF  629


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/206 (22%), Positives = 89/206 (43%), Gaps = 0/206 (0%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P  +TY SI+N  C+ G Y +A     EM + G      +Y++++    +TG  +EA
Sbjct  299  GLRPCLLTYNSIINGLCKNGQYRRARQLLVEMVESGLAPDTASYNTLLAECCRTGNLQEA  358

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
              +  +M  R   P++  Y++L+ +  R   +      +++MK + + PD V YT +I  
Sbjct  359  ESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLHCSLAYYEDMKSKGLTPDNVVYTILIGG  418

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
            + +   ++  +K   +    G   D      ++    K   + E  +L  ++       D
Sbjct  419  FCRIGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNPD  478

Query  593  ERLYRSALNALRDAGLEIRAKWLQES  670
               + + +N     G   +A  L E+
Sbjct  479  FYTFTTVINGCCKCGNMDKALTLFEA  504


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/206 (19%), Positives = 86/206 (42%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++V +G  P   T+ +++N  C+ G   KA   F  M  +     +V Y+S+++
Sbjct  463  ADELFNEMVERGVNPDFYTFTTVINGCCKCGNMDKALTLFEAMLLRNLKPDVVTYNSLID  522

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A  L  +M      PN   Y+  ++       +    ++W EM    + P
Sbjct  523  GFCKVGDMEKAFSLRDEMISVNISPNYITYSIFINGFCNKGCVSDALRLWDEMIDLGIKP  582

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+  S+I  Y ++ +     K+  + +      D      ++  F +   +D+ + L+
Sbjct  583  TIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIYPDSVTYNTLLDGFIREENMDKALDLV  642

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++       D   Y + L+     G
Sbjct  643  NEMGNRGLSPDVITYNTILDGFCKFG  668



>ref|XP_009625746.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X2 [Nicotiana tomentosiformis]
Length=608

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 108/197 (55%), Gaps = 0/197 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            +++  +G  P  VTY +++N YC +G+  +A    + M+  G   C++ Y+S++N   K 
Sbjct  140  QEMEEKGIFPDMVTYNTLINAYCHVGLLEEAYEVINLMKVTGLRPCLLTYNSIINGLCKN  199

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
            G +  A +L+ ++ E G  P+   YNTLL    R  N+++ E V+KEM  R ++PD VSY
Sbjct  200  GHYSRARQLLVELAESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMLCRAIIPDLVSY  259

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
            +S+I  +S+   L+  + YY+D K  G   D  +  I++G F +   + E +K+  ++  
Sbjct  260  SSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEMLE  319

Query  575  DETKLDERLYRSALNAL  625
                +D   Y + LN L
Sbjct  320  QGLHMDVVTYNTILNGL  336


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++++++  G +P  VT  SI+  YCR G  S+A+   + M  +      V  +++++
Sbjct  450  ALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIFPDSVTSNTLLD  509

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G   +A  LV +M  +G  P+V  YNT+LD   +   MK+   ++++M  R + P
Sbjct  510  GFIREGNMDKALDLVNEMGNQGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINP  569

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            D+ +YTS+I+ +     L+   +++ +    G   D
Sbjct  570  DKSTYTSLINGHVSLDNLKEAFRFHDEMLQRGFVPD  605


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/206 (21%), Positives = 101/206 (49%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+++++ +   P  V+Y+S++ ++ R G    +   + +M+ KG     V Y+ ++ 
Sbjct  240  AESVFKEMLCRAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIG  299

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  KEA ++  +M E+G   +V  YNT+L+   +   + + ++++ EM  R V P
Sbjct  300  GFCRNGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNP  359

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T++I+   K   ++  +  ++   L   K D      ++  F K+  +++   L 
Sbjct  360  DFYTFTTLINGCCKCGNMDKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFNLR  419

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++ +     +   Y   +N   + G
Sbjct  420  DEMISVNISPNYITYSILINGFCNKG  445


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 88/200 (44%), Gaps = 0/200 (0%)
 Frame = +2

Query  38   KLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTG  217
            +L   G  P   +Y ++L   CR G   +AE  F EM  +     +V+YSS++ ++ +TG
Sbjct  211  ELAESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMLCRAIIPDLVSYSSLIGLFSRTG  270

Query  218  RHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYT  397
            R   +      MK +G  P+  +Y  L+    R  +MK+  K+  EM  + +  D V+Y 
Sbjct  271  RLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEMLEQGLHMDVVTYN  330

Query  398  SVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTD  577
            ++++   K K L    + + +    G   D      ++    K   +D+ + L + +   
Sbjct  331  TILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTLINGCCKCGNMDKALTLFEGMLLR  390

Query  578  ETKLDERLYRSALNALRDAG  637
              K D   Y S ++     G
Sbjct  391  NLKPDVVTYNSLIDGFCKVG  410


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 92/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY S+++ +C++G   KA     EM         + YS ++N
Sbjct  380  ALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFNLRDEMISVNISPNYITYSILIN  439

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +   G   +A RL  +M + G +P +   N+++  + R+ +  + +K    M+ +++ P
Sbjct  440  GFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIFP  499

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+  +++  + +   ++  +    +    G   D      ++  F K  ++ E   L 
Sbjct  500  DSVTSNTLLDGFIREGNMDKALDLVNEMGNQGLSPDVITYNTILDGFCKFGRMKEANMLY  559

Query  560  QDLKTDETKLDERLYRSALNA  622
            + +       D+  Y S +N 
Sbjct  560  RKMVERGINPDKSTYTSLING  580


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/202 (20%), Positives = 87/202 (43%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++V +G  P   T+ +++N  C+ G   KA   F  M  +     +V Y+S+++
Sbjct  345  ADELFNEMVERGVNPDFYTFTTLINGCCKCGNMDKALTLFEGMLLRNLKPDVVTYNSLID  404

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A  L  +M      PN   Y+ L++       +    ++W EM    + P
Sbjct  405  GFCKVGDMEKAFNLRDEMISVNISPNYITYSILINGFCNKGCVSDALRLWDEMIDLGIKP  464

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+  S+I  Y ++ +     K+  + +      D   +  ++  F +   +D+ + L+
Sbjct  465  TIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIFPDSVTSNTLLDGFIREGNMDKALDLV  524

Query  560  QDLKTDETKLDERLYRSALNAL  625
             ++       D   Y + L+  
Sbjct  525  NEMGNQGLSPDVITYNTILDGF  546



>ref|XP_009625742.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625743.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625745.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
isoform X1 [Nicotiana tomentosiformis]
Length=726

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 108/197 (55%), Gaps = 0/197 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            +++  +G  P  VTY +++N YC +G+  +A    + M+  G   C++ Y+S++N   K 
Sbjct  258  QEMEEKGIFPDMVTYNTLINAYCHVGLLEEAYEVINLMKVTGLRPCLLTYNSIINGLCKN  317

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
            G +  A +L+ ++ E G  P+   YNTLL    R  N+++ E V+KEM  R ++PD VSY
Sbjct  318  GHYSRARQLLVELAESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMLCRAIIPDLVSY  377

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
            +S+I  +S+   L+  + YY+D K  G   D  +  I++G F +   + E +K+  ++  
Sbjct  378  SSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEMLE  437

Query  575  DETKLDERLYRSALNAL  625
                +D   Y + LN L
Sbjct  438  QGLHMDVVTYNTILNGL  454


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++++++  G +P  VT  SI+  YCR G  S+A+   + M  +      V  +++++
Sbjct  568  ALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIFPDSVTSNTLLD  627

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G   +A  LV +M  +G  P+V  YNT+LD   +   MK+   ++++M  R + P
Sbjct  628  GFIREGNMDKALDLVNEMGNQGLSPDVITYNTILDGFCKFGRMKEANMLYRKMVERGINP  687

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            D+ +YTS+I+ +     L+   +++ +    G   D
Sbjct  688  DKSTYTSLINGHVSLDNLKEAFRFHDEMLQRGFVPD  723


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/206 (21%), Positives = 101/206 (49%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+++++ +   P  V+Y+S++ ++ R G    +   + +M+ KG     V Y+ ++ 
Sbjct  358  AESVFKEMLCRAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIG  417

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  KEA ++  +M E+G   +V  YNT+L+   +   + + ++++ EM  R V P
Sbjct  418  GFCRNGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADELFNEMVERGVNP  477

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T++I+   K   ++  +  ++   L   K D      ++  F K+  +++   L 
Sbjct  478  DFYTFTTLINGCCKCGNMDKALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFNLR  537

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++ +     +   Y   +N   + G
Sbjct  538  DEMISVNISPNYITYSILINGFCNKG  563


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 88/200 (44%), Gaps = 0/200 (0%)
 Frame = +2

Query  38   KLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTG  217
            +L   G  P   +Y ++L   CR G   +AE  F EM  +     +V+YSS++ ++ +TG
Sbjct  329  ELAESGLAPDTASYNTLLAECCRTGNLQEAESVFKEMLCRAIIPDLVSYSSLIGLFSRTG  388

Query  218  RHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYT  397
            R   +      MK +G  P+  +Y  L+    R  +MK+  K+  EM  + +  D V+Y 
Sbjct  389  RLDCSLAYYEDMKSKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEMLEQGLHMDVVTYN  448

Query  398  SVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTD  577
            ++++   K K L    + + +    G   D      ++    K   +D+ + L + +   
Sbjct  449  TILNGLCKEKMLHEADELFNEMVERGVNPDFYTFTTLINGCCKCGNMDKALTLFEGMLLR  508

Query  578  ETKLDERLYRSALNALRDAG  637
              K D   Y S ++     G
Sbjct  509  NLKPDVVTYNSLIDGFCKVG  528


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 92/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY S+++ +C++G   KA     EM         + YS ++N
Sbjct  498  ALTLFEGMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFNLRDEMISVNISPNYITYSILIN  557

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +   G   +A RL  +M + G +P +   N+++  + R+ +  + +K    M+ +++ P
Sbjct  558  GFCNKGCVSDALRLWDEMIDLGIKPTIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIFP  617

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+  +++  + +   ++  +    +    G   D      ++  F K  ++ E   L 
Sbjct  618  DSVTSNTLLDGFIREGNMDKALDLVNEMGNQGLSPDVITYNTILDGFCKFGRMKEANMLY  677

Query  560  QDLKTDETKLDERLYRSALNA  622
            + +       D+  Y S +N 
Sbjct  678  RKMVERGINPDKSTYTSLING  698


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 79/168 (47%), Gaps = 3/168 (2%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P  +TY SI+N  C+ G YS+A     E+ + G      +Y++++    +TG  +EA
Sbjct  299  GLRPCLLTYNSIINGLCKNGHYSRARQLLVELAESGLAPDTASYNTLLAECCRTGNLQEA  358

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
              +  +M  R   P++  Y++L+ +  R   +      +++MK + + PD V YT +I  
Sbjct  359  ESVFKEMLCRAIIPDLVSYSSLIGLFSRTGRLDCSLAYYEDMKSKGLTPDNVVYTILIGG  418

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSK---MNKVDEL  547
            + +   ++  +K   +    G   D      ++    K   +++ DEL
Sbjct  419  FCRNGSMKEAMKMRDEMLEQGLHMDVVTYNTILNGLCKEKMLHEADEL  466


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/206 (20%), Positives = 88/206 (43%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++V +G  P   T+ +++N  C+ G   KA   F  M  +     +V Y+S+++
Sbjct  463  ADELFNEMVERGVNPDFYTFTTLINGCCKCGNMDKALTLFEGMLLRNLKPDVVTYNSLID  522

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A  L  +M      PN   Y+ L++       +    ++W EM    + P
Sbjct  523  GFCKVGDMEKAFNLRDEMISVNISPNYITYSILINGFCNKGCVSDALRLWDEMIDLGIKP  582

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+  S+I  Y ++ +     K+  + +      D   +  ++  F +   +D+ + L+
Sbjct  583  TIVTCNSIIKGYCRSGDASRADKFLNNMRSQRIFPDSVTSNTLLDGFIREGNMDKALDLV  642

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++       D   Y + L+     G
Sbjct  643  NEMGNQGLSPDVITYNTILDGFCKFG  668



>ref|XP_004237581.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Solanum lycopersicum]
Length=738

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 108/203 (53%), Gaps = 6/203 (3%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P  VTY +++N YC  G+  +A+   + M+  G   C++ Y+S++N   K G++  A  L
Sbjct  279  PDMVTYNTLINAYCHEGLLEEADEVINIMKATGLRPCLLTYNSILNGLCKNGQYGRAREL  338

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
            + +M+E G  P+   YN LL    RA N+ + E V+KEM  R ++PD VSY+S+I  +++
Sbjct  339  LVEMEECGLAPDTTSYNALLAECCRAGNVLEAESVFKEMLCRAIIPDLVSYSSLIGLFAR  398

Query  422  AKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERL  601
               L+  + YY+  K  G   D  +  I++G F +   + E +K+  ++      +D   
Sbjct  399  TGRLDRSLVYYEHMKRKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEMLERSLVMDVVT  458

Query  602  YRSALNALRDAGLEIRAKWLQES  670
            Y + LN L       + K LQE+
Sbjct  459  YNTILNGL------CKGKMLQEA  475


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 102/206 (50%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+++++ +   P  V+Y+S++ ++ R G   ++ + +  M++KG     V Y+ ++ 
Sbjct  370  AESVFKEMLCRAIIPDLVSYSSLIGLFARTGRLDRSLVYYEHMKRKGLTPDNVVYTILIG  429

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  KEA ++  +M ER    +V  YNT+L+   +   +++  +++ EM  R V P
Sbjct  430  GFCRNGSMKEAMKMRDEMLERSLVMDVVTYNTILNGLCKGKMLQEANELFNEMLERDVNP  489

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T++I+ Y K   ++     ++   L   K D      ++  F K+  +++   L 
Sbjct  490  DFYTFTTLINGYCKCGNMDKAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLR  549

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++ +     +   Y   +N   + G
Sbjct  550  DEMISVNISPNYITYSILINGFCNKG  575


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 83/156 (53%), Gaps = 0/156 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++ ++  G +P  VT  SI+  YCR G  S+A    ++M+ +G     + Y+++++
Sbjct  580  ALRLWDDMIILGIKPTIVTCNSIIKGYCRCGDTSRAAKFLNKMQIQGLFPDSITYNTLLD  639

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               +     +A  LV +M ++G  P+V+ YNT+LD   +   M++   ++ +M  R + P
Sbjct  640  GLIREENMDKALDLVNEMGKQGLSPDVFSYNTILDGFCKFGRMQEANMLYSKMVERGINP  699

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            DR +YTS+I+ +     L+   +++ +    G   D
Sbjct  700  DRSTYTSLINGHVSQDNLKEAFRFHDEMLQRGFIPD  735


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/195 (25%), Positives = 87/195 (45%), Gaps = 0/195 (0%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P   +Y ++L   CR G   +AE  F EM  +     +V+YSS++ ++ +TGR   +
Sbjct  346  GLAPDTTSYNALLAECCRAGNVLEAESVFKEMLCRAIIPDLVSYSSLIGLFARTGRLDRS  405

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
                  MK +G  P+  +Y  L+    R  +MK+  K+  EM  R +V D V+Y ++++ 
Sbjct  406  LVYYEHMKRKGLTPDNVVYTILIGGFCRNGSMKEAMKMRDEMLERSLVMDVVTYNTILNG  465

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
              K K L+   + + +        D      ++  + K   +D+   L + +     K D
Sbjct  466  LCKGKMLQEANELFNEMLERDVNPDFYTFTTLINGYCKCGNMDKAQTLFEAMLLRNLKPD  525

Query  593  ERLYRSALNALRDAG  637
               Y S ++     G
Sbjct  526  VVTYNSLIDGFCKVG  540


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/158 (27%), Positives = 76/158 (48%), Gaps = 0/158 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A ++ ++++S    P  +TY+ ++N +C  G  S A   + +M   G    IV  +S++ 
Sbjct  545  AFSLRDEMISVNISPNYITYSILINGFCNKGHVSDALRLWDDMIILGIKPTIVTCNSIIK  604

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y + G    A + + KM+ +G  P+   YNTLLD   R  NM +   +  EM ++ + P
Sbjct  605  GYCRCGDTSRAAKFLNKMQIQGLFPDSITYNTLLDGLIREENMDKALDLVNEMGKQGLSP  664

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRA  493
            D  SY +++  + K   ++     Y      G   DR+
Sbjct  665  DVFSYNTILDGFCKFGRMQEANMLYSKMVERGINPDRS  702


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/185 (22%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY +ILN  C+  +  +A   F+EM ++  +     +++++N Y K G   +A  L   
Sbjct  457  VTYNTILNGLCKGKMLQEANELFNEMLERDVNPDFYTFTTLINGYCKCGNMDKAQTLFEA  516

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            M  R  +P+V  YN+L+D   +  +M++   +  EM    + P+ ++Y+ +I+ +     
Sbjct  517  MLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSILINGFCNKGH  576

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +   ++ + D  + G K        ++  + +        K L  ++      D   Y +
Sbjct  577  VSDALRLWDDMIILGIKPTIVTCNSIIKGYCRCGDTSRAAKFLNKMQIQGLFPDSITYNT  636

Query  611  ALNAL  625
             L+ L
Sbjct  637  LLDGL  641


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 87/201 (43%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY S+++ +C++G   KA     EM         + YS ++N
Sbjct  510  AQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSILIN  569

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +   G   +A RL   M   G +P +   N+++  + R  +  +  K   +M+ + + P
Sbjct  570  GFCNKGHVSDALRLWDDMIILGIKPTIVTCNSIIKGYCRCGDTSRAAKFLNKMQIQGLFP  629

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D ++Y +++    + + ++  +    +    G   D      ++  F K  ++ E   L 
Sbjct  630  DSITYNTLLDGLIREENMDKALDLVNEMGKQGLSPDVFSYNTILDGFCKFGRMQEANMLY  689

Query  560  QDLKTDETKLDERLYRSALNA  622
              +       D   Y S +N 
Sbjct  690  SKMVERGINPDRSTYTSLING  710


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/206 (19%), Positives = 88/206 (43%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +++ +   P   T+ +++N YC+ G   KA+  F  M  +     +V Y+S+++
Sbjct  475  ANELFNEMLERDVNPDFYTFTTLINGYCKCGNMDKAQTLFEAMLLRNLKPDVVTYNSLID  534

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A  L  +M      PN   Y+ L++      ++    ++W +M    + P
Sbjct  535  GFCKVGDMEKAFSLRDEMISVNISPNYITYSILINGFCNKGHVSDALRLWDDMIILGIKP  594

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+  S+I  Y +  +     K+    ++ G   D      ++    +   +D+ + L+
Sbjct  595  TIVTCNSIIKGYCRCGDTSRAAKFLNKMQIQGLFPDSITYNTLLDGLIREENMDKALDLV  654

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++       D   Y + L+     G
Sbjct  655  NEMGKQGLSPDVFSYNTILDGFCKFG  680



>emb|CDP08449.1| unnamed protein product [Coffea canephora]
Length=714

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 108/192 (56%), Gaps = 0/192 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G     VTY +++N Y R G   +A    + M  +GF  C++ ++ +VN   K G++ +
Sbjct  251  KGIFSDSVTYNTLINAYSREGKLEEAFGLMNVMSAEGFKPCLLTFNCIVNGLCKNGKYGK  310

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            AT+++ +M + G  P+   YN+LL    R+ N+ + E V+ EM  R V+PD VSY+S+I+
Sbjct  311  ATQVLDEMVKIGLSPDTATYNSLLAECCRSGNLSEAESVFSEMLHRGVIPDLVSYSSLIA  370

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             +S+   L+  + YY+D K NG   D+ +  I++G F K   + E +++  ++      +
Sbjct  371  LFSRVGLLDRALGYYKDMKSNGLIPDKVIYTILIGGFCKHGSMLEAMRIRDEMLEKGCLM  430

Query  590  DERLYRSALNAL  625
            D   Y + LNAL
Sbjct  431  DVVTYNTILNAL  442


 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/207 (24%), Positives = 100/207 (48%), Gaps = 0/207 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ +++ +G  P  V+Y+S++ ++ R+G+  +A   + +M+  G     V Y+ ++ 
Sbjct  346  AESVFSEMLHRGVIPDLVSYSSLIALFSRVGLLDRALGYYKDMKSNGLIPDKVIYTILIG  405

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G   EA R+  +M E+GC  +V  YNT+L+       + + +++  EM  R V P
Sbjct  406  GFCKHGSMLEAMRIRDEMLEKGCLMDVVTYNTILNALCNKKMLSEADQLLNEMFERGVFP  465

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  +YT++I+ Y K   +   +  ++       K D      ++  F K  +++E + L 
Sbjct  466  DYYTYTTLINGYCKDGNMSKALTLFRSMLQRNLKPDIVTYNTLIDGFCKAGEIEEAILLR  525

Query  560  QDLKTDETKLDERLYRSALNALRDAGL  640
             ++ T     +   Y   +N     G 
Sbjct  526  DEMITKSVLPNLITYSILINGFCSRGF  552


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 80/157 (51%), Gaps = 2/157 (1%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKG-FDKCIVAYSSMV  196
            A  ++EK+V    +P  VT  S++  YCR G   KA     +M  +G F  C   Y++++
Sbjct  556  ALRLWEKMVDTRIQPSLVTCNSLIKGYCRHGETEKACQFLGQMRSQGVFPDCF-TYNTLI  614

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            N Y K     +A  L+++M+ +G  PNV  YN +LD   +   M++   ++++M  R + 
Sbjct  615  NGYIKEENMDKAFDLLSEMENQGLSPNVITYNVMLDGFCKLGRMQEANMLYRKMSGRGIN  674

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            PDR +YTS+I+ +      +    ++ +    G   D
Sbjct  675  PDRATYTSLINGHVSLDNFKEAAWFHDEMLQRGFMPD  711


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 79/146 (54%), Gaps = 0/146 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + ++++ +GC    VTY +ILN  C   + S+A+   +EM ++G       Y++++N
Sbjct  416  AMRIRDEMLEKGCLMDVVTYNTILNALCNKKMLSEADQLLNEMFERGVFPDYYTYTTLIN  475

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K G   +A  L   M +R  +P++  YNTL+D   +A  +++   +  EM  + V+P
Sbjct  476  GYCKDGNMSKALTLFRSMLQRNLKPDIVTYNTLIDGFCKAGEIEEAILLRDEMITKSVLP  535

Query  380  DRVSYTSVISAYSKAKELESCVKYYQ  457
            + ++Y+ +I+ +     +   ++ ++
Sbjct  536  NLITYSILINGFCSRGFISDALRLWE  561


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 86/185 (46%), Gaps = 0/185 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +  ++  +G  P   TY +++N YC+ G  SKA   F  M Q+     IV Y+++++
Sbjct  451  ADQLLNEMFERGVFPDYYTYTTLINGYCKDGNMSKALTLFRSMLQRNLKPDIVTYNTLID  510

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  +EA  L  +M  +   PN+  Y+ L++       +    ++W++M   ++ P
Sbjct  511  GFCKAGEIEEAILLRDEMITKSVLPNLITYSILINGFCSRGFISDALRLWEKMVDTRIQP  570

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+  S+I  Y +  E E   ++    +  G   D      ++  + K   +D+   LL
Sbjct  571  SLVTCNSLIKGYCRHGETEKACQFLGQMRSQGVFPDCFTYNTLINGYIKEENMDKAFDLL  630

Query  560  QDLKT  574
             +++ 
Sbjct  631  SEMEN  635


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/216 (21%), Positives = 97/216 (45%), Gaps = 0/216 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++  ++ +  +P  VTY ++++ +C+ G   +A +   EM  K     ++ YS ++N
Sbjct  486  ALTLFRSMLQRNLKPDIVTYNTLIDGFCKAGEIEEAILLRDEMITKSVLPNLITYSILIN  545

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +   G   +A RL  KM +   +P++   N+L+  + R    ++  +   +M+ + V P
Sbjct  546  GFCSRGFISDALRLWEKMVDTRIQPSLVTCNSLIKGYCRHGETEKACQFLGQMRSQGVFP  605

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  +Y ++I+ Y K + ++       + +  G   +     +M+  F K+ ++ E   L 
Sbjct  606  DCFTYNTLINGYIKEENMDKAFDLLSEMENQGLSPNVITYNVMLDGFCKLGRMQEANMLY  665

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
            + +       D   Y S +N          A W  +
Sbjct  666  RKMSGRGINPDRATYTSLINGHVSLDNFKEAAWFHD  701


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 66/125 (53%), Gaps = 0/125 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            ++G +P  +T+  I+N  C+ G Y KA     EM + G       Y+S++    ++G   
Sbjct  285  AEGFKPCLLTFNCIVNGLCKNGKYGKATQVLDEMVKIGLSPDTATYNSLLAECCRSGNLS  344

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            EA  + ++M  RG  P++  Y++L+ +  R   + +    +K+MK   ++PD+V YT +I
Sbjct  345  EAESVFSEMLHRGVIPDLVSYSSLIALFSRVGLLDRALGYYKDMKSNGLIPDKVIYTILI  404

Query  407  SAYSK  421
              + K
Sbjct  405  GGFCK  409



>dbj|BAK02704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 114/209 (55%), Gaps = 1/209 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A  V++++ S GC+    TY +++N + R G+  KAE  F EM+Q G +  + AY++
Sbjct  100  PMSAMKVFKEMQSIGCKANICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNA  159

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y + G  + A+ + + M+  GCEP+   YN L+D +GRA   ++ E V++ +KR+ 
Sbjct  160  LMEAYSRAGFPQAASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHREAEAVFESLKRQG  219

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P   S+  +++A++++  +  C +       +G   D      M+  + +  ++D++ 
Sbjct  220  MAPTMKSHMLLLAAHARSGNVARCEEVMAQLHKSGLAPDTIALNAMLNAYGRAGRLDDME  279

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAG  637
            +LL  ++   T+ D   Y  A+NA   AG
Sbjct  280  RLLAAMERRGTR-DVGTYNVAVNAYGRAG  307


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 103/192 (54%), Gaps = 1/192 (1%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            R A  V+E L  QG  P   ++  +L  + R G  ++ E   +++ + G     +A ++M
Sbjct  206  REAEAVFESLKRQGMAPTMKSHMLLLAAHARSGNVARCEEVMAQLHKSGLAPDTIALNAM  265

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            +N YG+ GR  +  RL+A M+ RG   +V  YN  ++ +GRA  ++++E  +  ++RR +
Sbjct  266  LNAYGRAGRLDDMERLLAAMERRGTR-DVGTYNVAVNAYGRAGYLERMEAAFASLERRGL  324

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
              D V++TS + AY++ KE   C++ +++    G   D   A ++V   S   +V+++  
Sbjct  325  AADVVTWTSRMGAYARKKEYRRCLEIFEEMVDAGCYPDAGTAKVLVAACSDERQVEQVTA  384

Query  554  LLQDLKTDETKL  589
            +++ +  +   L
Sbjct  385  IVRSMHKEAKTL  396


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/216 (24%), Positives = 94/216 (44%), Gaps = 35/216 (16%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS------  190
            +Y  L+   C P + TYA +L  YC  G   +AE   SEM + G       Y++      
Sbjct  1    MYAALLEARCVPTEDTYALLLRAYCTAGSLHRAEGVISEMREHGIPPSATVYNAYLDGLL  60

Query  191  -----------------------------MVNMYGKTGRHKEATRLVAKMKERGCEPNVW  283
                                         M+N+YGK+ +   A ++  +M+  GC+ N+ 
Sbjct  61   KARCAEKAVEVYQRMKRERCRTNTETYTLMINVYGKSKQPMSAMKVFKEMQSIGCKANIC  120

Query  284  IYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDF  463
             Y  L++   R    ++ E+V++EM++    PD  +Y +++ AYS+A   ++  + +   
Sbjct  121  TYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGFPQAASEIFSLM  180

Query  464  KLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
            +  G + DRA   I+V  + +     E   + + LK
Sbjct  181  QHMGCEPDRASYNILVDAYGRAGLHREAEAVFESLK  216


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 92/206 (45%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  VY+++  + C     TY  ++N+Y +      A   F EM+  G    I  Y+++VN
Sbjct  68   AVEVYQRMKRERCRTNTETYTLMINVYGKSKQPMSAMKVFKEMQSIGCKANICTYTALVN  127

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M++ G EP+V+ YN L++ + RA   +   +++  M+     P
Sbjct  128  AFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGFPQAASEIFSLMQHMGCEP  187

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A         ++  K  G         +++   ++   V    +++
Sbjct  188  DRASYNILVDAYGRAGLHREAEAVFESLKRQGMAPTMKSHMLLLAAHARSGNVARCEEVM  247

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              L       D     + LNA   AG
Sbjct  248  AQLHKSGLAPDTIALNAMLNAYGRAG  273



>ref|XP_009792924.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009792925.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X2 [Nicotiana sylvestris]
Length=550

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/220 (27%), Positives = 115/220 (52%), Gaps = 0/220 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ +Q C+P   TY +++N + R G+  KAE  F E+++ GF+  +  Y++++
Sbjct  252  MALKVFNEMKTQKCKPNICTYTALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALM  311

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G  + A  + + M+  GCEP+   YN ++D +GRA   +  + V+ EMKR  + 
Sbjct  312  EAYSRAGYPQGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGIT  371

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   SY  +ISAYS+   +  C +  +  +  G K D  +   M+ ++ ++ +  ++ +L
Sbjct  372  PTMKSYMLLISAYSRNSNVSKCEEIVKQMQKEGVKLDTYLLNNMLNLYGRLGQFAKMEEL  431

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            L  ++      D   Y   +NA   +G   + + +  S A
Sbjct  432  LTVIEAGPYVADISTYNILINAYGRSGFIAKMEEIFHSLA  471


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 104/205 (51%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            R  + A  +++++  + C+P   TY  ++N+Y +      A   F+EM+ +     I  Y
Sbjct  213  RNSQKALVIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKPNICTY  272

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            +++VN + + G  ++A  +  +++E G EP+V+ YN L++ + RA   +   +++  M+ 
Sbjct  273  TALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALMEAYSRAGYPQGAAEIFSLMQH  332

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
                PDR SY  ++ AY +A   E     + + K  G         +++  +S+ + V +
Sbjct  333  MGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGITPTMKSYMLLISAYSRNSNVSK  392

Query  545  LVKLLQDLKTDETKLDERLYRSALN  619
              ++++ ++ +  KLD  L  + LN
Sbjct  393  CEEIVKQMQKEGVKLDTYLLNNMLN  417


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/215 (25%), Positives = 105/215 (49%), Gaps = 6/215 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y  L+   C P + TYA +L  Y + G+  KAE  FSEM + G     + Y++ ++
Sbjct  148  AESTYLALLEARCVPTEDTYALLLKSYSKCGMLEKAEAVFSEMRKNGLPPSALVYNAYID  207

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K    ++A  +  +MK   C+P+   Y  L++++G+ +      KV+ EMK +K  P
Sbjct  208  GLMKGRNSQKALVIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKP  267

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM---NKVDELV  550
            +  +YT++++A+++    E   + +++ +  G + D      ++  +S+        E+ 
Sbjct  268  NICTYTALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALMEAYSRAGYPQGAAEIF  327

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L+Q +  +    D   Y   ++A   AGL   A+
Sbjct  328  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQ  359


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 108/221 (49%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P+ AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G          
Sbjct  320  PQGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGITPTMKSYML  379

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             I AYS                            +M+N+YG+ G+  +   L+  ++   
Sbjct  380  LISAYSRNSNVSKCEEIVKQMQKEGVKLDTYLLNNMLNLYGRLGQFAKMEELLTVIEAGP  439

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
               ++  YN L++ +GR+  + ++E+++  +  + + PD V++TS + AYSK K+ + C+
Sbjct  440  YVADISTYNILINAYGRSGFIAKMEEIFHSLAAKNLKPDVVTWTSRLGAYSKKKQYQRCL  499

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++    G   D   A +++   S  ++++++  +++ +
Sbjct  500  EIFEEMIDEGCYPDGGTAKVLLSSCSSEDQIEQVTTVIRSM  540


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 86/197 (44%), Gaps = 4/197 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEME----QKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P   T+  I+N+  ++ +  + ++     E    +  F   ++ Y+ ++  YG++   K+
Sbjct  88   PTNDTWDDIINVAVQLRINKQWDLIILVCEWILCRSSFQADVICYNLLIEAYGQSSLVKK  147

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A      + E  C P    Y  LL  + +   +++ E V+ EM++  + P  + Y + I 
Sbjct  148  AESTYLALLEARCVPTEDTYALLLKSYSKCGMLEKAEAVFSEMRKNGLPPSALVYNAYID  207

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K +  +  +  +   K    +       +++ ++ K NK    +K+  ++KT + K 
Sbjct  208  GLMKGRNSQKALVIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKP  267

Query  590  DERLYRSALNALRDAGL  640
            +   Y + +NA    GL
Sbjct  268  NICTYTALVNAFARGGL  284



>ref|XP_011090170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Sesamum indicum]
Length=715

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 100/185 (54%), Gaps = 0/185 (0%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY +++N YCR G   K  +    M  K  + C++ Y+S+VN   K GR++ A  +  +
Sbjct  259  VTYNTMINAYCRAGHIEKGLVMMRLMRDKDMEPCLLTYNSIVNGLCKNGRYERAKEVFNE  318

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            M + G  P+   YNTLL    R  N+ + E ++ EM RR VVPD VSY+S+I  +S+   
Sbjct  319  MIQIGMSPDTATYNTLLVECCRKDNVVEAEGLFDEMLRRGVVPDLVSYSSIIGFFSRTGN  378

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            L+  + YY+D +  G   D+ +  I++G F +   + + +K+  ++      +D   Y S
Sbjct  379  LDRMMTYYRDMQSKGLTPDKFVYTILIGGFCRHGAISDAMKVRDEMMKLGCHMDVVTYNS  438

Query  611  ALNAL  625
             LN L
Sbjct  439  ILNGL  443


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 95/184 (52%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V ++++  GC    VTY SILN  C+  +  +A+  F+EM ++G       Y++++N
Sbjct  417  AMKVRDEMMKLGCHMDVVTYNSILNGLCKEKMLCEADALFNEMLERGVFPDFCTYTTLIN  476

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y KTG   +A+ L   M +R  +P+V  YNTL+D   +A  M++  ++  +M  + + P
Sbjct  477  GYCKTGYMDKASSLFTSMLQRNLKPDVITYNTLIDGFCKAGEMERAIELRDDMISKMIHP  536

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y ++++ +     L    K + +    G + +  +   ++  + +     + ++ L
Sbjct  537  NYITYGTLMNGFCDGGFLSEAFKLWNEMIDKGIEPNIIICNCLIKGYCRHGDPGKALEFL  596

Query  560  QDLK  571
            + +K
Sbjct  597  KKMK  600


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 102/218 (47%), Gaps = 6/218 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++++++ +G  P  V+Y+SI+  + R G   +    + +M+ KG       Y+ ++ 
Sbjct  347  AEGLFDEMLRRGVVPDLVSYSSIIGFFSRTGNLDRMMTYYRDMQSKGLTPDKFVYTILIG  406

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G   +A ++  +M + GC  +V  YN++L+   +   + + + ++ EM  R V P
Sbjct  407  GFCRHGAISDAMKVRDEMMKLGCHMDVVTYNSILNGLCKEKMLCEADALFNEMLERGVFP  466

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  +YT++I+ Y K   ++     +        K D      ++  F K  +++  ++L 
Sbjct  467  DFCTYTTLINGYCKTGYMDKASSLFTSMLQRNLKPDVITYNTLIDGFCKAGEMERAIELR  526

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
             D+ +     +   Y + +N   D G      +L E+F
Sbjct  527  DDMISKMIHPNYITYGTLMNGFCDGG------FLSEAF  558


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 88/183 (48%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + + ++S+   P  +TY +++N +C  G  S+A   ++EM  KG +  I+  + ++ 
Sbjct  522  AIELRDDMISKMIHPNYITYGTLMNGFCDGGFLSEAFKLWNEMIDKGIEPNIIICNCLIK  581

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y + G   +A   + KMK RG  P+   YNTL+    +  N+     + K M++  +VP
Sbjct  582  GYCRHGDPGKALEFLKKMKPRGIFPDCISYNTLIHGFMKEENIDTAFDLVKRMEKEDLVP  641

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+Y  +++ + +   ++     Y+     G   DR+    ++  +     + +  KL 
Sbjct  642  DLVTYNVILAQFCRLGRMQEANTIYRKMIEKGVNPDRSTYTSLINGYVSQENLKQAFKLH  701

Query  560  QDL  568
             ++
Sbjct  702  DEM  704


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 89/199 (45%), Gaps = 0/199 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +++ +G  P   TY +++N YC+ G   KA   F+ M Q+     ++ Y+++++
Sbjct  452  ADALFNEMLERGVFPDFCTYTTLINGYCKTGYMDKASSLFTSMLQRNLKPDVITYNTLID  511

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  + A  L   M  +   PN   Y TL++       + +  K+W EM  + + P
Sbjct  512  GFCKAGEMERAIELRDDMISKMIHPNYITYGTLMNGFCDGGFLSEAFKLWNEMIDKGIEP  571

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + +    +I  Y +  +    +++ +  K  G   D      ++  F K   +D    L+
Sbjct  572  NIIICNCLIKGYCRHGDPGKALEFLKKMKPRGIFPDCISYNTLIHGFMKEENIDTAFDLV  631

Query  560  QDLKTDETKLDERLYRSAL  616
            + ++ ++   D   Y   L
Sbjct  632  KRMEKEDLVPDLVTYNVIL  650


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 96/201 (48%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A++++  ++ +  +P  +TY ++++ +C+ G   +A     +M  K      + Y +++N
Sbjct  487  ASSLFTSMLQRNLKPDVITYNTLIDGFCKAGEMERAIELRDDMISKMIHPNYITYGTLMN  546

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +   G   EA +L  +M ++G EPN+ I N L+  + R  +  +  +  K+MK R + P
Sbjct  547  GFCDGGFLSEAFKLWNEMIDKGIEPNIIICNCLIKGYCRHGDPGKALEFLKKMKPRGIFP  606

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +SY ++I  + K + +++     +  +      D     +++  F ++ ++ E   + 
Sbjct  607  DCISYNTLIHGFMKEENIDTAFDLVKRMEKEDLVPDLVTYNVILAQFCRLGRMQEANTIY  666

Query  560  QDLKTDETKLDERLYRSALNA  622
            + +       D   Y S +N 
Sbjct  667  RKMIEKGVNPDRSTYTSLING  687


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 66/156 (42%), Gaps = 35/156 (22%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKG-FDKCI-------  175
            A  ++ +++ +G EP  +    ++  YCR G   KA     +M+ +G F  CI       
Sbjct  557  AFKLWNEMIDKGIEPNIIICNCLIKGYCRHGDPGKALEFLKKMKPRGIFPDCISYNTLIH  616

Query  176  ---------------------------VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEP  274
                                       V Y+ ++  + + GR +EA  +  KM E+G  P
Sbjct  617  GFMKEENIDTAFDLVKRMEKEDLVPDLVTYNVILAQFCRLGRMQEANTIYRKMIEKGVNP  676

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  382
            +   Y +L++ +    N+KQ  K+  EM +R  VPD
Sbjct  677  DRSTYTSLINGYVSQENLKQAFKLHDEMLQRGFVPD  712



>ref|XP_009792923.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X1 [Nicotiana sylvestris]
Length=576

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/220 (27%), Positives = 115/220 (52%), Gaps = 0/220 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ +Q C+P   TY +++N + R G+  KAE  F E+++ GF+  +  Y++++
Sbjct  278  MALKVFNEMKTQKCKPNICTYTALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALM  337

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G  + A  + + M+  GCEP+   YN ++D +GRA   +  + V+ EMKR  + 
Sbjct  338  EAYSRAGYPQGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGIT  397

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   SY  +ISAYS+   +  C +  +  +  G K D  +   M+ ++ ++ +  ++ +L
Sbjct  398  PTMKSYMLLISAYSRNSNVSKCEEIVKQMQKEGVKLDTYLLNNMLNLYGRLGQFAKMEEL  457

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            L  ++      D   Y   +NA   +G   + + +  S A
Sbjct  458  LTVIEAGPYVADISTYNILINAYGRSGFIAKMEEIFHSLA  497


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 104/205 (51%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            R  + A  +++++  + C+P   TY  ++N+Y +      A   F+EM+ +     I  Y
Sbjct  239  RNSQKALVIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKPNICTY  298

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            +++VN + + G  ++A  +  +++E G EP+V+ YN L++ + RA   +   +++  M+ 
Sbjct  299  TALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALMEAYSRAGYPQGAAEIFSLMQH  358

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
                PDR SY  ++ AY +A   E     + + K  G         +++  +S+ + V +
Sbjct  359  MGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGITPTMKSYMLLISAYSRNSNVSK  418

Query  545  LVKLLQDLKTDETKLDERLYRSALN  619
              ++++ ++ +  KLD  L  + LN
Sbjct  419  CEEIVKQMQKEGVKLDTYLLNNMLN  443


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/215 (25%), Positives = 105/215 (49%), Gaps = 6/215 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y  L+   C P + TYA +L  Y + G+  KAE  FSEM + G     + Y++ ++
Sbjct  174  AESTYLALLEARCVPTEDTYALLLKSYSKCGMLEKAEAVFSEMRKNGLPPSALVYNAYID  233

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K    ++A  +  +MK   C+P+   Y  L++++G+ +      KV+ EMK +K  P
Sbjct  234  GLMKGRNSQKALVIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKP  293

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM---NKVDELV  550
            +  +YT++++A+++    E   + +++ +  G + D      ++  +S+        E+ 
Sbjct  294  NICTYTALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALMEAYSRAGYPQGAAEIF  353

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L+Q +  +    D   Y   ++A   AGL   A+
Sbjct  354  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQ  385


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 108/221 (49%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P+ AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G          
Sbjct  346  PQGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGITPTMKSYML  405

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             I AYS                            +M+N+YG+ G+  +   L+  ++   
Sbjct  406  LISAYSRNSNVSKCEEIVKQMQKEGVKLDTYLLNNMLNLYGRLGQFAKMEELLTVIEAGP  465

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
               ++  YN L++ +GR+  + ++E+++  +  + + PD V++TS + AYSK K+ + C+
Sbjct  466  YVADISTYNILINAYGRSGFIAKMEEIFHSLAAKNLKPDVVTWTSRLGAYSKKKQYQRCL  525

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++    G   D   A +++   S  ++++++  +++ +
Sbjct  526  EIFEEMIDEGCYPDGGTAKVLLSSCSSEDQIEQVTTVIRSM  566


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 86/197 (44%), Gaps = 4/197 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEME----QKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P   T+  I+N+  ++ +  + ++     E    +  F   ++ Y+ ++  YG++   K+
Sbjct  114  PTNDTWDDIINVAVQLRINKQWDLIILVCEWILCRSSFQADVICYNLLIEAYGQSSLVKK  173

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A      + E  C P    Y  LL  + +   +++ E V+ EM++  + P  + Y + I 
Sbjct  174  AESTYLALLEARCVPTEDTYALLLKSYSKCGMLEKAEAVFSEMRKNGLPPSALVYNAYID  233

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K +  +  +  +   K    +       +++ ++ K NK    +K+  ++KT + K 
Sbjct  234  GLMKGRNSQKALVIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKP  293

Query  590  DERLYRSALNALRDAGL  640
            +   Y + +NA    GL
Sbjct  294  NICTYTALVNAFARGGL  310



>ref|XP_009593082.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
[Nicotiana tomentosiformis]
Length=576

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 110/208 (53%), Gaps = 0/208 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ +Q C+P   TY +++N + R G+  KAE  F E+++ GF+  +  Y++++
Sbjct  278  MALKVFNEMKTQKCKPNICTYTALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALM  337

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G  + A  + + M+  GCEP+   YN ++D +GRA   +  + V+ EMKR  + 
Sbjct  338  EAYSRAGYPQGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGIA  397

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   SY  +ISAYS+   +  C +  +  +  G K D  +   M+ ++ ++ +  ++ +L
Sbjct  398  PTMKSYMLLISAYSRNSNVSKCEEIVKQMQREGVKLDTFLLNNMLNLYGRLGQFPKMEEL  457

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L  ++      D   Y   +NA   +G 
Sbjct  458  LIVIEAGPYVADISTYNILINAYGRSGF  485


 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 104/205 (51%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            R  + A  +++++  + C+P   TY  ++N+Y +      A   F+EM+ +     I  Y
Sbjct  239  RNSQKALAIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKPNICTY  298

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            +++VN + + G  ++A  +  +++E G EP+V+ YN L++ + RA   +   +++  M+ 
Sbjct  299  TALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALMEAYSRAGYPQGAAEIFSLMQH  358

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
                PDR SY  ++ AY +A   E     + + K  G         +++  +S+ + V +
Sbjct  359  MGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGIAPTMKSYMLLISAYSRNSNVSK  418

Query  545  LVKLLQDLKTDETKLDERLYRSALN  619
              ++++ ++ +  KLD  L  + LN
Sbjct  419  CEEIVKQMQREGVKLDTFLLNNMLN  443


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/215 (25%), Positives = 105/215 (49%), Gaps = 6/215 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y  L+   C P + TYA +L  Y + G+  KAE  FSEM + G     + Y++ ++
Sbjct  174  AESTYLALLEARCVPTEDTYALLLKSYSKCGMLEKAEAAFSEMRKNGLPPSALVYNAYID  233

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K    ++A  +  +MK   C+P+   Y  L++++G+ +      KV+ EMK +K  P
Sbjct  234  GLMKGRNSQKALAIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKP  293

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM---NKVDELV  550
            +  +YT++++A+++    E   + +++ +  G + D      ++  +S+        E+ 
Sbjct  294  NICTYTALVNAFARGGLCEKAEEVFEELQEAGFEPDVYTYNALMEAYSRAGYPQGAAEIF  353

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L+Q +  +    D   Y   ++A   AGL   A+
Sbjct  354  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQ  385


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 110/221 (50%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P+ AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G          
Sbjct  346  PQGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMKRLGIAPTMKSYML  405

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             I AYS                            +M+N+YG+ G+  +   L+  ++   
Sbjct  406  LISAYSRNSNVSKCEEIVKQMQREGVKLDTFLLNNMLNLYGRLGQFPKMEELLIVIEAGP  465

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
               ++  YN L++ +GR+  ++++E++++ +  + + PD V++TS + AYSK K+ + C+
Sbjct  466  YVADISTYNILINAYGRSGFIEKMEEIFQSLPAKNLKPDVVTWTSRLGAYSKKKQYQRCL  525

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++    G   D   A +++   S  ++++++  +++ +
Sbjct  526  EIFEEMIDEGCYPDGGTAKVLLSSCSSEDQIEQVTTVIRSM  566


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/197 (19%), Positives = 85/197 (43%), Gaps = 4/197 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEME----QKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P   T+  I+N+  ++ +  + ++     E    +  F   ++ Y+ ++  YG++   K+
Sbjct  114  PTNDTWDDIINVAVQLRINKQWDLIILVCEWILCRSSFQADVICYNLLIEAYGQSSLVKK  173

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A      + E  C P    Y  LL  + +   +++ E  + EM++  + P  + Y + I 
Sbjct  174  AESTYLALLEARCVPTEDTYALLLKSYSKCGMLEKAEAAFSEMRKNGLPPSALVYNAYID  233

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K +  +  +  +   K    +       +++ ++ K NK    +K+  ++KT + K 
Sbjct  234  GLMKGRNSQKALAIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKVFNEMKTQKCKP  293

Query  590  DERLYRSALNALRDAGL  640
            +   Y + +NA    GL
Sbjct  294  NICTYTALVNAFARGGL  310



>ref|XP_006338777.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Solanum tuberosum]
Length=730

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 106/198 (54%), Gaps = 1/198 (1%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E++  +G  P  VTY +++N YC  G+  +A    + M+  G   C++ Y+S++N   K 
Sbjct  261  EEMEKKGIFPDMVTYNTLINAYCHEGLLEEAYEVINIMKATGLRPCLLTYNSILNGLCKN  320

Query  215  GRHKEA-TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVS  391
            G++  A   L+ +M+E G  P+   YN LL    +  N+ + E V+KEM  R ++PD VS
Sbjct  321  GQYGRARDLLLVEMEESGLSPDTASYNALLAECCKTGNVLEAESVFKEMSCRAIIPDLVS  380

Query  392  YTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
            Y+S+I  +S+   L+  + YY+  K  G K D  +  I++G F +   + E +K+  ++ 
Sbjct  381  YSSLIGLFSRTGRLDRSLAYYEHMKHKGLKPDNVVYTILIGGFCRNGSMKEAMKMRDEML  440

Query  572  TDETKLDERLYRSALNAL  625
                 +D   Y + LN L
Sbjct  441  EQSLVMDVVTYNTILNGL  458


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/158 (27%), Positives = 77/158 (49%), Gaps = 0/158 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A ++ ++++S    P  +TY+ ++N +C  G  S A   + +M   G    IV  +S++ 
Sbjct  537  AFSLRDEMISVNISPNYITYSILINGFCNKGRVSDALRLWDDMIILGIKPTIVTCNSIIK  596

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y ++G    A +   KM+ +G  P+   YNTLLD   R  NM +   +  EM  + + P
Sbjct  597  GYCRSGDASRAAKFRNKMQSQGLFPDSITYNTLLDGFIREENMAKALDLVNEMGNQGLSP  656

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRA  493
            D +SY +++  + K   ++     Y+     G   DR+
Sbjct  657  DVISYNTILDGFCKFGRMQEANMLYRKMVERGINPDRS  694


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 80/147 (54%), Gaps = 0/147 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++ ++  G +P  VT  SI+  YCR G  S+A    ++M+ +G     + Y+++++
Sbjct  572  ALRLWDDMIILGIKPTIVTCNSIIKGYCRSGDASRAAKFRNKMQSQGLFPDSITYNTLLD  631

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + +     +A  LV +M  +G  P+V  YNT+LD   +   M++   ++++M  R + P
Sbjct  632  GFIREENMAKALDLVNEMGNQGLSPDVISYNTILDGFCKFGRMQEANMLYRKMVERGINP  691

Query  380  DRVSYTSVISAYSKAKELESCVKYYQD  460
            DR +YTS+I+ +     L+    ++ +
Sbjct  692  DRSTYTSLINGHVSQDNLKEAFHFHDE  718


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 87/196 (44%), Gaps = 0/196 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
             G  P   +Y ++L   C+ G   +AE  F EM  +     +V+YSS++ ++ +TGR   
Sbjct  337  SGLSPDTASYNALLAECCKTGNVLEAESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLDR  396

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            +      MK +G +P+  +Y  L+    R  +MK+  K+  EM  + +V D V+Y ++++
Sbjct  397  SLAYYEHMKHKGLKPDNVVYTILIGGFCRNGSMKEAMKMRDEMLEQSLVMDVVTYNTILN  456

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K K L    + + +        D      ++  + K   +D+   L + +     K 
Sbjct  457  GLCKGKMLHEADELFNEMLERDVNPDFYTLTTLINGYCKCGNMDKAQTLFEAMLLRNLKP  516

Query  590  DERLYRSALNALRDAG  637
            D   Y S ++     G
Sbjct  517  DVVTYNSLIDGFCKVG  532


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/206 (21%), Positives = 98/206 (48%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V++++  +   P  V+Y+S++ ++ R G   ++   +  M+ KG     V Y+ ++ 
Sbjct  362  AESVFKEMSCRAIIPDLVSYSSLIGLFSRTGRLDRSLAYYEHMKHKGLKPDNVVYTILIG  421

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  KEA ++  +M E+    +V  YNT+L+   +   + + ++++ EM  R V P
Sbjct  422  GFCRNGSMKEAMKMRDEMLEQSLVMDVVTYNTILNGLCKGKMLHEADELFNEMLERDVNP  481

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  + T++I+ Y K   ++     ++   L   K D      ++  F K+  +++   L 
Sbjct  482  DFYTLTTLINGYCKCGNMDKAQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLR  541

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             ++ +     +   Y   +N   + G
Sbjct  542  DEMISVNISPNYITYSILINGFCNKG  567


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            AA    K+ SQG  P  +TY ++L+ + R    +KA    +EM  +G    +++Y+++++
Sbjct  607  AAKFRNKMQSQGLFPDSITYNTLLDGFIREENMAKALDLVNEMGNQGLSPDVISYNTILD  666

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K GR +EA  L  KM ERG  P+   Y +L++ H    N+K+      EM +   +P
Sbjct  667  GFCKFGRMQEANMLYRKMVERGINPDRSTYTSLINGHVSQDNLKEAFHFHDEMLQMGFIP  726

Query  380  D  382
            D
Sbjct  727  D  727


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/201 (21%), Positives = 90/201 (45%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY S+++ +C++G   KA     EM         + YS ++N
Sbjct  502  AQTLFEAMLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSILIN  561

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +   GR  +A RL   M   G +P +   N+++  + R+ +  +  K   +M+ + + P
Sbjct  562  GFCNKGRVSDALRLWDDMIILGIKPTIVTCNSIIKGYCRSGDASRAAKFRNKMQSQGLFP  621

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D ++Y +++  + + + +   +    +    G   D      ++  F K  ++ E   L 
Sbjct  622  DSITYNTLLDGFIREENMAKALDLVNEMGNQGLSPDVISYNTILDGFCKFGRMQEANMLY  681

Query  560  QDLKTDETKLDERLYRSALNA  622
            + +       D   Y S +N 
Sbjct  682  RKMVERGINPDRSTYTSLING  702


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/137 (25%), Positives = 70/137 (51%), Gaps = 0/137 (0%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY +ILN  C+  +  +A+  F+EM ++  +      ++++N Y K G   +A  L   
Sbjct  449  VTYNTILNGLCKGKMLHEADELFNEMLERDVNPDFYTLTTLINGYCKCGNMDKAQTLFEA  508

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            M  R  +P+V  YN+L+D   +  +M++   +  EM    + P+ ++Y+ +I+ +     
Sbjct  509  MLLRNLKPDVVTYNSLIDGFCKVGDMEKAFSLRDEMISVNISPNYITYSILINGFCNKGR  568

Query  431  LESCVKYYQDFKLNGGK  481
            +   ++ + D  + G K
Sbjct  569  VSDALRLWDDMIILGIK  585


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/202 (19%), Positives = 85/202 (42%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +++ +   P   T  +++N YC+ G   KA+  F  M  +     +V Y+S+++
Sbjct  467  ADELFNEMLERDVNPDFYTLTTLINGYCKCGNMDKAQTLFEAMLLRNLKPDVVTYNSLID  526

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A  L  +M      PN   Y+ L++       +    ++W +M    + P
Sbjct  527  GFCKVGDMEKAFSLRDEMISVNISPNYITYSILINGFCNKGRVSDALRLWDDMIILGIKP  586

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+  S+I  Y ++ +     K+    +  G   D      ++  F +   + + + L+
Sbjct  587  TIVTCNSIIKGYCRSGDASRAAKFRNKMQSQGLFPDSITYNTLLDGFIREENMAKALDLV  646

Query  560  QDLKTDETKLDERLYRSALNAL  625
             ++       D   Y + L+  
Sbjct  647  NEMGNQGLSPDVISYNTILDGF  668



>ref|XP_002971064.1| hypothetical protein SELMODRAFT_95253, partial [Selaginella moellendorffii]
 gb|EFJ27662.1| hypothetical protein SELMODRAFT_95253, partial [Selaginella moellendorffii]
Length=814

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 107/206 (52%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V + ++++ C P +VTY  ++N  C+ G   +AE  F  M   GF    V Y+S+++
Sbjct  279  ALKVLDNMLAKACVPTEVTYGILVNSLCKAGTLERAEELFRVMAASGFRPNSVIYTSLIH  338

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K+GR KEA  L  +M E G  P+V  +  ++D   ++ N +Q  K ++EM R    P
Sbjct  339  GFAKSGRMKEACSLFDEMVEAGYRPDVITHTVMIDGLCKSGNFEQAAKSFEEMMRGGCKP  398

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + V+YT++I   SK   + +  +  +    +G   D      ++  F K+ ++DE  +LL
Sbjct  399  NVVTYTTIIQGLSKIGRVANAFRIMKGMIAHGCFPDSVTYICLLDGFCKLGRLDEAAQLL  458

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             +L    +  + +LY S +N L D G
Sbjct  459  DELDKCSSSPNLQLYSSLVNGLCDGG  484


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 94/203 (46%), Gaps = 1/203 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A ++++++V  G  P  +T+  +++  C+ G + +A  +F EM + G    +V Y++++ 
Sbjct  349  ACSLFDEMVEAGYRPDVITHTVMIDGLCKSGNFEQAAKSFEEMMRGGCKPNVVTYTTIIQ  408

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K GR   A R++  M   GC P+   Y  LLD   +   + +  ++  E+ +    P
Sbjct  409  GLSKIGRVANAFRIMKGMIAHGCFPDSVTYICLLDGFCKLGRLDEAAQLLDELDKCSSSP  468

Query  380  DRVSYTSVISAYSKAKELESCV-KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            +   Y+S+++       +E  +   ++  K      D  +   ++    K  ++DE  ++
Sbjct  469  NLQLYSSLVNGLCDGGSVEKTLDDLFEQSKAAAETLDPGLCCSIIVGLCKTGRLDEACRI  528

Query  557  LQDLKTDETKLDERLYRSALNAL  625
             Q + ++  K D   Y   +N L
Sbjct  529  FQRMVSEGCKPDATTYNILINGL  551


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/207 (20%), Positives = 95/207 (46%), Gaps = 1/207 (0%)
 Frame = +2

Query  20   AATVYEKLVSQG-CEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            A  V+ ++++ G   P +  + +++    +     +A   F +ME+ GF    +AY++M+
Sbjct  208  AFEVFHEMMAMGFVPPDRALHTAMVRTLLKAKRVKEAREVFGQMEKCGFPPDAIAYNTMI  267

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +   K G  +EA +++  M  + C P    Y  L++   +A  +++ E++++ M      
Sbjct  268  DGLAKAGHAQEALKVLDNMLAKACVPTEVTYGILVNSLCKAGTLERAEELFRVMAASGFR  327

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P+ V YTS+I  ++K+  ++     + +    G + D     +M+    K    ++  K 
Sbjct  328  PNSVIYTSLIHGFAKSGRMKEACSLFDEMVEAGYRPDVITHTVMIDGLCKSGNFEQAAKS  387

Query  557  LQDLKTDETKLDERLYRSALNALRDAG  637
             +++     K +   Y + +  L   G
Sbjct  388  FEEMMRGGCKPNVVTYTTIIQGLSKIG  414


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 81/178 (46%), Gaps = 4/178 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS---EMEQKGFDKCIVAYSS  190
            A  +++++VS+GC+P   TY  ++N  CR    ++ E  F+   ++E+ G+    V Y+ 
Sbjct  525  ACRIFQRMVSEGCKPDATTYNILINGLCR-SRENRVERAFALLHDLEKVGYLPDAVTYTP  583

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +     K G    A +++ +   RG   +V  Y  L         + +   +++EM R+ 
Sbjct  584  LCIGLCKIGEVDRAVKMLEEASSRGWNADVVAYTALCTGLCYQGQVDRAVSLFQEMVRQG  643

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
              PD  +Y  +I+   K K+LE   K++ +    G K   A    +V        VDE
Sbjct  644  GAPDAAAYCCIINGLIKVKKLEDACKFFDEMIGKGQKPTVATYTALVQALCHAGNVDE  701


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/197 (23%), Positives = 87/197 (44%), Gaps = 1/197 (1%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKM  253
            TY  ++N+      YS+      EM + G      +++ ++  + +T R  +A      M
Sbjct  121  TYNCLMNLLVAEKNYSQCYAIHEEMLKAGIAPNTFSFNILIRSFARTRRADDAVTCFEIM  180

Query  254  KERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP-DRVSYTSVISAYSKAKE  430
            K + C+P++  +  L+D   +A   ++  +V+ EM     VP DR  +T+++    KAK 
Sbjct  181  KRKRCKPDLHTFLILVDCLCKAGMDEKAFEVFHEMMAMGFVPPDRALHTAMVRTLLKAKR  240

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            ++   + +   +  G   D      M+   +K     E +K+L ++        E  Y  
Sbjct  241  VKEAREVFGQMEKCGFPPDAIAYNTMIDGLAKAGHAQEALKVLDNMLAKACVPTEVTYGI  300

Query  611  ALNALRDAGLEIRAKWL  661
             +N+L  AG   RA+ L
Sbjct  301  LVNSLCKAGTLERAEEL  317


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 73/170 (43%), Gaps = 1/170 (1%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P  VTY  +    C+IG   +A     E   +G++  +VAY+++       G+   A  L
Sbjct  576  PDAVTYTPLCIGLCKIGEVDRAVKMLEEASSRGWNADVVAYTALCTGLCYQGQVDRAVSL  635

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
              +M  +G  P+   Y  +++   +   ++   K + EM  +   P   +YT+++ A   
Sbjct  636  FQEMVRQGGAPDAAAYCCIINGLIKVKKLEDACKFFDEMIGKGQKPTVATYTALVQALCH  695

Query  422  AKELESCVKYYQDFKLNGGKTDRAMA-GIMVGVFSKMNKVDELVKLLQDL  568
            A  ++     ++     G      M    ++  F K  KVD  +KL +D+
Sbjct  696  AGNVDEAFHRFESMLARGELVGSVMIYDALIHGFCKALKVDAALKLFEDM  745


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 68/164 (41%), Gaps = 1/164 (1%)
 Frame = +2

Query  149  EQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNM  328
            EQ GF   +  Y+ ++N+      + +   +  +M + G  PN + +N L+    R    
Sbjct  111  EQAGFQHDVFTYNCLMNLLVAEKNYSQCYAIHEEMLKAGIAPNTFSFNILIRSFARTRRA  170

Query  329  KQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGG-KTDRAMAGI  505
                  ++ MKR++  PD  ++  ++    KA   E   + + +    G    DRA+   
Sbjct  171  DDAVTCFEIMKRKRCKPDLHTFLILVDCLCKAGMDEKAFEVFHEMMAMGFVPPDRALHTA  230

Query  506  MVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  637
            MV    K  +V E  ++   ++      D   Y + ++ L  AG
Sbjct  231  MVRTLLKAKRVKEAREVFGQMEKCGFPPDAIAYNTMIDGLAKAG  274



>ref|XP_004233239.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
[Solanum lycopersicum]
Length=576

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 111/211 (53%), Gaps = 0/211 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  ++ ++ +Q C+P   TY +++N + R G+  KAE  F E+++ GF+  +  Y++++
Sbjct  278  MALKMFNEMKAQKCKPNICTYTALVNAFARSGLCEKAEEVFEELQEAGFEPDVYTYNALM  337

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G  + A  + + M+  GCEP+   YN ++D +GRA   +  + V+ EM R  + 
Sbjct  338  EAYSRAGYPQGAAEIFSLMQHMGCEPDTASYNIMVDAYGRAGLHEDAQTVFDEMTRLGIA  397

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   SY  +ISAYS+   +  C +     + +G K D  +   M+ ++ ++ +  ++ +L
Sbjct  398  PTMKSYMLLISAYSRNSNVSKCEEIVNQMQKSGVKLDTFLLNSMLNLYGRLGQFAKMEEL  457

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIR  649
            L  ++      D   Y   +NA   +G  ++
Sbjct  458  LTVIEAGPYVADISTYNILINAYGRSGFIVK  488


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/205 (23%), Positives = 101/205 (49%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            R  + A  +++++  + C+P   TY  ++N+Y +      A   F+EM+ +     I  Y
Sbjct  239  RNSQKALAIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKMFNEMKAQKCKPNICTY  298

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            +++VN + ++G  ++A  +  +++E G EP+V+ YN L++ + RA   +   +++  M+ 
Sbjct  299  TALVNAFARSGLCEKAEEVFEELQEAGFEPDVYTYNALMEAYSRAGYPQGAAEIFSLMQH  358

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
                PD  SY  ++ AY +A   E     + +    G         +++  +S+ + V +
Sbjct  359  MGCEPDTASYNIMVDAYGRAGLHEDAQTVFDEMTRLGIAPTMKSYMLLISAYSRNSNVSK  418

Query  545  LVKLLQDLKTDETKLDERLYRSALN  619
              +++  ++    KLD  L  S LN
Sbjct  419  CEEIVNQMQKSGVKLDTFLLNSMLN  443


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 107/221 (48%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P+ AA ++  +   GCEP   +Y  +++ Y R G++  A+  F EM + G          
Sbjct  346  PQGAAEIFSLMQHMGCEPDTASYNIMVDAYGRAGLHEDAQTVFDEMTRLGIAPTMKSYML  405

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             I AYS                            SM+N+YG+ G+  +   L+  ++   
Sbjct  406  LISAYSRNSNVSKCEEIVNQMQKSGVKLDTFLLNSMLNLYGRLGQFAKMEELLTVIEAGP  465

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
               ++  YN L++ +GR+  + ++E+V++ +  + + PD V++TS + AYSK K+ + C+
Sbjct  466  YVADISTYNILINAYGRSGFIVKMEEVFQSLPSKNLQPDVVTWTSRLGAYSKKKQYQRCL  525

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++    G   D   A +++   S  ++++++  +++ +
Sbjct  526  EIFEEMIDEGCYPDGGTAKVLLSSCSSEDQIEQVTTVIRSM  566


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 105/215 (49%), Gaps = 6/215 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y  LV   C P + TYA +L  Y +  +  KAE  FSEM + G     + Y++ ++
Sbjct  174  AESTYLALVDARCVPTEDTYALLLKSYSKCRMIEKAEAVFSEMRKNGLPSSALVYNAYID  233

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K    ++A  +  +MK   C+P+   Y  L++++G+ +      K++ EMK +K  P
Sbjct  234  GLMKGRNSQKALAIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKMFNEMKAQKCKP  293

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKM---NKVDELV  550
            +  +YT++++A++++   E   + +++ +  G + D      ++  +S+        E+ 
Sbjct  294  NICTYTALVNAFARSGLCEKAEEVFEELQEAGFEPDVYTYNALMEAYSRAGYPQGAAEIF  353

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L+Q +  +    D   Y   ++A   AGL   A+
Sbjct  354  SLMQHMGCEP---DTASYNIMVDAYGRAGLHEDAQ  385



>emb|CBI24234.3| unnamed protein product [Vitis vinifera]
Length=589

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 101/192 (53%), Gaps = 0/192 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G  P  VTY +++N YCR G+  +A      M  KG   C+  Y++++N   KTG++  
Sbjct  126  KGVFPDVVTYNTLINAYCRQGLLEEAFELMDSMSGKGLKPCVFTYNAIINGLCKTGKYLR  185

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  ++ +M + G  P+   YN LL    R  NM   E+++ EM  + VVPD VS++++I 
Sbjct  186  AKGVLDEMLKIGMSPDTATYNILLVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIG  245

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
              SK   L+  +KY++D K  G   D  +  I++G F +   + E +K+  ++      L
Sbjct  246  LLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCVL  305

Query  590  DERLYRSALNAL  625
            D   Y + LN L
Sbjct  306  DVVTYNTILNGL  317


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V ++++ QGC    VTY +ILN  C+  + S+A+  F+EM ++G       +++++N
Sbjct  291  ALKVRDEMLEQGCVLDVVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLIN  350

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K G   +A  L   M +R  +P+V  YNTL+D   + S M++V ++W +M  R++ P
Sbjct  351  GYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYP  410

Query  380  DRVSYTSVISAY  415
            + +SY  +I+ Y
Sbjct  411  NHISYGILINGY  422


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/179 (26%), Positives = 93/179 (52%), Gaps = 3/179 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++ SQG  P  V++++++ +  + G   +A   F +M+  G     V Y+ ++ 
Sbjct  221  AERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIG  280

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G   EA ++  +M E+GC  +V  YNT+L+   +   + + ++++ EM  R V P
Sbjct  281  GFCRNGVMSEALKVRDEMLEQGCVLDVVTYNTILNGLCKEKMLSEADELFTEMTERGVFP  340

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF---SKMNKVDEL  547
            D  ++T++I+ YSK   +   V  ++       K D      ++  F   S+M KV+EL
Sbjct  341  DFYTFTTLINGYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNEL  399


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 76/147 (52%), Gaps = 0/147 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++V +G E   +T  +I+  YCR G   KA+   S M  KG     + Y++++N
Sbjct  431  AFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSNMLLKGIVPDGITYNTLIN  490

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K      A  LV KM+  G  P+V  YN +L+   R   M++ E +  +M  R V P
Sbjct  491  GFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIMLKMIERGVNP  550

Query  380  DRVSYTSVISAYSKAKELESCVKYYQD  460
            DR +YTS+I+ +     L+   + + +
Sbjct  551  DRSTYTSLINGHVTQNNLKEAFRVHDE  577


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 75/136 (55%), Gaps = 0/136 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++  ++S+   P  ++Y  ++N YC +G  S+A   + EM +KGF+  I+  +++V  Y 
Sbjct  399  LWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYC  458

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G   +A   ++ M  +G  P+   YNTL++   +  NM +   +  +M+   ++PD +
Sbjct  459  RAGNAVKADEFLSNMLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVI  518

Query  389  SYTSVISAYSKAKELE  436
            +Y  +++ +S+   ++
Sbjct  519  TYNVILNGFSRQGRMQ  534


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 102/220 (46%), Gaps = 6/220 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY ++++ +C+     K    +++M  +      ++Y  ++N
Sbjct  361  AVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYPNHISYGILIN  420

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G   EA RL  +M E+G E  +   NT++  + RA N  + ++    M  + +VP
Sbjct  421  GYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSNMLLKGIVP  480

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D ++Y ++I+ + K + ++         + +G   D     +++  FS+  ++ E   ++
Sbjct  481  DGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIM  540

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  679
              +       D   Y S +N        +    L+E+F V
Sbjct  541  LKMIERGVNPDRSTYTSLING------HVTQNNLKEAFRV  574


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 87/202 (43%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V ++++  G  P   TY  +L   CR      AE  F EM  +G    +V++S+++ 
Sbjct  186  AKGVLDEMLKIGMSPDTATYNILLVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIG  245

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +  K G   +A +    MK  G  P+  IY  L+    R   M +  KV  EM  +  V 
Sbjct  246  LLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCVL  305

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+Y ++++   K K L    + + +    G   D      ++  +SK   +++ V L 
Sbjct  306  DVVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLINGYSKDGNMNKAVTLF  365

Query  560  QDLKTDETKLDERLYRSALNAL  625
            + +     K D   Y + ++  
Sbjct  366  EMMIQRNLKPDVVTYNTLIDGF  387


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A      ++ +G  P  +TY +++N + +     +A    ++ME  G    ++ Y+ ++N
Sbjct  466  ADEFLSNMLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILN  525

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + GR +EA  ++ KM ERG  P+   Y +L++ H   +N+K+  +V  EM +R  VP
Sbjct  526  GFSRQGRMQEAELIMLKMIERGVNPDRSTYTSLINGHVTQNNLKEAFRVHDEMLQRGFVP  585

Query  380  D  382
            D
Sbjct  586  D  586



>emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera]
Length=850

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 101/192 (53%), Gaps = 0/192 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G  P  VTY +++N YCR G+  +A      M  KG   C+  Y++++N   KTG++  
Sbjct  387  KGVFPDVVTYNTLINAYCRQGLLEEAFELMDSMSGKGLKPCVFTYNAIINGLCKTGKYLR  446

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  ++ +M + G  P+   YN LL    R  NM   E+++ EM  + VVPD VS++++I 
Sbjct  447  AKGVLDEMLKIGMSPDTATYNILLVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIG  506

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
              SK   L+  +KY++D K  G   D  +  I++G F +   + E +K+  ++      L
Sbjct  507  LLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCXL  566

Query  590  DERLYRSALNAL  625
            D   Y + LN L
Sbjct  567  DVVTYNTILNGL  578


 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V ++++ QGC    VTY +ILN  C+  + S+A+  F+EM ++G       +++++N
Sbjct  552  ALKVRDEMLEQGCXLDVVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLIN  611

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K G   +A  L   M +R  +P+V  YNTL+D   + S M++V ++W +M  R++ P
Sbjct  612  GYXKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYP  671

Query  380  DRVSYTSVISAY  415
            + +SY  +I+ Y
Sbjct  672  NHISYGILINGY  683


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 92/179 (51%), Gaps = 3/179 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++ SQG  P  V++++++ +  + G   +A   F +M+  G     V Y+ ++ 
Sbjct  482  AERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIG  541

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G   EA ++  +M E+GC  +V  YNT+L+   +   + + ++++ EM  R V P
Sbjct  542  GFCRNGVMSEALKVRDEMLEQGCXLDVVTYNTILNGLCKEKMLSEADELFTEMTERGVFP  601

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF---SKMNKVDEL  547
            D  ++T++I+ Y K   +   V  ++       K D      ++  F   S+M KV+EL
Sbjct  602  DFYTFTTLINGYXKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNEL  660


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 78/156 (50%), Gaps = 0/156 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++V +G E   +T  +I+  YCR G   KA+   S M  KG     + Y++++N
Sbjct  692  AFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSNMLLKGIVPDGITYNTLIN  751

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K      A  LV KM+  G  P+V  YN +L+   R   M++ E +  +M  R V P
Sbjct  752  GFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIMLKMIERGVNP  811

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            DR +YTS+I+ +     L+   + + +    G   D
Sbjct  812  DRSTYTSLINGHVTQNNLKEAFRVHDEMLQRGFVPD  847


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 75/136 (55%), Gaps = 0/136 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++  ++S+   P  ++Y  ++N YC +G  S+A   + EM +KGF+  I+  +++V  Y 
Sbjct  660  LWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYC  719

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G   +A   ++ M  +G  P+   YNTL++   +  NM +   +  +M+   ++PD +
Sbjct  720  RAGNAVKADEFLSNMLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVI  779

Query  389  SYTSVISAYSKAKELE  436
            +Y  +++ +S+   ++
Sbjct  780  TYNVILNGFSRQGRMQ  795


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 102/220 (46%), Gaps = 6/220 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY ++++ +C+     K    +++M  +      ++Y  ++N
Sbjct  622  AVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYPNHISYGILIN  681

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G   EA RL  +M E+G E  +   NT++  + RA N  + ++    M  + +VP
Sbjct  682  GYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSNMLLKGIVP  741

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D ++Y ++I+ + K + ++         + +G   D     +++  FS+  ++ E   ++
Sbjct  742  DGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIM  801

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  679
              +       D   Y S +N        +    L+E+F V
Sbjct  802  LKMIERGVNPDRSTYTSLING------HVTQNNLKEAFRV  835



>ref|NP_001046025.1| Os02g0170000 [Oryza sativa Japonica Group]
 dbj|BAD25179.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF07939.1| Os02g0170000 [Oryza sativa Japonica Group]
Length=397

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 111/209 (53%), Gaps = 1/209 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  +  V+ ++ S GC+P   TY +++N + R G+  KAE  F EM+Q G +  + AY++
Sbjct  98   PMSSMKVFNEMKSIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNA  157

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y + G  + A+ + + M+  GCEP+   YN L+D +GRA   +  E V++E+K+R 
Sbjct  158  LMEAYSRAGLPQGASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRG  217

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P   S+  +++A++++     C +       +G   D      M+  +++  ++D++ 
Sbjct  218  MSPTMKSHMLLLAAHARSGNATRCEEVMAQLHKSGLTPDTFALNAMLNAYARAGRLDDME  277

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAG  637
            +L   ++      D   Y  A+NA   AG
Sbjct  278  RLFAAMER-RGDADVGTYNVAVNAYGRAG  305


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/212 (24%), Positives = 93/212 (44%), Gaps = 35/212 (17%)
 Frame = +2

Query  41   LVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS----------  190
            L+   C P + TYA +L  YC  G   +AE   SEM + G       Y++          
Sbjct  3    LLEAQCVPTEDTYALLLRAYCNAGSLHRAEGVISEMREHGIPPNATVYNAYLDGLLKARC  62

Query  191  -------------------------MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNT  295
                                     M+N+YGK  +   + ++  +MK  GC+PN+  Y  
Sbjct  63   TEKAVEVYQRMKRERCRANTETFTLMINVYGKAKQPMSSMKVFNEMKSIGCKPNICTYTA  122

Query  296  LLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNG  475
            L++   R    ++ E+V++EM++    PD  +Y +++ AYS+A   +   + +   +  G
Sbjct  123  LVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMQHMG  182

Query  476  GKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
             + DRA   I+V  + +    ++   + ++LK
Sbjct  183  CEPDRASYNILVDAYGRAGLHEDAEAVFEELK  214


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 94/206 (46%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  VY+++  + C     T+  ++N+Y +      +   F+EM+  G    I  Y+++VN
Sbjct  66   AVEVYQRMKRERCRANTETFTLMINVYGKAKQPMSSMKVFNEMKSIGCKPNICTYTALVN  125

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M++ G EP+V+ YN L++ + RA   +   +++  M+     P
Sbjct  126  AFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMQHMGCEP  185

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A   E     +++ K  G         +++   ++        +++
Sbjct  186  DRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHMLLLAAHARSGNATRCEEVM  245

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              L       D     + LNA   AG
Sbjct  246  AQLHKSGLTPDTFALNAMLNAYARAG  271


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 103/221 (47%), Gaps = 36/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD--------  166
            P+ A+ ++  +   GCEP + +Y  +++ Y R G++  AE  F E++Q+G          
Sbjct  168  PQGASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHML  227

Query  167  ------------KC---------------IVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                        +C                 A ++M+N Y + GR  +  RL A M+ RG
Sbjct  228  LLAAHARSGNATRCEEVMAQLHKSGLTPDTFALNAMLNAYARAGRLDDMERLFAAMERRG  287

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
             + +V  YN  ++ +GRA  + ++E  +  +  R +  D V++T+ + AY++ KE   CV
Sbjct  288  -DADVGTYNVAVNAYGRAGYVGRMEAAFAAVAARGLAADVVTWTARMGAYARRKEYGRCV  346

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
               ++    G   D   A +++   S   +V+++  +++ +
Sbjct  347  GMVEEMVDAGCYPDAGTARVLLAACSDERQVEQVTAIVRSM  387



>ref|NP_181058.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|O82178.1|PP186_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g35130 
[Arabidopsis thaliana]
 gb|AAC61823.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09068.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=591

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 108/204 (53%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +Y ++ S  C+P   TY +++N + R G+  KAE  F ++++ G +  +  Y++++  Y 
Sbjct  286  LYCEMRSHQCKPNICTYTALVNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMESYS  345

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G    A  + + M+  GCEP+   YN ++D +GRA      E V++EMKR  + P   
Sbjct  346  RAGYPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEEMKRLGIAPTMK  405

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            S+  ++SAYSKA+++  C    ++   NG + D  +   M+ ++ ++ +  ++ K+L ++
Sbjct  406  SHMLLLSAYSKARDVTKCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEM  465

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +      D   Y   +N    AG 
Sbjct  466  ENGPCTADISTYNILINIYGKAGF  489


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 113/221 (51%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P  AA ++  +   GCEP + +Y  +++ Y R G++S AE  F EM++ G          
Sbjct  350  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEEMKRLGIAPTMKSHML  409

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             + AYS                            SM+N+YG+ G+  +  +++A+M+   
Sbjct  410  LLSAYSKARDVTKCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEMENGP  469

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C  ++  YN L++I+G+A  ++++E+++ E+K +   PD V++TS I AYS+ K    C+
Sbjct  470  CTADISTYNILINIYGKAGFLERIEELFVELKEKNFRPDVVTWTSRIGAYSRKKLYVKCL  529

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++   +G   D   A +++   S   +V+++  +L+ +
Sbjct  530  EVFEEMIDSGCAPDGGTAKVLLSACSSEEQVEQVTSVLRTM  570


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 92/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  318  AEEIFEQLQEDGLEPDVYVYNALMESYSRAGYPYGAAEIFSLMQHMGCEPDRASYNIMVD  377

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H +A  +  +MK  G  P +  +  LL  + +A ++ + E + KEM    V P
Sbjct  378  AYGRAGLHSDAEAVFEEMKRLGIAPTMKSHMLLLSAYSKARDVTKCEAIVKEMSENGVEP  437

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +     K   + +      D +   I++ ++ K   ++ + +L 
Sbjct  438  DTFVLNSMLNLYGRLGQFTKMEKILAEMENGPCTADISTYNILINIYGKAGFLERIEELF  497

Query  560  QDLKTDETKLDERLYRSALNA  622
             +LK    + D   + S + A
Sbjct  498  VELKEKNFRPDVVTWTSRIGA  518


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/223 (22%), Positives = 108/223 (48%), Gaps = 10/223 (4%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDK---CIVAYSS  190
            A ++Y +L+     P + TYA ++  YC  G+  +AE+   EM+          +  Y++
Sbjct  174  AESLYVQLLESRYVPTEDTYALLIKAYCMAGLIERAEVVLVEMQNHHVSPKTIGVTVYNA  233

Query  191  MV-NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRR  367
             +  +  + G  +EA  +  +MK   C+P    YN +++++G+AS      K++ EM+  
Sbjct  234  YIEGLMKRKGNTEEAIDVFQRMKRDRCKPTTETYNLMINLYGKASKSYMSWKLYCEMRSH  293

Query  368  KVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KV  538
            +  P+  +YT++++A+++    E   + ++  + +G + D  +   ++  +S+       
Sbjct  294  QCKPNICTYTALVNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMESYSRAGYPYGA  353

Query  539  DELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
             E+  L+Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  354  AEIFSLMQHMGCEP---DRASYNIMVDAYGRAGLHSDAEAVFE  393



>ref|XP_002275790.2| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651511.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
 ref|XP_010651512.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Vitis vinifera]
Length=746

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 101/192 (53%), Gaps = 0/192 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G  P  VTY +++N YCR G+  +A      M  KG   C+  Y++++N   KTG++  
Sbjct  283  KGVFPDVVTYNTLINAYCRQGLLEEAFELMDSMSGKGLKPCVFTYNAIINGLCKTGKYLR  342

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  ++ +M + G  P+   YN LL    R  NM   E+++ EM  + VVPD VS++++I 
Sbjct  343  AKGVLDEMLKIGMSPDTATYNILLVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIG  402

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
              SK   L+  +KY++D K  G   D  +  I++G F +   + E +K+  ++      L
Sbjct  403  LLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCVL  462

Query  590  DERLYRSALNAL  625
            D   Y + LN L
Sbjct  463  DVVTYNTILNGL  474


 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V ++++ QGC    VTY +ILN  C+  + S+A+  F+EM ++G       +++++N
Sbjct  448  ALKVRDEMLEQGCVLDVVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLIN  507

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K G   +A  L   M +R  +P+V  YNTL+D   + S M++V ++W +M  R++ P
Sbjct  508  GYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYP  567

Query  380  DRVSYTSVISAY  415
            + +SY  +I+ Y
Sbjct  568  NHISYGILINGY  579


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/179 (26%), Positives = 93/179 (52%), Gaps = 3/179 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++ SQG  P  V++++++ +  + G   +A   F +M+  G     V Y+ ++ 
Sbjct  378  AERIFDEMPSQGVVPDLVSFSALIGLLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIG  437

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G   EA ++  +M E+GC  +V  YNT+L+   +   + + ++++ EM  R V P
Sbjct  438  GFCRNGVMSEALKVRDEMLEQGCVLDVVTYNTILNGLCKEKMLSEADELFTEMTERGVFP  497

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF---SKMNKVDEL  547
            D  ++T++I+ YSK   +   V  ++       K D      ++  F   S+M KV+EL
Sbjct  498  DFYTFTTLINGYSKDGNMNKAVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNEL  556


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 78/156 (50%), Gaps = 0/156 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++V +G E   +T  +I+  YCR G   KA+   S M  KG     + Y++++N
Sbjct  588  AFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSNMLLKGIVPDGITYNTLIN  647

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K      A  LV KM+  G  P+V  YN +L+   R   M++ E +  +M  R V P
Sbjct  648  GFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIMLKMIERGVNP  707

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            DR +YTS+I+ +     L+   + + +    G   D
Sbjct  708  DRSTYTSLINGHVTQNNLKEAFRVHDEMLQRGFVPD  743


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 75/136 (55%), Gaps = 0/136 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++  ++S+   P  ++Y  ++N YC +G  S+A   + EM +KGF+  I+  +++V  Y 
Sbjct  556  LWNDMISRRIYPNHISYGILINGYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYC  615

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G   +A   ++ M  +G  P+   YNTL++   +  NM +   +  +M+   ++PD +
Sbjct  616  RAGNAVKADEFLSNMLLKGIVPDGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVI  675

Query  389  SYTSVISAYSKAKELE  436
            +Y  +++ +S+   ++
Sbjct  676  TYNVILNGFSRQGRMQ  691


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 102/220 (46%), Gaps = 6/220 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++E ++ +  +P  VTY ++++ +C+     K    +++M  +      ++Y  ++N
Sbjct  518  AVTLFEMMIQRNLKPDVVTYNTLIDGFCKGSEMEKVNELWNDMISRRIYPNHISYGILIN  577

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G   EA RL  +M E+G E  +   NT++  + RA N  + ++    M  + +VP
Sbjct  578  GYCNMGCVSEAFRLWDEMVEKGFEATIITCNTIVKGYCRAGNAVKADEFLSNMLLKGIVP  637

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D ++Y ++I+ + K + ++         + +G   D     +++  FS+  ++ E   ++
Sbjct  638  DGITYNTLINGFIKEENMDRAFALVNKMENSGLLPDVITYNVILNGFSRQGRMQEAELIM  697

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  679
              +       D   Y S +N        +    L+E+F V
Sbjct  698  LKMIERGVNPDRSTYTSLING------HVTQNNLKEAFRV  731


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 87/202 (43%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V ++++  G  P   TY  +L   CR      AE  F EM  +G    +V++S+++ 
Sbjct  343  AKGVLDEMLKIGMSPDTATYNILLVECCRNDNMMDAERIFDEMPSQGVVPDLVSFSALIG  402

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +  K G   +A +    MK  G  P+  IY  L+    R   M +  KV  EM  +  V 
Sbjct  403  LLSKNGCLDQALKYFRDMKNAGLAPDNVIYTILIGGFCRNGVMSEALKVRDEMLEQGCVL  462

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+Y ++++   K K L    + + +    G   D      ++  +SK   +++ V L 
Sbjct  463  DVVTYNTILNGLCKEKMLSEADELFTEMTERGVFPDFYTFTTLINGYSKDGNMNKAVTLF  522

Query  560  QDLKTDETKLDERLYRSALNAL  625
            + +     K D   Y + ++  
Sbjct  523  EMMIQRNLKPDVVTYNTLIDGF  544



>ref|NP_001189682.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AEC09069.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=613

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 108/204 (53%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +Y ++ S  C+P   TY +++N + R G+  KAE  F ++++ G +  +  Y++++  Y 
Sbjct  308  LYCEMRSHQCKPNICTYTALVNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMESYS  367

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G    A  + + M+  GCEP+   YN ++D +GRA      E V++EMKR  + P   
Sbjct  368  RAGYPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEEMKRLGIAPTMK  427

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            S+  ++SAYSKA+++  C    ++   NG + D  +   M+ ++ ++ +  ++ K+L ++
Sbjct  428  SHMLLLSAYSKARDVTKCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEM  487

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +      D   Y   +N    AG 
Sbjct  488  ENGPCTADISTYNILINIYGKAGF  511


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 113/221 (51%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P  AA ++  +   GCEP + +Y  +++ Y R G++S AE  F EM++ G          
Sbjct  372  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEEMKRLGIAPTMKSHML  431

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             + AYS                            SM+N+YG+ G+  +  +++A+M+   
Sbjct  432  LLSAYSKARDVTKCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEMENGP  491

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C  ++  YN L++I+G+A  ++++E+++ E+K +   PD V++TS I AYS+ K    C+
Sbjct  492  CTADISTYNILINIYGKAGFLERIEELFVELKEKNFRPDVVTWTSRIGAYSRKKLYVKCL  551

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++   +G   D   A +++   S   +V+++  +L+ +
Sbjct  552  EVFEEMIDSGCAPDGGTAKVLLSACSSEEQVEQVTSVLRTM  592


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 92/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  340  AEEIFEQLQEDGLEPDVYVYNALMESYSRAGYPYGAAEIFSLMQHMGCEPDRASYNIMVD  399

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H +A  +  +MK  G  P +  +  LL  + +A ++ + E + KEM    V P
Sbjct  400  AYGRAGLHSDAEAVFEEMKRLGIAPTMKSHMLLLSAYSKARDVTKCEAIVKEMSENGVEP  459

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +     K   + +      D +   I++ ++ K   ++ + +L 
Sbjct  460  DTFVLNSMLNLYGRLGQFTKMEKILAEMENGPCTADISTYNILINIYGKAGFLERIEELF  519

Query  560  QDLKTDETKLDERLYRSALNA  622
             +LK    + D   + S + A
Sbjct  520  VELKEKNFRPDVVTWTSRIGA  540


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/223 (22%), Positives = 108/223 (48%), Gaps = 10/223 (4%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDK---CIVAYSS  190
            A ++Y +L+     P + TYA ++  YC  G+  +AE+   EM+          +  Y++
Sbjct  196  AESLYVQLLESRYVPTEDTYALLIKAYCMAGLIERAEVVLVEMQNHHVSPKTIGVTVYNA  255

Query  191  MV-NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRR  367
             +  +  + G  +EA  +  +MK   C+P    YN +++++G+AS      K++ EM+  
Sbjct  256  YIEGLMKRKGNTEEAIDVFQRMKRDRCKPTTETYNLMINLYGKASKSYMSWKLYCEMRSH  315

Query  368  KVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KV  538
            +  P+  +YT++++A+++    E   + ++  + +G + D  +   ++  +S+       
Sbjct  316  QCKPNICTYTALVNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMESYSRAGYPYGA  375

Query  539  DELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
             E+  L+Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  376  AEIFSLMQHMGCEP---DRASYNIMVDAYGRAGLHSDAEAVFE  415



>ref|XP_010509658.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X2 [Camelina sativa]
Length=590

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 111/211 (53%), Gaps = 0/211 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++ ++ S  C+P  +TY ++LN + R G+  KAE  F ++++ G +  +  Y++++  Y 
Sbjct  284  LFCEMRSHQCKPNIITYTALLNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMEAYS  343

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G    A  + + M+  GCEP+   YN ++D +GRA      E V++ MKR  + P   
Sbjct  344  RAGYPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEAMKRLGIAPTMK  403

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            S+  ++SAYS+A+++  C    ++   NG + D  +   M+ ++ ++ +  ++ K+L ++
Sbjct  404  SHMLLLSAYSRARDVTKCEAVVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEM  463

Query  569  KTDETKLDERLYRSALNALRDAGLEIRAKWL  661
            +      D   Y   +N    AG   R + L
Sbjct  464  ENGPCTADISTYNILINIYGKAGFLERVEEL  494


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/221 (25%), Positives = 111/221 (50%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS----------------  142
            P  AA ++  +   GCEP + +Y  +++ Y R G++S AE  F                 
Sbjct  348  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEAMKRLGIAPTMKSHML  407

Query  143  -------------------EMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                               EM + G +      +SM+N+YG+ G+  +  +++A+M+   
Sbjct  408  LLSAYSRARDVTKCEAVVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEMENGP  467

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C  ++  YN L++I+G+A  +++VE+++ E+K R   PD V++TS I AYS+ K    C+
Sbjct  468  CTADISTYNILINIYGKAGFLERVEELFSELKERNFRPDVVTWTSRIGAYSRKKLYVKCL  527

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++   +G   D   A +++   S  ++V+++  +L+ +
Sbjct  528  EIFEEMIDSGCAPDGGTAKVLLSSCSSEDQVEQVTSVLRTM  568


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 109/221 (49%), Gaps = 7/221 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV-  196
            A ++Y +L+   C P + TYA ++  YC  G+  KAE    EM+          Y++ + 
Sbjct  175  AESLYVQLLESRCVPTEDTYALLVKAYCMAGLIEKAEAVLVEMQNHHVSPSTTVYNAYIE  234

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
             +  + G  +EA  +  +MK   C+P    YN +++++G+AS      K++ EM+  +  
Sbjct  235  GLIKRKGNTEEAINVFQRMKRDPCKPTTETYNLMINLYGKASKSFMSWKLFCEMRSHQCK  294

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDEL  547
            P+ ++YT++++A+++    E   + ++  + +G + D  +   ++  +S+        E+
Sbjct  295  PNIITYTALLNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEI  354

Query  548  VKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  670
              L+Q +  +    D   Y   ++A   AGL   A+ + E+
Sbjct  355  FSLMQHMGCEP---DRASYNIMVDAYGRAGLHSDAEAVFEA  392


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 91/201 (45%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  316  AEEIFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEIFSLMQHMGCEPDRASYNIMVD  375

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H +A  +   MK  G  P +  +  LL  + RA ++ + E V KEM    V P
Sbjct  376  AYGRAGLHSDAEAVFEAMKRLGIAPTMKSHMLLLSAYSRARDVTKCEAVVKEMSENGVEP  435

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +     K   + +      D +   I++ ++ K   ++ + +L 
Sbjct  436  DTFVLNSMLNLYGRLGQFTKMEKILAEMENGPCTADISTYNILINIYGKAGFLERVEELF  495

Query  560  QDLKTDETKLDERLYRSALNA  622
             +LK    + D   + S + A
Sbjct  496  SELKERNFRPDVVTWTSRIGA  516


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 80/177 (45%), Gaps = 1/177 (1%)
 Frame = +2

Query  146  MEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASN  325
            + +  F   ++ ++ +++ YG+  R+KEA  L  ++ E  C P    Y  L+  +  A  
Sbjct  147  LRRSSFQPDVICFNLLIDAYGQKFRYKEAESLYVQLLESRCVPTEDTYALLVKAYCMAGL  206

Query  326  MKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAK-ELESCVKYYQDFKLNGGKTDRAMAG  502
            +++ E V  EM+   V P    Y + I    K K   E  +  +Q  K +  K       
Sbjct  207  IEKAEAVLVEMQNHHVSPSTTVYNAYIEGLIKRKGNTEEAINVFQRMKRDPCKPTTETYN  266

Query  503  IMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            +M+ ++ K +K     KL  ++++ + K +   Y + LNA    GL  +A+ + E  
Sbjct  267  LMINLYGKASKSFMSWKLFCEMRSHQCKPNIITYTALLNAFAREGLCEKAEEIFEQL  323



>ref|XP_010494168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial isoform X1 [Camelina sativa]
 ref|XP_010494169.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial isoform X2 [Camelina sativa]
Length=709

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 107/202 (53%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T +++++SQG EP +VT+ ++++ +C+ G +  A+  F  ME++G   C   Y+ M+N
Sbjct  463  AMTTFDRMLSQGIEPDRVTWNTLIDCHCKHGRHLVAQEMFEAMERRGCFPCATTYNIMIN  522

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG   R  +  RL+AKMK +G  PNV  + TL+D++G++       K  +EMK   + P
Sbjct  523  SYGDQERWDDMKRLLAKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIKCLEEMKSVGLKP  582

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++    +G K        ++  F +  +  E   +L
Sbjct  583  SSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGEDRRDAEAFAVL  642

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  643  QYMKENGVKPDVVTYTTLMKAL  664


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 104/221 (47%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G +P +  Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  431  VLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSQGIEPDRVTWNTLIDCHC  490

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH  A  +   M+ RGC P    YN +++ +G       ++++  +MK + ++P+ V
Sbjct  491  KHGRHLVAQEMFEAMERRGCFPCATTYNIMINSYGDQERWDDMKRLLAKMKSQGILPNVV  550

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            ++T+++  Y K+      +K  ++ K  G K    M   ++  +++    ++ V   + +
Sbjct  551  THTTLVDVYGKSGRFNDAIKCLEEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVM  610

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
             +D  K       S +NA     RDA          E+FAV
Sbjct  611  TSDGLKPSLLALNSLINAFGEDRRDA----------EAFAV  641


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            + G      T  SI++     G   +AE  F E+ + G      AY++++  Y KTG  K
Sbjct  297  ATGLSAKTATLVSIISALANSGRTLEAEALFEELRRSGIKPRTKAYNALLKGYVKTGPLK  356

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M++RG  P+   Y+ L+D +  A   +    V KEM+   V P+   ++ ++
Sbjct  357  DAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLL  416

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + Y    E +   +  ++ K  G K DR    +++  F K N +D 
Sbjct  417  AGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDH  462


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 77/164 (47%), Gaps = 0/164 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G +P    Y ++L  Y + G    AE   SEME++G       YS +++
Sbjct  323  AEALFEELRRSGIKPRTKAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLID  382

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ LL  +      ++  +V KEMK   V P
Sbjct  383  AYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKP  442

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            DR  Y  VI  + K   L+  +  +      G + DR     ++
Sbjct  443  DRQFYNVVIDTFGKFNCLDHAMTTFDRMLSQGIEPDRVTWNTLI  486


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 68/132 (52%), Gaps = 0/132 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E++ S G +P    Y +++N Y + G+  +A   F  M   G    ++A +S++N +G+ 
Sbjct  573  EEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGED  632

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
             R  EA  ++  MKE G +P+V  Y TL+    R    ++V  V++EM      PDR + 
Sbjct  633  RRDAEAFAVLQYMKENGVKPDVVTYTTLMKALIRVDKFQKVPGVYEEMIMSGCKPDRKAR  692

Query  395  TSVISAYSKAKE  430
            + + SA    K+
Sbjct  693  SMLRSALRYMKQ  704


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 94/211 (45%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ +L  Y   G + K      EM+  G       Y+ +++
Sbjct  393  ARIVLKEMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVID  452

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M  +G EP+   +NTL+D H +       +++++ M+RR   P
Sbjct  453  TFGKFNCLDHAMTTFDRMLSQGIEPDRVTWNTLIDCHCKHGRHLVAQEMFEAMERRGCFP  512

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++Y   +  +   +     K  G   +      +V V+ K  + ++ +K L
Sbjct  513  CATTYNIMINSYGDQERWDDMKRLLAKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIKCL  572

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            +++K+   K    +Y + +NA    GL  +A
Sbjct  573  EEMKSVGLKPSSTMYNALINAYAQRGLSEQA  603


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 77/176 (44%), Gaps = 0/176 (0%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            + + G  S+A       +  G         S+++    +GR  EA  L  +++  G +P 
Sbjct  279  FAKSGDPSRALQLLGMAQATGLSAKTATLVSIISALANSGRTLEAEALFEELRRSGIKPR  338

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               YN LL  + +   +K  E +  EM++R V PD  +Y+ +I AY  A   ES     +
Sbjct  339  TKAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLK  398

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            + +    + +  +   ++  +    +  +  ++L+++K+   K D + Y   ++  
Sbjct  399  EMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTF  454



>ref|XP_010505013.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like 
[Camelina sativa]
Length=590

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 111/211 (53%), Gaps = 0/211 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++ ++ S  C+P  +TY ++LN + R G+  KAE  F ++++ G +  +  Y++++  Y 
Sbjct  285  LFCEMRSHQCKPNIITYTALLNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMEAYS  344

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G    A  + + M+  GCEP+   YN ++D +GRA      E V++ MKR  + P   
Sbjct  345  RAGYPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEAMKRLGIAPTMK  404

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            S+  ++SAYS+A+++  C    ++   NG + D  +   M+ ++ ++ +  ++ K+L ++
Sbjct  405  SHMLLLSAYSRARDVTKCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEM  464

Query  569  KTDETKLDERLYRSALNALRDAGLEIRAKWL  661
            +      D   Y   +N    AG   R + L
Sbjct  465  ENGPCTADISTYNILINIYGKAGFLERVEEL  495


 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 112/221 (51%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS----------------  142
            P  AA ++  +   GCEP + +Y  +++ Y R G++S AE  F                 
Sbjct  349  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEAMKRLGIAPTMKSHML  408

Query  143  -------------------EMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                               EM + G +      +SM+N+YG+ G+  +  +++A+M+   
Sbjct  409  LLSAYSRARDVTKCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEMENGP  468

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C  ++  YN L++I+G+A  +++VE+++ E+K++   PD V++TS I AYS+ K    C+
Sbjct  469  CTADISTYNILINIYGKAGFLERVEELFSELKKKNFRPDVVTWTSRIGAYSRKKLYVKCL  528

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++   +G   D   A +++   S  ++V+++  +L+ +
Sbjct  529  EVFEEMIDSGCAPDGGTAKVLLSSCSSEDQVEQVTSVLRTM  569


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/201 (25%), Positives = 91/201 (45%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  317  AEEIFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEIFSLMQHMGCEPDRASYNIMVD  376

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H +A  +   MK  G  P +  +  LL  + RA ++ + E + KEM    V P
Sbjct  377  AYGRAGLHSDAEAVFEAMKRLGIAPTMKSHMLLLSAYSRARDVTKCEAIVKEMSENGVEP  436

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +     K   + +      D +   I++ ++ K   ++ + +L 
Sbjct  437  DTFVLNSMLNLYGRLGQFTKMEKILAEMENGPCTADISTYNILINIYGKAGFLERVEELF  496

Query  560  QDLKTDETKLDERLYRSALNA  622
             +LK    + D   + S + A
Sbjct  497  SELKKKNFRPDVVTWTSRIGA  517


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/221 (24%), Positives = 109/221 (49%), Gaps = 7/221 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A ++Y +L+   C P + TYA ++  YC  G+  KAE    EM+          Y++ + 
Sbjct  176  AESLYVQLLESRCVPTEDTYALLVKAYCMAGLTEKAEAVLIEMQNHHVSPSTTVYNAYIE  235

Query  200  MYGKT-GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
               K+ G  +EA  +  +MK   C+P    YN +++++G+AS      K++ EM+  +  
Sbjct  236  GLIKSKGNTEEAINVFQRMKRDPCKPTTETYNLMINLYGKASKSFMSWKLFCEMRSHQCK  295

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDEL  547
            P+ ++YT++++A+++    E   + ++  + +G + D  +   ++  +S+        E+
Sbjct  296  PNIITYTALLNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEI  355

Query  548  VKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  670
              L+Q +  +    D   Y   ++A   AGL   A+ + E+
Sbjct  356  FSLMQHMGCEP---DRASYNIMVDAYGRAGLHSDAEAVFEA  393


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 80/177 (45%), Gaps = 1/177 (1%)
 Frame = +2

Query  146  MEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASN  325
            + +  F   ++ ++ +++ YG+  R+KEA  L  ++ E  C P    Y  L+  +  A  
Sbjct  148  LRRSSFQPDVICFNLLIDAYGQKFRYKEAESLYVQLLESRCVPTEDTYALLVKAYCMAGL  207

Query  326  MKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAK-ELESCVKYYQDFKLNGGKTDRAMAG  502
             ++ E V  EM+   V P    Y + I    K+K   E  +  +Q  K +  K       
Sbjct  208  TEKAEAVLIEMQNHHVSPSTTVYNAYIEGLIKSKGNTEEAINVFQRMKRDPCKPTTETYN  267

Query  503  IMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            +M+ ++ K +K     KL  ++++ + K +   Y + LNA    GL  +A+ + E  
Sbjct  268  LMINLYGKASKSFMSWKLFCEMRSHQCKPNIITYTALLNAFAREGLCEKAEEIFEQL  324



>ref|XP_009353967.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X2 [Pyrus x bretschneideri]
Length=596

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/226 (26%), Positives = 120/226 (53%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +R   +A  +++++ SQ C P   TY +++N + R G+  KAE  F +M++ G++  + A
Sbjct  293  ERKSFMALKLFQEMKSQKCRPNICTYTALVNAFARDGLCEKAEEIFEQMQEAGYEPDVYA  352

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y++++  Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  +  ++EMK
Sbjct  353  YNALMEAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAAFEEMK  412

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R  + P   S+  ++SAYSKA  +  C       + +G + D  +   M+ ++ ++ +++
Sbjct  413  RLGITPTVKSHMLLLSAYSKAGNVSKCEDIVNQMQESGLELDTFVINSMLNLYGRLGQLE  472

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  679
            ++ ++L  ++T     D   Y   +N    AG   + + L +S  +
Sbjct  473  KMEEVLTAMETGPYVADISTYNILINIYGRAGFFDKMEELFQSLPL  518


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 105/215 (49%), Gaps = 6/215 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y +L+   C P + TYA +L  YC+ G++ KAE  F EM + G     +   + +N
Sbjct  194  AESTYLELLEARCVPTEDTYALLLKAYCKSGLFDKAEAIFVEMRKYGLPPSAIVLDAYIN  253

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G  ++A  +  +MK   C+P+   Y  L++++GR        K+++EMK +K  P
Sbjct  254  GLLKGGNPQKAVEIFQRMKRDQCQPSTETYTMLINLYGRERKSFMALKLFQEMKSQKCRP  313

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  +YT++++A+++    E   + ++  +  G + D      ++  +S+        E+ 
Sbjct  314  NICTYTALVNAFARDGLCEKAEEIFEQMQEAGYEPDVYAYNALMEAYSRAGFPYGAAEIF  373

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L+Q +  +    D   Y   ++A   AGL   A+
Sbjct  374  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQ  405


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 98/203 (48%), Gaps = 0/203 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P+ A  +++++    C+P   TY  ++N+Y R      A   F EM+ +     I  Y++
Sbjct  261  PQKAVEIFQRMKRDQCQPSTETYTMLINLYGRERKSFMALKLFQEMKSQKCRPNICTYTA  320

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +VN + + G  ++A  +  +M+E G EP+V+ YN L++ + RA       +++  M+   
Sbjct  321  LVNAFARDGLCEKAEEIFEQMQEAGYEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMG  380

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
              PDR SY  ++ AY +A   E     +++ K  G         +++  +SK   V +  
Sbjct  381  CEPDRASYNIMVDAYGRAGLHEDAQAAFEEMKRLGITPTVKSHMLLLSAYSKAGNVSKCE  440

Query  551  KLLQDLKTDETKLDERLYRSALN  619
             ++  ++    +LD  +  S LN
Sbjct  441  DIVNQMQESGLELDTFVINSMLN  463


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 90/172 (52%), Gaps = 0/172 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G    + ++  
Sbjct  366  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAAFEEMKRLGITPTVKSHML  425

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +++ Y K G   +   +V +M+E G E + ++ N++L+++GR   ++++E+V   M+   
Sbjct  426  LLSAYSKAGNVSKCEDIVNQMQESGLELDTFVINSMLNLYGRLGQLEKMEEVLTAMETGP  485

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSK  526
             V D  +Y  +I+ Y +A   +   + +Q   L   K D       +G +S+
Sbjct  486  YVADISTYNILINIYGRAGFFDKMEELFQSLPLKNLKPDVVTWTSRLGAYSR  537


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/163 (20%), Positives = 76/163 (47%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  QKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK  331
            +  F   ++ Y+ +++ YG+  +HK+A     ++ E  C P    Y  LL  + ++    
Sbjct  168  KSSFKPDVICYNLLIDAYGQKSQHKDAESTYLELLEARCVPTEDTYALLLKAYCKSGLFD  227

Query  332  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            + E ++ EM++  + P  +   + I+   K    +  V+ +Q  K +  +       +++
Sbjct  228  KAEAIFVEMRKYGLPPSAIVLDAYINGLLKGGNPQKAVEIFQRMKRDQCQPSTETYTMLI  287

Query  512  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             ++ +  K    +KL Q++K+ + + +   Y + +NA    GL
Sbjct  288  NLYGRERKSFMALKLFQEMKSQKCRPNICTYTALVNAFARDGL  330



>gb|KDO54847.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
Length=487

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 106/207 (51%), Gaps = 6/207 (3%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G  P  VTY +++N YCR G   +A    + M  KG    +  Y+S++N   K GR   
Sbjct  24   KGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDR  83

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  ++ +M + G  P+   YNTLL    R  NM + E+++ EM RR V PD VS++++I 
Sbjct  84   AKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIG  143

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             +S+  +L+  + Y+++ K  G   D  +  I++  + +   V E +K+  ++      +
Sbjct  144  IFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVM  203

Query  590  DERLYRSALNALRDAGLEIRAKWLQES  670
            D   Y + LN L       RAK L E+
Sbjct  204  DVVTYNTILNGL------CRAKMLTEA  224


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 105/217 (48%), Gaps = 6/217 (3%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            ++++ +GC    VTY +ILN  CR  + ++A+  F+EM ++G       ++++++ + K 
Sbjct  194  DEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKD  253

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
            G   +A  L   M ++  +P++  YNTL+D   +   M++  K+W +M  RK+ P+ +SY
Sbjct  254  GNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISY  313

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
              +I+ Y     +    + + +    G K        ++  + +     +  + L  + +
Sbjct  314  GILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVS  373

Query  575  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  685
            +    D   Y + +N        +R + + ++FA+ +
Sbjct  374  EGVDPDSISYNTLINGF------VREENMDKAFALVS  404


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 93/183 (51%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++  +G  P  V++++++ I+ R G   +A M F EM+  G     V Y+ ++N
Sbjct  119  AEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIIN  178

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y + G   EA ++  +M E+GC  +V  YNT+L+   RA  + + + ++ EM  R V P
Sbjct  179  GYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFP  238

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T++I  + K   +   +  +        K D      ++  F K+ ++++  KL 
Sbjct  239  DFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLW  298

Query  560  QDL  568
             D+
Sbjct  299  ADM  301


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 83/159 (52%), Gaps = 0/159 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++V +G +P  V+  +I+  YCR G  SKA+   S+M  +G D   ++Y++++N
Sbjct  329  AFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLIN  388

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + +     +A  LV+KM+ +G  P+V  YN +L    R   M   E +   M  + + P
Sbjct  389  GFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNP  448

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM  496
            DR +YT++I+ +     L+   +++ +    G   D A 
Sbjct  449  DRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  487


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 74/134 (55%), Gaps = 0/134 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  ++S+   P  ++Y  ++N YC +G  ++A   + EM  KG    +V+ ++++ 
Sbjct  294  ANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIK  353

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y ++G   +A   ++KM   G +P+   YNTL++   R  NM +   +  +M+ + +VP
Sbjct  354  GYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVP  413

Query  380  DRVSYTSVISAYSK  421
            D ++Y  +++ + +
Sbjct  414  DVITYNVILTGFCR  427


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/202 (21%), Positives = 90/202 (45%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +++ +G  P   T+ ++++ +C+ G  +KA   F  M QK     IV Y+++++
Sbjct  224  ADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLID  283

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A +L A M  R   PN   Y  L++ +    ++ +  ++W EM  + + P
Sbjct  284  GFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKP  343

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              VS  ++I  Y ++ +     ++       G   D      ++  F +   +D+   L+
Sbjct  344  TLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALV  403

Query  560  QDLKTDETKLDERLYRSALNAL  625
              ++      D   Y   L   
Sbjct  404  SKMENQGLVPDVITYNVILTGF  425



>ref|XP_009379098.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Pyrus x bretschneideri]
Length=709

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 118/213 (55%), Gaps = 7/213 (3%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC---IVA  181
            P  A   +EK+ S GC P  VTY+++++ Y R G   K EM FS  ++   +K     V 
Sbjct  235  PDKAVEWFEKMPSFGCNPDDVTYSAMIDAYGRAG---KVEMAFSLYDRARTEKWRIDPVT  291

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            +S+++ ++G++G       +  +MK  G +PN+ IYNTLLD  GRA    Q +K+++EM 
Sbjct  292  FSTLIKIHGQSGNFDGCLNVYEEMKAIGAKPNLVIYNTLLDAMGRARRPWQAKKIYREMI  351

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
             R++ P+ V+Y S++ AY +A+  +  +  Y++ K  G + +  +   ++ + + +   D
Sbjct  352  SRELSPNWVTYASLLRAYGRARYSDDALNVYKEMKEKGLELNVILYNTLLAMCADVGYTD  411

Query  542  ELVKLLQDLKTDET-KLDERLYRSALNALRDAG  637
            E V + +++K+ ET K D   + S +     +G
Sbjct  412  EAVGIFEEMKSSETLKPDSWTFSSMITVYSCSG  444


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 95/196 (48%), Gaps = 2/196 (1%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            R P  A  +Y +++S+   P  VTYAS+L  Y R      A   + EM++KG +  ++ Y
Sbjct  338  RRPWQAKKIYREMISRELSPNWVTYASLLRAYGRARYSDDALNVYKEMKEKGLELNVILY  397

Query  185  SSMVNMYGKTGRHKEATRLVAKMK-ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            ++++ M    G   EA  +  +MK     +P+ W +++++ ++  +  + + E    EM 
Sbjct  398  NTLLAMCADVGYTDEAVGIFEEMKSSETLKPDSWTFSSMITVYSCSGKVTEAEATLNEML  457

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
              +  P+    TS+I  Y KAK  +  V+ +      G   D    G ++ V ++  K +
Sbjct  458  EARFEPNIFILTSLIQCYGKAKRTDDVVRIFNQLLDLGITPDERFCGCLLNVMTQTPK-E  516

Query  542  ELVKLLQDLKTDETKL  589
            EL KL   ++  + KL
Sbjct  517  ELCKLANCIERADEKL  532


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 81/175 (46%), Gaps = 1/175 (1%)
 Frame = +2

Query  101  CRIGV-YSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            CR G    +AE  F ++ Q+G     V +S+M++         +A     KM   GC P+
Sbjct  194  CRKGKDLDRAEKLFDQLLQRGVKPDNVTFSTMISCARMCSLPDKAVEWFEKMPSFGCNPD  253

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               Y+ ++D +GRA  ++    ++   +  K   D V+++++I  + ++   + C+  Y+
Sbjct  254  DVTYSAMIDAYGRAGKVEMAFSLYDRARTEKWRIDPVTFSTLIKIHGQSGNFDGCLNVYE  313

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  622
            + K  G K +  +   ++    +  +  +  K+ +++ + E   +   Y S L A
Sbjct  314  EMKAIGAKPNLVIYNTLLDAMGRARRPWQAKKIYREMISRELSPNWVTYASLLRA  368



>gb|AHC02079.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
peruviana]
Length=388

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ S G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  72   REARSLISEMRSAGVMPNTASYSTLLTMYVENKXFLEALSVFSEMREI---KCLLDLTTC  128

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  129  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  188

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  189  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  248

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  249  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  287


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  109  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  168

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  169  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  228

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  229  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  288

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  289  HELKSPD------------NIPRDTAIHILA  307


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  196  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  255

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  256  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  311

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  312  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  371

Query  611  ALNA  622
             LNA
Sbjct  372  VLNA  375


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/168 (21%), Positives = 79/168 (47%), Gaps = 0/168 (0%)
 Frame = +2

Query  137  FSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGR  316
              +MEQ      +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+
Sbjct  8    LQKMEQDRVPGDLVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGK  67

Query  317  ASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM  496
            A   ++   +  EM+   V+P+  SY+++++ Y + K     +  + + +      D   
Sbjct  68   AKLFREARSLISEMRSAGVMPNTASYSTLLTMYVENKXFLEALSVFSEMREIKCLLDLTT  127

Query  497  AGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
              IM+ V+ ++    E  KL   ++    + +   Y + L    DA L
Sbjct  128  CNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  175


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 72/170 (42%), Gaps = 31/170 (18%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  214  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  273

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  274  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  333

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +
Sbjct  334  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFD  383



>ref|XP_009353966.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X1 [Pyrus x bretschneideri]
Length=606

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/226 (26%), Positives = 120/226 (53%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +R   +A  +++++ SQ C P   TY +++N + R G+  KAE  F +M++ G++  + A
Sbjct  303  ERKSFMALKLFQEMKSQKCRPNICTYTALVNAFARDGLCEKAEEIFEQMQEAGYEPDVYA  362

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y++++  Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  +  ++EMK
Sbjct  363  YNALMEAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAAFEEMK  422

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R  + P   S+  ++SAYSKA  +  C       + +G + D  +   M+ ++ ++ +++
Sbjct  423  RLGITPTVKSHMLLLSAYSKAGNVSKCEDIVNQMQESGLELDTFVINSMLNLYGRLGQLE  482

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  679
            ++ ++L  ++T     D   Y   +N    AG   + + L +S  +
Sbjct  483  KMEEVLTAMETGPYVADISTYNILINIYGRAGFFDKMEELFQSLPL  528


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 105/215 (49%), Gaps = 6/215 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y +L+   C P + TYA +L  YC+ G++ KAE  F EM + G     +   + +N
Sbjct  204  AESTYLELLEARCVPTEDTYALLLKAYCKSGLFDKAEAIFVEMRKYGLPPSAIVLDAYIN  263

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G  ++A  +  +MK   C+P+   Y  L++++GR        K+++EMK +K  P
Sbjct  264  GLLKGGNPQKAVEIFQRMKRDQCQPSTETYTMLINLYGRERKSFMALKLFQEMKSQKCRP  323

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  +YT++++A+++    E   + ++  +  G + D      ++  +S+        E+ 
Sbjct  324  NICTYTALVNAFARDGLCEKAEEIFEQMQEAGYEPDVYAYNALMEAYSRAGFPYGAAEIF  383

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L+Q +  +    D   Y   ++A   AGL   A+
Sbjct  384  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQ  415


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 98/203 (48%), Gaps = 0/203 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P+ A  +++++    C+P   TY  ++N+Y R      A   F EM+ +     I  Y++
Sbjct  271  PQKAVEIFQRMKRDQCQPSTETYTMLINLYGRERKSFMALKLFQEMKSQKCRPNICTYTA  330

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +VN + + G  ++A  +  +M+E G EP+V+ YN L++ + RA       +++  M+   
Sbjct  331  LVNAFARDGLCEKAEEIFEQMQEAGYEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMG  390

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
              PDR SY  ++ AY +A   E     +++ K  G         +++  +SK   V +  
Sbjct  391  CEPDRASYNIMVDAYGRAGLHEDAQAAFEEMKRLGITPTVKSHMLLLSAYSKAGNVSKCE  450

Query  551  KLLQDLKTDETKLDERLYRSALN  619
             ++  ++    +LD  +  S LN
Sbjct  451  DIVNQMQESGLELDTFVINSMLN  473


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 96/186 (52%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G    + ++  
Sbjct  376  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAAFEEMKRLGITPTVKSHML  435

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +++ Y K G   +   +V +M+E G E + ++ N++L+++GR   ++++E+V   M+   
Sbjct  436  LLSAYSKAGNVSKCEDIVNQMQESGLELDTFVINSMLNLYGRLGQLEKMEEVLTAMETGP  495

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
             V D  +Y  +I+ Y +A   +   + +Q   L   K D       +G +S+       +
Sbjct  496  YVADISTYNILINIYGRAGFFDKMEELFQSLPLKNLKPDVVTWTSRLGAYSRKKLYTRCL  555

Query  551  KLLQDL  568
            ++ +++
Sbjct  556  EIFEEM  561


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/163 (20%), Positives = 76/163 (47%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  QKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK  331
            +  F   ++ Y+ +++ YG+  +HK+A     ++ E  C P    Y  LL  + ++    
Sbjct  178  KSSFKPDVICYNLLIDAYGQKSQHKDAESTYLELLEARCVPTEDTYALLLKAYCKSGLFD  237

Query  332  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            + E ++ EM++  + P  +   + I+   K    +  V+ +Q  K +  +       +++
Sbjct  238  KAEAIFVEMRKYGLPPSAIVLDAYINGLLKGGNPQKAVEIFQRMKRDQCQPSTETYTMLI  297

Query  512  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             ++ +  K    +KL Q++K+ + + +   Y + +NA    GL
Sbjct  298  NLYGRERKSFMALKLFQEMKSQKCRPNICTYTALVNAFARDGL  340



>ref|XP_010936410.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Elaeis guineensis]
Length=719

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 117/219 (53%), Gaps = 2/219 (1%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A   +EK+    C P  VTY+++++ Y R G   KA   +    Q+ +    V +++
Sbjct  244  PEKAVEWFEKMPEFACSPDYVTYSAMIDAYGRSGNIEKALGLYDRARQEKWRLDPVTFAT  303

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++ +Y  +G    A  +  +MK  G +PNV IYNTLLD  GRA    QV+ ++KEM ++ 
Sbjct  304  VIRVYSHSGNFDGALNVYEEMKALGVKPNVVIYNTLLDAMGRAGRPWQVKTIFKEMDKKG  363

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            VVP+R +Y +++ +Y KA+  E  +  Y+  K  G + +  +  +++ + + +  VDE  
Sbjct  364  VVPNRATYAALLRSYCKARYAEDALSVYRQMKEKGMEMNVILYNMLMSMCADIGCVDEAA  423

Query  551  KLLQDLK--TDETKLDERLYRSALNALRDAGLEIRAKWL  661
            ++  ++K   D+ K D   Y + + A   +G  + A+ L
Sbjct  424  EIFAEMKGLPDDCKPDSWSYSALITAYSCSGKVLEAEGL  462


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/195 (24%), Positives = 95/195 (49%), Gaps = 3/195 (2%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P    T+++++  +G  P + TYA++L  YC+      A   + +M++KG +  ++ Y+ 
Sbjct  349  PWQVKTIFKEMDKKGVVPNRATYAALLRSYCKARYAEDALSVYRQMKEKGMEMNVILYNM  408

Query  191  MVNMYGKTGRHKEATRLVAKMK--ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            +++M    G   EA  + A+MK     C+P+ W Y+ L+  +  +  + + E +  EM  
Sbjct  409  LMSMCADIGCVDEAAEIFAEMKGLPDDCKPDSWSYSALITAYSCSGKVLEAEGLLNEMLE  468

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
                P+    TS+I  Y KA++ +  V+ +          D    G ++ V ++  + +E
Sbjct  469  AGYQPNIFVLTSIIQCYGKARQTDDVVRSFDKLLELRITPDDRFCGCLLNVLTQ-TQTEE  527

Query  545  LVKLLQDLKTDETKL  589
            L K++  ++    KL
Sbjct  528  LGKVINCIERANVKL  542


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 62/124 (50%), Gaps = 0/124 (0%)
 Frame = +2

Query  116  YSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNT  295
            +   E  + EM ++G     V +S++++  G     ++A     KM E  C P+   Y+ 
Sbjct  209  WDGVEALWKEMLERGVKPDNVTFSTIISCAGFCNLPEKAVEWFEKMPEFACSPDYVTYSA  268

Query  296  LLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNG  475
            ++D +GR+ N+++   ++   ++ K   D V++ +VI  YS +   +  +  Y++ K  G
Sbjct  269  MIDAYGRSGNIEKALGLYDRARQEKWRLDPVTFATVIRVYSHSGNFDGALNVYEEMKALG  328

Query  476  GKTD  487
             K +
Sbjct  329  VKPN  332



>ref|XP_008370969.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Malus domestica]
Length=709

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 110/194 (57%), Gaps = 6/194 (3%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC---IVA  181
            P  A   +EK+ S GC P  VTY+++++ Y R G   K EM FS  ++   +K     V 
Sbjct  235  PDKAVEWFEKMPSFGCNPDDVTYSAMIDAYGRAG---KVEMAFSLYDRARTEKWRIDPVT  291

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            +S+++ ++G++G       +  +MK  G +PN+ IYNTLLD  GRA    Q +K+++EM 
Sbjct  292  FSTLIKIHGQSGNFDGCLNVYEEMKAIGAKPNLVIYNTLLDAMGRARRPWQAKKIYREMI  351

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
             R++ P+ V+Y S++ AY +A+  +  +  Y+  K  G + +  +   ++ + + +   D
Sbjct  352  SRELSPNWVTYASLLRAYGRARYSDDALNVYKVMKEKGLELNVILYNTLLAMCADVGNTD  411

Query  542  ELVKLLQDLKTDET  583
            E V + +++K+ ET
Sbjct  412  EAVDIFEEMKSSET  425


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 93/196 (47%), Gaps = 2/196 (1%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            R P  A  +Y +++S+   P  VTYAS+L  Y R      A   +  M++KG +  ++ Y
Sbjct  338  RRPWQAKKIYREMISRELSPNWVTYASLLRAYGRARYSDDALNVYKVMKEKGLELNVILY  397

Query  185  SSMVNMYGKTGRHKEATRLVAKMK-ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            ++++ M    G   EA  +  +MK     +P+ W +++++ I+  +  + + E    EM 
Sbjct  398  NTLLAMCADVGNTDEAVDIFEEMKSSETLKPDSWTFSSMITIYSCSGKVTEAEATLNEML  457

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
                 P+    TS+I  Y KAK  +  V+ +      G   D    G ++ V ++  K +
Sbjct  458  EAGFEPNIFILTSLIQCYGKAKRTDDVVRIFNQLLDLGITPDERFCGCLLNVMTQTPK-E  516

Query  542  ELVKLLQDLKTDETKL  589
            EL KL   ++  + KL
Sbjct  517  ELCKLANCIERADEKL  532


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 81/175 (46%), Gaps = 1/175 (1%)
 Frame = +2

Query  101  CRIGV-YSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            CR G    +AE  F ++ Q+G     V +S+M++         +A     KM   GC P+
Sbjct  194  CRKGKDLDRAEKLFDQLLQRGVKPDNVTFSTMISCARMCSLPDKAVEWFEKMPSFGCNPD  253

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               Y+ ++D +GRA  ++    ++   +  K   D V+++++I  + ++   + C+  Y+
Sbjct  254  DVTYSAMIDAYGRAGKVEMAFSLYDRARTEKWRIDPVTFSTLIKIHGQSGNFDGCLNVYE  313

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  622
            + K  G K +  +   ++    +  +  +  K+ +++ + E   +   Y S L A
Sbjct  314  EMKAIGAKPNLVIYNTLLDAMGRARRPWQAKKIYREMISRELSPNWVTYASLLRA  368



>ref|XP_006446275.1| hypothetical protein CICLE_v10017597mg [Citrus clementina]
 gb|ESR59515.1| hypothetical protein CICLE_v10017597mg [Citrus clementina]
Length=732

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 106/207 (51%), Gaps = 6/207 (3%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G  P  VTY +++N YCR G   +A    + M  KG    +  Y+S++N   K GR   
Sbjct  269  KGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDR  328

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  ++ +M + G  P+   YNTLL    R  NM + E+++ EM RR V PD VS++++I 
Sbjct  329  AKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIG  388

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             +S+  +L+  + Y+++ K  G   D  +  I++  + +   V E +K+  ++      +
Sbjct  389  IFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVM  448

Query  590  DERLYRSALNALRDAGLEIRAKWLQES  670
            D   Y S LN L       RAK L E+
Sbjct  449  DVVTYNSILNGL------CRAKMLTEA  469


 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/222 (22%), Positives = 107/222 (48%), Gaps = 6/222 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + ++++ +GC    VTY SILN  CR  + ++A+  F+EM ++G       ++++++
Sbjct  434  ALKMRDEMLEKGCVMDVVTYNSILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIH  493

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G   +A  L   M ++  +P++  YNTL+D   +   M++  K+W +M  RK+ P
Sbjct  494  GHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISP  553

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + +SY  +I+ Y     +    + + +    G K        ++  + +     +  + L
Sbjct  554  NYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFL  613

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  685
              + ++    D   Y + +N        +R + + ++FA+ +
Sbjct  614  SKMVSEGVDPDSISYNTLINGF------VREENMDKAFALVS  649


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 85/159 (53%), Gaps = 0/159 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++V +G +P  V+  +I+  YCR G  SKA+   S+M  +G D   ++Y++++N
Sbjct  574  AFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLIN  633

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + +     +A  LV+KM+ +G  P+V  YN +L    R   M   E + + M  +++ P
Sbjct  634  GFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILRRMIEKRLNP  693

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM  496
            DR +YT++I+ +     L+   +++ +    G   D A 
Sbjct  694  DRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  732


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 93/183 (51%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++  +G  P  V++++++ I+ R G   +A M F EM+  G     V Y+ ++N
Sbjct  364  AEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIIN  423

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y + G   EA ++  +M E+GC  +V  YN++L+   RA  + + + ++ EM  R V P
Sbjct  424  GYCRNGFVLEALKMRDEMLEKGCVMDVVTYNSILNGLCRAKMLTEADDLFNEMLERGVFP  483

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T++I  + K   +   +  +        K D      ++  F K+ ++++  KL 
Sbjct  484  DFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLW  543

Query  560  QDL  568
             D+
Sbjct  544  ADM  546


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 87/185 (47%), Gaps = 0/185 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +++ +G  P   T+ ++++ +C+ G  +KA   F  M QK     IV Y+++++
Sbjct  469  ADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLID  528

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A +L A M  R   PN   Y  L++ +    ++ +  ++W EM  + + P
Sbjct  529  GFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKP  588

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              VS  ++I  Y ++ +     ++       G   D      ++  F +   +D+   L+
Sbjct  589  TLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALV  648

Query  560  QDLKT  574
              ++ 
Sbjct  649  SKMEN  653


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/201 (19%), Positives = 94/201 (47%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++ +  +  +P  VTY ++++ +C++G   KA   +++M  +      ++Y  ++N
Sbjct  504  ALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILIN  563

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G   EA RL  +M  +G +P +   NT++  + R+ +  + ++   +M    V P
Sbjct  564  GYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDP  623

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +SY ++I+ + + + ++         +  G   D     +++  F +  ++ +   +L
Sbjct  624  DSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELIL  683

Query  560  QDLKTDETKLDERLYRSALNA  622
            + +       D   Y + +N 
Sbjct  684  RRMIEKRLNPDRSTYTTLING  704



>ref|XP_006365038.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like 
[Solanum tuberosum]
Length=576

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 109/208 (52%), Gaps = 0/208 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  ++ ++ +Q C+P   TY +++N + R G+  KAE  F E+++ G +  +  Y++++
Sbjct  278  MALKMFNEMKTQKCKPNICTYTALVNAFARSGLCEKAEEVFEELQEAGLEPDVYTYNALM  337

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G  + A  + + M+  GCEP+   YN ++D +GRA   +  + V+ EM R  + 
Sbjct  338  EAYSRAGYPQGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMTRLGIA  397

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   SY  +ISAYS+   +  C +     +++G K D  +   M+ ++ ++ +  ++ +L
Sbjct  398  PTMKSYMLLISAYSRNSNVSKCEEIVNQMQISGVKLDTFLLNSMLNLYGRLGQFAKMEEL  457

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L  ++      D   Y   +NA   +G 
Sbjct  458  LTVIEAGPYIADISTYNILINAYGRSGF  485


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 102/205 (50%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            R  + A  +++++  + C+P   TY  ++N+Y +      A   F+EM+ +     I  Y
Sbjct  239  RNSQKALAIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKMFNEMKTQKCKPNICTY  298

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            +++VN + ++G  ++A  +  +++E G EP+V+ YN L++ + RA   +   +++  M+ 
Sbjct  299  TALVNAFARSGLCEKAEEVFEELQEAGLEPDVYTYNALMEAYSRAGYPQGAAEIFSLMQH  358

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
                PDR SY  ++ AY +A   E     + +    G         +++  +S+ + V +
Sbjct  359  MGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMTRLGIAPTMKSYMLLISAYSRNSNVSK  418

Query  545  LVKLLQDLKTDETKLDERLYRSALN  619
              +++  ++    KLD  L  S LN
Sbjct  419  CEEIVNQMQISGVKLDTFLLNSMLN  443


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 93/204 (46%), Gaps = 35/204 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS---  190
            A + Y  LV   C P + TYA +L  Y + G+  KAE  FSEM + G     + Y++   
Sbjct  174  AESTYLALVDARCVPTEDTYAILLKSYSKCGMIEKAEAVFSEMRKNGLPPSALVYNAYID  233

Query  191  --------------------------------MVNMYGKTGRHKEATRLVAKMKERGCEP  274
                                            ++N+YGK  +   A ++  +MK + C+P
Sbjct  234  GLMKGRNSQKALAIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKMFNEMKTQKCKP  293

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
            N+  Y  L++   R+   ++ E+V++E++   + PD  +Y +++ AYS+A   +   + +
Sbjct  294  NICTYTALVNAFARSGLCEKAEEVFEELQEAGLEPDVYTYNALMEAYSRAGYPQGAAEIF  353

Query  455  QDFKLNGGKTDRAMAGIMVGVFSK  526
               +  G + DRA   IMV  + +
Sbjct  354  SLMQHMGCEPDRASYNIMVDAYGR  377


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 108/221 (49%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P+ AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM + G          
Sbjct  346  PQGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQTVFDEMTRLGIAPTMKSYML  405

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             I AYS                            SM+N+YG+ G+  +   L+  ++   
Sbjct  406  LISAYSRNSNVSKCEEIVNQMQISGVKLDTFLLNSMLNLYGRLGQFAKMEELLTVIEAGP  465

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
               ++  YN L++ +GR+  + ++E+V++ +  + + PD V++TS + AYSK K+ + C+
Sbjct  466  YIADISTYNILINAYGRSGFIMKMEEVFQSLPAKNLKPDVVTWTSRLGAYSKKKQYQRCL  525

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++    G   D   A +++   S  ++++++  +++ +
Sbjct  526  EIFEEMIDEGCYPDGGTAKVLLSSCSSEDQIEQVTTVIRSM  566


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/197 (18%), Positives = 85/197 (43%), Gaps = 4/197 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEME----QKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P   T+  ++N+  +  +  + ++     E    +  F   ++ Y+ ++  YG+    K+
Sbjct  114  PNNHTWDDLINVAVQFRLNKQWDLIILMCEWILCRSSFQADVICYNLLIEAYGQCSLVKK  173

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A      + +  C P    Y  LL  + +   +++ E V+ EM++  + P  + Y + I 
Sbjct  174  AESTYLALVDARCVPTEDTYAILLKSYSKCGMIEKAEAVFSEMRKNGLPPSALVYNAYID  233

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K +  +  +  +   K    +       +++ ++ K NK    +K+  ++KT + K 
Sbjct  234  GLMKGRNSQKALAIFDRMKRESCQPSTDTYTMLINLYGKENKSYMALKMFNEMKTQKCKP  293

Query  590  DERLYRSALNALRDAGL  640
            +   Y + +NA   +GL
Sbjct  294  NICTYTALVNAFARSGL  310



>ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial-like [Populus euphratica]
Length=701

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 105/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +++++S+G EP  VT+ ++++ +CR G + +AE  F EM + G+  C   ++ M+N
Sbjct  456  AMATFDRMLSEGIEPDTVTWNTLIDCHCRAGKHDRAEELFEEMMEGGYSPCNTTFNIMIN  515

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +G   R  +   L+A M+ +G  PN   Y TL+DI+G++       +   +MK   + P
Sbjct  516  SFGDQERWDDVKNLLANMRSQGLVPNSVTYTTLIDIYGKSGRFNDAIECLDDMKAAGLKP  575

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++  +++G K        ++  F +  +  E   +L
Sbjct  576  SSTMYNALINAYAQRGLSEQAVSAFRAMRVDGLKPSHLALNSLINAFGEDRRDAEAFTVL  635

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K ++ K D   Y + + AL
Sbjct  636  QYMKENDLKPDVVTYTTLMKAL  657


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/206 (22%), Positives = 93/206 (45%), Gaps = 4/206 (2%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V  ++ + G  P +V Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  424  VLREMENSGVRPDRVFYNVMIDTFGKFNCLDHAMATFDRMLSEGIEPDTVTWNTLIDCHC  483

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G+H  A  L  +M E G  P    +N +++  G       V+ +   M+ + +VP+ V
Sbjct  484  RAGKHDRAEELFEEMMEGGYSPCNTTFNIMINSFGDQERWDDVKNLLANMRSQGLVPNSV  543

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT++I  Y K+      ++   D K  G K    M   ++  +++    ++ V   + +
Sbjct  544  TYTTLIDIYGKSGRFNDAIECLDDMKAAGLKPSSTMYNALINAYAQRGLSEQAVSAFRAM  603

Query  569  KTDETKLDERLYRSALNAL----RDA  634
            + D  K       S +NA     RDA
Sbjct  604  RVDGLKPSHLALNSLINAFGEDRRDA  629


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 88/182 (48%), Gaps = 0/182 (0%)
 Frame = +2

Query  122  KAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLL  301
            +AE  F EM   G      AY++++  Y K G  K+A  +V++M+  G  PN   Y+ L+
Sbjct  315  EAEAIFEEMRDNGLKPRTRAYNALLRGYVKAGLLKDAEFVVSEMERSGVSPNEQTYSFLI  374

Query  302  DIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGK  481
            D +G A   +    V KEM+   V P+   ++ ++S+Y    E +   +  ++ + +G +
Sbjct  375  DAYGNAGRWESARIVLKEMEASNVQPNAYVFSRILSSYRDKGEWQKSFQVLREMENSGVR  434

Query  482  TDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
             DR    +M+  F K N +D  +     + ++  + D   + + ++    AG   RA+ L
Sbjct  435  PDRVFYNVMIDTFGKFNCLDHAMATFDRMLSEGIEPDTVTWNTLIDCHCRAGKHDRAEEL  494

Query  662  QE  667
             E
Sbjct  495  FE  496


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 86/183 (47%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G +P    Y ++L  Y + G+   AE   SEME+ G       YS +++
Sbjct  316  AEAIFEEMRDNGLKPRTRAYNALLRGYVKAGLLKDAEFVVSEMERSGVSPNEQTYSFLID  375

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG  GR + A  ++ +M+    +PN ++++ +L  +      ++  +V +EM+   V P
Sbjct  376  AYGNAGRWESARIVLKEMEASNVQPNAYVFSRILSSYRDKGEWQKSFQVLREMENSGVRP  435

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DRV Y  +I  + K   L+  +  +      G + D      ++    +  K D   +L 
Sbjct  436  DRVFYNVMIDTFGKFNCLDHAMATFDRMLSEGIEPDTVTWNTLIDCHCRAGKHDRAEELF  495

Query  560  QDL  568
            +++
Sbjct  496  EEM  498


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/211 (22%), Positives = 94/211 (45%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ IL+ Y   G + K+     EME  G     V Y+ M++
Sbjct  386  ARIVLKEMEASNVQPNAYVFSRILSSYRDKGEWQKSFQVLREMENSGVRPDRVFYNVMID  445

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H RA    + E++++EM      P
Sbjct  446  TFGKFNCLDHAMATFDRMLSEGIEPDTVTWNTLIDCHCRAGKHDRAEELFEEMMEGGYSP  505

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               ++  +I+++   +  +       + +  G   +      ++ ++ K  + ++ ++ L
Sbjct  506  CNTTFNIMINSFGDQERWDDVKNLLANMRSQGLVPNSVTYTTLIDIYGKSGRFNDAIECL  565

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             D+K    K    +Y + +NA    GL  +A
Sbjct  566  DDMKAAGLKPSSTMYNALINAYAQRGLSEQA  596


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 80/167 (48%), Gaps = 0/167 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            SQG  P  VTY ++++IY + G ++ A     +M+  G       Y++++N Y + G  +
Sbjct  535  SQGLVPNSVTYTTLIDIYGKSGRFNDAIECLDDMKAAGLKPSSTMYNALINAYAQRGLSE  594

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A      M+  G +P+    N+L++  G      +   V + MK   + PD V+YT+++
Sbjct  595  QAVSAFRAMRVDGLKPSHLALNSLINAFGEDRRDAEAFTVLQYMKENDLKPDVVTYTTLM  654

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDEL  547
             A  + ++ +     Y++  L+G   DR    ++      M +  EL
Sbjct  655  KALIRVEKFDKVPSVYEEMILSGCTPDRKARAMLRSALKYMKQTLEL  701


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (49%), Gaps = 0/117 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            + + + G +P    Y +++N Y + G+  +A   F  M   G     +A +S++N +G+ 
Sbjct  566  DDMKAAGLKPSSTMYNALINAYAQRGLSEQAVSAFRAMRVDGLKPSHLALNSLINAFGED  625

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             R  EA  ++  MKE   +P+V  Y TL+    R     +V  V++EM      PDR
Sbjct  626  RRDAEAFTVLQYMKENDLKPDVVTYTTLMKALIRVEKFDKVPSVYEEMILSGCTPDR  682



>ref|XP_004172160.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like, 
partial [Cucumis sativus]
Length=312

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 110/216 (51%), Gaps = 0/216 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
             +A  +++++ +Q C+P   T+ +++N   R G+  KAE  F +M++ G++  + AY+++
Sbjct  13   HMAQNIFDEMRTQRCKPNICTFTALVNALAREGLCEKAEEIFEQMQEAGYEPDVYAYNAL  72

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            +  Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++EMKR  +
Sbjct  73   MESYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEEMKRIGI  132

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
             P   S+  ++SAYS A  +  C         +G K D  +   M+ ++ ++ +  ++  
Sbjct  133  TPTMKSHMLLLSAYSSAGNVAKCEDIIGQMHKSGLKPDTFVMNSMLNLYGRLGQFGKMED  192

Query  554  LLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
            L   ++    + D   Y   +N    AG   R + L
Sbjct  193  LFSTMQKGPCRADISTYNILINVYGRAGFVERMEEL  228


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/224 (23%), Positives = 110/224 (49%), Gaps = 35/224 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P  AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G          
Sbjct  82   PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEEMKRIGITPTMKSHML  141

Query  173  -IVAYSS----------------------------MVNMYGKTGRHKEATRLVAKMKERG  265
             + AYSS                            M+N+YG+ G+  +   L + M++  
Sbjct  142  LLSAYSSAGNVAKCEDIIGQMHKSGLKPDTFVMNSMLNLYGRLGQFGKMEDLFSTMQKGP  201

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C  ++  YN L++++GRA  ++++E++++ +  + + PD V++TS I AYS+ K  + C+
Sbjct  202  CRADISTYNILINVYGRAGFVERMEELFQLLPAKNLEPDVVTWTSRIGAYSRKKLYKRCL  261

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTD  577
            + ++     G   D   A +++   S   +++++  +++ +  D
Sbjct  262  ELFEKMIDAGCYPDGGTAKVLLSACSSEEQIEQVTNVVRTMHKD  305


 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/201 (23%), Positives = 91/201 (45%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  50   AEEIFEQMQEAGYEPDVYAYNALMESYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVD  109

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H++A  +  +MK  G  P +  +  LL  +  A N+ + E +  +M +  + P
Sbjct  110  AYGRAGLHEDAQAVFEEMKRIGITPTMKSHMLLLSAYSSAGNVAKCEDIIGQMHKSGLKP  169

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +       +   +    + D +   I++ V+ +   V+ + +L 
Sbjct  170  DTFVMNSMLNLYGRLGQFGKMEDLFSTMQKGPCRADISTYNILINVYGRAGFVERMEELF  229

Query  560  QDLKTDETKLDERLYRSALNA  622
            Q L     + D   + S + A
Sbjct  230  QLLPAKNLEPDVVTWTSRIGA  250



>gb|AHX42025.1| pentatricopeptide repeat-containing protein 11, partial [Campanula 
peregrina]
Length=267

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 114/230 (50%), Gaps = 5/230 (2%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            + P VA   Y +++  G  P   ++  ++N +C+      A + F EM + G    +V+Y
Sbjct  32   KSPVVAWDFYLEILGCGYPPNLYSFNILMNKFCKECKVKDAHLVFDEMSRSGLRPTVVSY  91

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            ++++N Y K G   E  RL   M+E    P+V+ Y++L++   +   M    KV+ EM  
Sbjct  92   NTLINGYCKWGNSDEGFRLKKVMEESRLVPDVFTYSSLINGLCKGGRMDDANKVFGEMCS  151

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +VP+ V YT++I+ + K  ++   ++ Y    + G K D  M   ++ V  K   ++E
Sbjct  152  KGLVPNDVIYTTLINGFCKDGKVSLAMELYGRMLMKGVKPDLIMYNTLINVICKSGNINE  211

Query  545  LVKLLQDLKTDETKLDERLYRSALNAL-----RDAGLEIRAKWLQESFAV  679
              KL+ ++     K D+  Y + ++        DA LEIR + +QE   +
Sbjct  212  ARKLIDEMSLKGLKADKVTYTTLIDGCCKEGDLDAALEIRKRMIQEGIEL  261


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 90/195 (46%), Gaps = 0/195 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++++   G  P  V+Y +++N YC+ G   +       ME+      +  YSS++N
Sbjct  72   AHLVFDEMSRSGLRPTVVSYNTLINGYCKWGNSDEGFRLKKVMEESRLVPDVFTYSSLIN  131

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K GR  +A ++  +M  +G  PN  IY TL++   +   +    +++  M  + V P
Sbjct  132  GLCKGGRMDDANKVFGEMCSKGLVPNDVIYTTLINGFCKDGKVSLAMELYGRMLMKGVKP  191

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D + Y ++I+   K+  +    K   +  L G K D+     ++    K   +D  +++ 
Sbjct  192  DLIMYNTLINVICKSGNINEARKLIDEMSLKGLKADKVTYTTLIDGCCKEGDLDAALEIR  251

Query  560  QDLKTDETKLDERLY  604
            + +  +  +LD   Y
Sbjct  252  KRMIQEGIELDNVAY  266


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+ ++ S+G  P  V Y +++N +C+ G  S A   +  M  KG    ++ Y++++N
Sbjct  142  ANKVFGEMCSKGLVPNDVIYTTLINGFCKDGKVSLAMELYGRMLMKGVKPDLIMYNTLIN  201

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +  K+G   EA +L+ +M  +G + +   Y TL+D   +  ++    ++ K M +  +  
Sbjct  202  VICKSGNINEARKLIDEMSLKGLKADKVTYTTLIDGCCKEGDLDAALEIRKRMIQEGIEL  261

Query  380  DRVSYT  397
            D V+YT
Sbjct  262  DNVAYT  267



>ref|XP_002962027.1| hypothetical protein SELMODRAFT_77588, partial [Selaginella moellendorffii]
 gb|EFJ37287.1| hypothetical protein SELMODRAFT_77588, partial [Selaginella moellendorffii]
Length=814

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 106/206 (51%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V + ++++ C P +VTY  ++N  C+ G   +AE  F  M   GF    V Y+S+++
Sbjct  279  ALKVLDNMLAKACVPTEVTYGILVNSLCKAGTLERAEELFRVMAASGFRPNSVIYTSLIH  338

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K+GR KEA  L  +M E G  P+V  +  ++D   ++ N +Q  K ++EM R    P
Sbjct  339  GFAKSGRMKEACSLFDEMVEAGYRPDVITHTVMIDGLCKSGNFEQAAKSFEEMMRGGCKP  398

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + V+YT++I   SK   + +  +  +    +G   D      ++  F K+ ++DE  +LL
Sbjct  399  NVVTYTTIIQGLSKIGRVANAFRIMKGMIAHGCFPDSVTYICLLDGFCKLGRLDEAAQLL  458

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             +L    +  + +LY S +  L D G
Sbjct  459  DELDKCSSSPNLQLYSSLVKGLCDGG  484


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 94/203 (46%), Gaps = 1/203 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A ++++++V  G  P  +T+  +++  C+ G + +A  +F EM + G    +V Y++++ 
Sbjct  349  ACSLFDEMVEAGYRPDVITHTVMIDGLCKSGNFEQAAKSFEEMMRGGCKPNVVTYTTIIQ  408

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K GR   A R++  M   GC P+   Y  LLD   +   + +  ++  E+ +    P
Sbjct  409  GLSKIGRVANAFRIMKGMIAHGCFPDSVTYICLLDGFCKLGRLDEAAQLLDELDKCSSSP  468

Query  380  DRVSYTSVISAYSKAKELESCV-KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            +   Y+S++        +E+ +   ++  K      D  +   ++    K  ++DE  ++
Sbjct  469  NLQLYSSLVKGLCDGGSVENTLDDLFEQSKAAAENLDPGLCCSIIVGLCKTGRLDEACRI  528

Query  557  LQDLKTDETKLDERLYRSALNAL  625
             Q + ++  K D   Y   +N L
Sbjct  529  FQRMVSEGCKPDATTYNILINGL  551


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/207 (20%), Positives = 95/207 (46%), Gaps = 1/207 (0%)
 Frame = +2

Query  20   AATVYEKLVSQG-CEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            A  V+ ++++ G   P +  + +++    +     +A   F +ME+ GF    +AY++M+
Sbjct  208  AFEVFHEMMAMGFVPPDRALHTAMVRTLLKAKRVKEAREVFGQMEKCGFPPDAIAYNTMI  267

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +   K G  +EA +++  M  + C P    Y  L++   +A  +++ E++++ M      
Sbjct  268  DGLAKAGHAQEALKVLDNMLAKACVPTEVTYGILVNSLCKAGTLERAEELFRVMAASGFR  327

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P+ V YTS+I  ++K+  ++     + +    G + D     +M+    K    ++  K 
Sbjct  328  PNSVIYTSLIHGFAKSGRMKEACSLFDEMVEAGYRPDVITHTVMIDGLCKSGNFEQAAKS  387

Query  557  LQDLKTDETKLDERLYRSALNALRDAG  637
             +++     K +   Y + +  L   G
Sbjct  388  FEEMMRGGCKPNVVTYTTIIQGLSKIG  414


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 4/178 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS---EMEQKGFDKCIVAYSS  190
            A  +++++VS+GC+P   TY  ++N  CR    ++ E  F+   ++E  G+    V Y+ 
Sbjct  525  ACRIFQRMVSEGCKPDATTYNILINGLCR-SRENRVERAFALLHDLEMVGYLPDAVTYTP  583

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +     K G    A +++ +   RG   +V  Y  L         + +   +++EM R+ 
Sbjct  584  LCIGLCKIGEVDRAVKMLEEASSRGWNADVVAYTALCTGLCYQGQVDRAVSLFQEMVRQG  643

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
              PD  +Y  +I+   K K+LE   K++ +    G K   A    +V        VDE
Sbjct  644  GAPDAAAYCCIINGLIKGKKLEDACKFFDEMIGKGQKPTVATYTALVQALCHAGNVDE  701


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/197 (23%), Positives = 87/197 (44%), Gaps = 1/197 (1%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKM  253
            TY  ++N+      YS+      EM + G      +++ ++  + +T R  +A      M
Sbjct  121  TYNCLMNLLVAEKNYSQCYAIHEEMLKAGIAPNTFSFNILIRSFARTRRADDAVTCFEIM  180

Query  254  KERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP-DRVSYTSVISAYSKAKE  430
            K + C+P++  +  L+D   +A   ++  +V+ EM     VP DR  +T+++    KAK 
Sbjct  181  KRKRCKPDLHTFLILVDCLCKAGMDEKAFEVFHEMMAMGFVPPDRALHTAMVRTLLKAKR  240

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            ++   + +   +  G   D      M+   +K     E +K+L ++        E  Y  
Sbjct  241  VKEAREVFGQMEKCGFPPDAIAYNTMIDGLAKAGHAQEALKVLDNMLAKACVPTEVTYGI  300

Query  611  ALNALRDAGLEIRAKWL  661
             +N+L  AG   RA+ L
Sbjct  301  LVNSLCKAGTLERAEEL  317


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 73/170 (43%), Gaps = 1/170 (1%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P  VTY  +    C+IG   +A     E   +G++  +VAY+++       G+   A  L
Sbjct  576  PDAVTYTPLCIGLCKIGEVDRAVKMLEEASSRGWNADVVAYTALCTGLCYQGQVDRAVSL  635

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
              +M  +G  P+   Y  +++   +   ++   K + EM  +   P   +YT+++ A   
Sbjct  636  FQEMVRQGGAPDAAAYCCIINGLIKGKKLEDACKFFDEMIGKGQKPTVATYTALVQALCH  695

Query  422  AKELESCVKYYQDFKLNGGKTDRAMA-GIMVGVFSKMNKVDELVKLLQDL  568
            A  ++     ++     G      M    ++  F K  KVD  +KL +D+
Sbjct  696  AGNVDEAFHRFEGMLARGELVGSVMIYDALIHGFCKALKVDAALKLFEDM  745


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 68/164 (41%), Gaps = 1/164 (1%)
 Frame = +2

Query  149  EQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNM  328
            EQ GF   +  Y+ ++N+      + +   +  +M + G  PN + +N L+    R    
Sbjct  111  EQAGFQHDVFTYNCLMNLLVAEKNYSQCYAIHEEMLKAGIAPNTFSFNILIRSFARTRRA  170

Query  329  KQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGG-KTDRAMAGI  505
                  ++ MKR++  PD  ++  ++    KA   E   + + +    G    DRA+   
Sbjct  171  DDAVTCFEIMKRKRCKPDLHTFLILVDCLCKAGMDEKAFEVFHEMMAMGFVPPDRALHTA  230

Query  506  MVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  637
            MV    K  +V E  ++   ++      D   Y + ++ L  AG
Sbjct  231  MVRTLLKAKRVKEAREVFGQMEKCGFPPDAIAYNTMIDGLAKAG  274



>gb|AHC02098.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
polygalifolia]
Length=436

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  102  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  158

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  159  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  218

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  219  KNIVQNVVTYNSMIMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  278

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  279  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  139  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  198

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  199  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMIMIYGKTLEHEKANNLIQEMQNRGIEP  258

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  259  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  318

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  319  HELKSPD------------NIPRDTAIHILA  337


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/204 (20%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  
Sbjct  2    LFDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSR  61

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  
Sbjct  62   KLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTA  121

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SY+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   +
Sbjct  122  SYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGM  181

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +    + +   Y + L    DA L
Sbjct  182  RKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  226  VTYNSMIMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  285

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  286  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  341

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  342  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  401

Query  611  ALNA  622
             LNA
Sbjct  402  VLNA  405


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  244  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  304  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  363

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  364  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  423



>gb|KDO54845.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
 gb|KDO54846.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
Length=732

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 106/207 (51%), Gaps = 6/207 (3%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G  P  VTY +++N YCR G   +A    + M  KG    +  Y+S++N   K GR   
Sbjct  269  KGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDR  328

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  ++ +M + G  P+   YNTLL    R  NM + E+++ EM RR V PD VS++++I 
Sbjct  329  AKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIG  388

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             +S+  +L+  + Y+++ K  G   D  +  I++  + +   V E +K+  ++      +
Sbjct  389  IFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVM  448

Query  590  DERLYRSALNALRDAGLEIRAKWLQES  670
            D   Y + LN L       RAK L E+
Sbjct  449  DVVTYNTILNGL------CRAKMLTEA  469


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 93/183 (51%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++  +G  P  V++++++ I+ R G   +A M F EM+  G     V Y+ ++N
Sbjct  364  AEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIIN  423

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y + G   EA ++  +M E+GC  +V  YNT+L+   RA  + + + ++ EM  R V P
Sbjct  424  GYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFP  483

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T++I  + K   +   +  +        K D      ++  F K+ ++++  KL 
Sbjct  484  DFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLW  543

Query  560  QDL  568
             D+
Sbjct  544  ADM  546


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 105/217 (48%), Gaps = 6/217 (3%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            ++++ +GC    VTY +ILN  CR  + ++A+  F+EM ++G       ++++++ + K 
Sbjct  439  DEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKD  498

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
            G   +A  L   M ++  +P++  YNTL+D   +   M++  K+W +M  RK+ P+ +SY
Sbjct  499  GNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISY  558

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
              +I+ Y     +    + + +    G K        ++  + +     +  + L  + +
Sbjct  559  GILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVS  618

Query  575  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVAT  685
            +    D   Y + +N        +R + + ++FA+ +
Sbjct  619  EGVDPDSISYNTLINGF------VREENMDKAFALVS  649


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 83/159 (52%), Gaps = 0/159 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++V +G +P  V+  +I+  YCR G  SKA+   S+M  +G D   ++Y++++N
Sbjct  574  AFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLIN  633

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + +     +A  LV+KM+ +G  P+V  YN +L    R   M   E +   M  + + P
Sbjct  634  GFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNP  693

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM  496
            DR +YT++I+ +     L+   +++ +    G   D A 
Sbjct  694  DRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  732


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 74/134 (55%), Gaps = 0/134 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  ++S+   P  ++Y  ++N YC +G  ++A   + EM  KG    +V+ ++++ 
Sbjct  539  ANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIK  598

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y ++G   +A   ++KM   G +P+   YNTL++   R  NM +   +  +M+ + +VP
Sbjct  599  GYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVP  658

Query  380  DRVSYTSVISAYSK  421
            D ++Y  +++ + +
Sbjct  659  DVITYNVILTGFCR  672


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/202 (21%), Positives = 90/202 (45%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +++ +G  P   T+ ++++ +C+ G  +KA   F  M QK     IV Y+++++
Sbjct  469  ADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLID  528

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A +L A M  R   PN   Y  L++ +    ++ +  ++W EM  + + P
Sbjct  529  GFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKP  588

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              VS  ++I  Y ++ +     ++       G   D      ++  F +   +D+   L+
Sbjct  589  TLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALV  648

Query  560  QDLKTDETKLDERLYRSALNAL  625
              ++      D   Y   L   
Sbjct  649  SKMENQGLVPDVITYNVILTGF  670



>ref|XP_006470579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Citrus sinensis]
Length=752

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 106/207 (51%), Gaps = 6/207 (3%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G  P  VTY +++N YCR G   +A    + M  KG    +  Y+S++N   K GR   
Sbjct  289  KGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDR  348

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  ++ +M + G  P+   YNTLL    R  NM + E+++ EM RR V PD VS++++I 
Sbjct  349  AKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIG  408

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             +S+  +L+  + Y+++ K  G   D  +  I++  + +   V E +K+  ++      +
Sbjct  409  IFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVM  468

Query  590  DERLYRSALNALRDAGLEIRAKWLQES  670
            D   Y + LN L       RAK L E+
Sbjct  469  DVVTYNTILNGL------CRAKMLTEA  489


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 104/216 (48%), Gaps = 6/216 (3%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            ++++ +GC    VTY +ILN  CR  + ++A+  F+EM ++G       ++++++ + K 
Sbjct  459  DEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKD  518

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
            G   +A  L   M ++  +P++  YNTL+D   +   M++  K+W +M  RK+ P+ +SY
Sbjct  519  GNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISY  578

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
              +I+ Y     +    + + +    G K        ++  + +     +  + L  + +
Sbjct  579  GILINGYCSMGHVTEAFRLWYEMVGEGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVS  638

Query  575  DETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +    D   Y + +N        +R + + ++FA+ 
Sbjct  639  EGVDPDSISYNTLINGF------VREENMDKAFALV  668


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 93/183 (51%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++  +G  P  V++++++ I+ R G   +A M F EM+  G     V Y+ ++N
Sbjct  384  AEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIIN  443

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y + G   EA ++  +M E+GC  +V  YNT+L+   RA  + + + ++ EM  R V P
Sbjct  444  GYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFP  503

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  ++T++I  + K   +   +  +        K D      ++  F K+ ++++  KL 
Sbjct  504  DFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLW  563

Query  560  QDL  568
             D+
Sbjct  564  ADM  566


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 83/159 (52%), Gaps = 0/159 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++V +G +P  V+  +I+  YCR G  SKA+   S+M  +G D   ++Y++++N
Sbjct  594  AFRLWYEMVGEGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLIN  653

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + +     +A  LV KM+ +G  P+V  YN ++    R   M   E + + M  + + P
Sbjct  654  GFVREENMDKAFALVRKMENQGLVPDVITYNVIMTGFCRQGRMHDSELILRRMIEKGLNP  713

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM  496
            DR +YT++I+ +     L+   +++ +    G   D A 
Sbjct  714  DRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPDDAF  752


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 87/185 (47%), Gaps = 0/185 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +++ +G  P   T+ ++++ +C+ G  +KA   F  M QK     IV Y+++++
Sbjct  489  ADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLID  548

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++A +L A M  R   PN   Y  L++ +    ++ +  ++W EM    + P
Sbjct  549  GFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGEGIKP  608

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              VS  ++I  Y ++ +     ++       G   D      ++  F +   +D+   L+
Sbjct  609  THVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALV  668

Query  560  QDLKT  574
            + ++ 
Sbjct  669  RKMEN  673


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 74/134 (55%), Gaps = 0/134 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  ++S+   P  ++Y  ++N YC +G  ++A   + EM  +G     V+ ++++ 
Sbjct  559  ANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGEGIKPTHVSCNTIIK  618

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y ++G   +A   ++KM   G +P+   YNTL++   R  NM +   + ++M+ + +VP
Sbjct  619  GYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVRKMENQGLVP  678

Query  380  DRVSYTSVISAYSK  421
            D ++Y  +++ + +
Sbjct  679  DVITYNVIMTGFCR  692


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/201 (19%), Positives = 93/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++ +  +  +P  VTY ++++ +C++G   KA   +++M  +      ++Y  ++N
Sbjct  524  ALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILIN  583

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G   EA RL  +M   G +P     NT++  + R+ +  + ++   +M    V P
Sbjct  584  GYCSMGHVTEAFRLWYEMVGEGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDP  643

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +SY ++I+ + + + ++      +  +  G   D     +++  F +  ++ +   +L
Sbjct  644  DSISYNTLINGFVREENMDKAFALVRKMENQGLVPDVITYNVIMTGFCRQGRMHDSELIL  703

Query  560  QDLKTDETKLDERLYRSALNA  622
            + +       D   Y + +N 
Sbjct  704  RRMIEKGLNPDRSTYTTLING  724



>ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa]
 gb|EEE93968.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa]
Length=709

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 105/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +++++S+G EP  VT+ ++++ +CR G + +AE  F EM + G+  C   ++ M+N
Sbjct  464  AMATFDRMLSEGIEPDTVTWNTLIDCHCRAGKHDRAEELFEEMMEGGYSPCNTTFNIMIN  523

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +G   R  +   L+A M+ +G  PN   Y TL+DI+G++       +   +MK   + P
Sbjct  524  SFGDQERWDDVKNLLAHMRSQGLVPNSVTYTTLIDIYGKSGRFNDAIECLDDMKAAGLKP  583

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++  +++G K        ++  F +  +  E   +L
Sbjct  584  SSTMYNALINAYAQRGLSEQAVSAFRAMRVDGLKPSLLALNSLINAFGEDRRDAEAFTVL  643

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K ++ K D   Y + + AL
Sbjct  644  QYMKENDLKPDVVTYTTLMKAL  665


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/206 (22%), Positives = 93/206 (45%), Gaps = 4/206 (2%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V  ++ + G  P +V Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  432  VLREMENSGVRPDRVFYNVMIDTFGKFNCLDHAMATFDRMLSEGIEPDTVTWNTLIDCHC  491

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G+H  A  L  +M E G  P    +N +++  G       V+ +   M+ + +VP+ V
Sbjct  492  RAGKHDRAEELFEEMMEGGYSPCNTTFNIMINSFGDQERWDDVKNLLAHMRSQGLVPNSV  551

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT++I  Y K+      ++   D K  G K    M   ++  +++    ++ V   + +
Sbjct  552  TYTTLIDIYGKSGRFNDAIECLDDMKAAGLKPSSTMYNALINAYAQRGLSEQAVSAFRAM  611

Query  569  KTDETKLDERLYRSALNAL----RDA  634
            + D  K       S +NA     RDA
Sbjct  612  RVDGLKPSLLALNSLINAFGEDRRDA  637


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 88/182 (48%), Gaps = 0/182 (0%)
 Frame = +2

Query  122  KAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLL  301
            +AE  F EM   G      AY++++  Y K G  K+A  +V++M+  G  PN   Y+ L+
Sbjct  323  EAEAIFEEMRDNGLKPRTRAYNALLRGYVKAGLLKDAEFVVSEMERSGVSPNEQTYSFLI  382

Query  302  DIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGK  481
            D +G A   +    V KEM+   V P+   ++ ++S+Y    E +   +  ++ + +G +
Sbjct  383  DAYGNAGRWESARIVLKEMEASNVQPNAYVFSRILSSYRDKGEWQKSFQVLREMENSGVR  442

Query  482  TDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
             DR    +M+  F K N +D  +     + ++  + D   + + ++    AG   RA+ L
Sbjct  443  PDRVFYNVMIDTFGKFNCLDHAMATFDRMLSEGIEPDTVTWNTLIDCHCRAGKHDRAEEL  502

Query  662  QE  667
             E
Sbjct  503  FE  504


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 86/183 (47%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G +P    Y ++L  Y + G+   AE   SEME+ G       YS +++
Sbjct  324  AEAIFEEMRDNGLKPRTRAYNALLRGYVKAGLLKDAEFVVSEMERSGVSPNEQTYSFLID  383

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG  GR + A  ++ +M+    +PN ++++ +L  +      ++  +V +EM+   V P
Sbjct  384  AYGNAGRWESARIVLKEMEASNVQPNAYVFSRILSSYRDKGEWQKSFQVLREMENSGVRP  443

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DRV Y  +I  + K   L+  +  +      G + D      ++    +  K D   +L 
Sbjct  444  DRVFYNVMIDTFGKFNCLDHAMATFDRMLSEGIEPDTVTWNTLIDCHCRAGKHDRAEELF  503

Query  560  QDL  568
            +++
Sbjct  504  EEM  506


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 81/167 (49%), Gaps = 0/167 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            SQG  P  VTY ++++IY + G ++ A     +M+  G       Y++++N Y + G  +
Sbjct  543  SQGLVPNSVTYTTLIDIYGKSGRFNDAIECLDDMKAAGLKPSSTMYNALINAYAQRGLSE  602

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A      M+  G +P++   N+L++  G      +   V + MK   + PD V+YT+++
Sbjct  603  QAVSAFRAMRVDGLKPSLLALNSLINAFGEDRRDAEAFTVLQYMKENDLKPDVVTYTTLM  662

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDEL  547
             A  + ++ +     Y++  L+G   DR    ++      M +  EL
Sbjct  663  KALIRVEKFDKVPSVYEEMILSGCTPDRKARAMLRSALKYMKQTLEL  709


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/211 (22%), Positives = 93/211 (44%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ IL+ Y   G + K+     EME  G     V Y+ M++
Sbjct  394  ARIVLKEMEASNVQPNAYVFSRILSSYRDKGEWQKSFQVLREMENSGVRPDRVFYNVMID  453

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H RA    + E++++EM      P
Sbjct  454  TFGKFNCLDHAMATFDRMLSEGIEPDTVTWNTLIDCHCRAGKHDRAEELFEEMMEGGYSP  513

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               ++  +I+++   +  +         +  G   +      ++ ++ K  + ++ ++ L
Sbjct  514  CNTTFNIMINSFGDQERWDDVKNLLAHMRSQGLVPNSVTYTTLIDIYGKSGRFNDAIECL  573

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             D+K    K    +Y + +NA    GL  +A
Sbjct  574  DDMKAAGLKPSSTMYNALINAYAQRGLSEQA  604



>gb|AFK37759.1| unknown [Lotus japonicus]
Length=500

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 108/208 (52%), Gaps = 0/208 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ +++S  C+P   TY +++N + R G+  KAE  F +M++ G +  + +Y++++
Sbjct  285  MALKVFNEMLSHKCKPNICTYTALVNAFAREGLCEKAEEVFEQMQEAGLEPDVYSYNALM  344

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN L+D +GRA  +   E V+++MKR  + 
Sbjct  345  EAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNILVDAYGRAGFLNDAEAVFEDMKRVGIT  404

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SA+SK   +  C         +G K D  +   M+ ++ ++ +  ++ ++
Sbjct  405  PTMKSHMVLLSAFSKTGNVSKCEDILNQMCKSGLKLDTFVLNSMLNLYGRLGQFGKMEEV  464

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L  ++    + D   Y   +N    AG 
Sbjct  465  LTVMENGSCEADISTYNILINRYGQAGF  492


 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 96/203 (47%), Gaps = 0/203 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A  ++ ++   GC+P   TY  ++N+Y + G    A   F+EM        I  Y++
Sbjct  248  PNKAEEIFLRMKRDGCKPSTETYTMLINLYGKDGKSFMALKVFNEMLSHKCKPNICTYTA  307

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +VN + + G  ++A  +  +M+E G EP+V+ YN L++ + RA       +++  M+   
Sbjct  308  LVNAFAREGLCEKAEEVFEQMQEAGLEPDVYSYNALMEAYSRAGFPYGAAEIFSLMQHMG  367

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
              PDR SY  ++ AY +A  L      ++D K  G         +++  FSK   V +  
Sbjct  368  CEPDRASYNILVDAYGRAGFLNDAEAVFEDMKRVGITPTMKSHMVLLSAFSKTGNVSKCE  427

Query  551  KLLQDLKTDETKLDERLYRSALN  619
             +L  +     KLD  +  S LN
Sbjct  428  DILNQMCKSGLKLDTFVLNSMLN  450


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 107/223 (48%), Gaps = 12/223 (5%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y +L+   C P + TYA ++  YC  G+  KAE  F EM+  G     V Y+S +N
Sbjct  181  AESTYLQLLEARCIPNEDTYALLIKAYCLSGLLEKAEAVFVEMKNYGLPSSAVVYNSYIN  240

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G   +A  +  +MK  GC+P+   Y  L++++G+        KV+ EM   K  P
Sbjct  241  GLMKGGNPNKAEEIFLRMKRDGCKPSTETYTMLINLYGKDGKSFMALKVFNEMLSHKCKP  300

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  +YT++++A+++    E   + ++  +  G + D      ++  +S+        E+ 
Sbjct  301  NICTYTALVNAFAREGLCEKAEEVFEQMQEAGLEPDVYSYNALMEAYSRAGFPYGAAEIF  360

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  679
             L+Q +  +         R++ N L DA    RA +L ++ AV
Sbjct  361  SLMQHMGCEPD-------RASYNILVDA--YGRAGFLNDAEAV  394


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/138 (24%), Positives = 74/138 (54%), Gaps = 0/138 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  AA ++  +   GCEP + +Y  +++ Y R G  + AE  F +M++ G    + ++  
Sbjct  353  PYGAAEIFSLMQHMGCEPDRASYNILVDAYGRAGFLNDAEAVFEDMKRVGITPTMKSHMV  412

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +++ + KTG   +   ++ +M + G + + ++ N++L+++GR     ++E+V   M+   
Sbjct  413  LLSAFSKTGNVSKCEDILNQMCKSGLKLDTFVLNSMLNLYGRLGQFGKMEEVLTVMENGS  472

Query  371  VVPDRVSYTSVISAYSKA  424
               D  +Y  +I+ Y +A
Sbjct  473  CEADISTYNILINRYGQA  490



>ref|XP_010052528.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
[Eucalyptus grandis]
 gb|KCW76599.1| hypothetical protein EUGRSUZ_D00981 [Eucalyptus grandis]
Length=582

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 113/207 (55%), Gaps = 0/207 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  ++ ++ SQ C+P   TY  ++N + R G+  KAE  F ++++ G +  + AY++++
Sbjct  284  MALKMFNEMRSQRCKPNICTYTVLINAFAREGLCEKAEEIFEQLQEAGHEPDVYAYNALM  343

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   +N ++D +GR+   K  E V+++MKR  +V
Sbjct  344  EAYSRAGYPYGAAEIFSLMQHMGCEPDRASFNIMVDAYGRSGLYKDAESVFEDMKRLGIV  403

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++ AYSK+  +  C    +  + +G + D  +   M+ ++ ++ + +++ ++
Sbjct  404  PTMKSHMLLLCAYSKSGNVAKCEDIVRQMQQSGLEPDTHVLNNMLNLYGRLGQFEKMEEV  463

Query  557  LQDLKTDETKLDERLYRSALNALRDAG  637
            L  ++T     D   Y + +NA   AG
Sbjct  464  LNAMETGPYVADITTYNTLINAYARAG  490


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/208 (25%), Positives = 102/208 (49%), Gaps = 10/208 (5%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y +L+   C P + TYA +L  YC  G+  KAE  F+EM + G       Y++ ++
Sbjct  180  AESTYLQLLEARCVPTEDTYALLLKAYCTCGLLEKAEAVFAEMRKYGLPPSAAVYNAYID  239

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G+ ++A ++  +MK   C+P    Y  L+++ G+AS      K++ EM+ ++  P
Sbjct  240  GLMKGGKPEKAIKIFDRMKRESCQPTTETYTMLINLFGKASKSYMALKMFNEMRSQRCKP  299

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  +YT +I+A+++    E   + ++  +  G + D      ++  +S+        E+ 
Sbjct  300  NICTYTVLINAFAREGLCEKAEEIFEQLQEAGHEPDVYAYNALMEAYSRAGYPYGAAEIF  359

Query  551  KLLQDLKTDETKLDERLYRSALNALRDA  634
             L+Q +  +         R++ N + DA
Sbjct  360  SLMQHMGCEPD-------RASFNIMVDA  380


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 92/172 (53%), Gaps = 0/172 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  AA ++  +   GCEP + ++  +++ Y R G+Y  AE  F +M++ G    + ++  
Sbjct  352  PYGAAEIFSLMQHMGCEPDRASFNIMVDAYGRSGLYKDAESVFEDMKRLGIVPTMKSHML  411

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y K+G   +   +V +M++ G EP+  + N +L+++GR    +++E+V   M+   
Sbjct  412  LLCAYSKSGNVAKCEDIVRQMQQSGLEPDTHVLNNMLNLYGRLGQFEKMEEVLNAMETGP  471

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSK  526
             V D  +Y ++I+AY++A  LE   + +Q   +   + D       +G +S+
Sbjct  472  YVADITTYNTLINAYARAGYLEKVEELFQMIPIKRLQPDVVTWTSRLGAYSR  523


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/196 (20%), Positives = 92/196 (47%), Gaps = 6/196 (3%)
 Frame = +2

Query  59   EPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVNMYGKTGRHKE  229
            +P  + Y  +++ Y    +Y KAE T+ ++ +    +C+     Y+ ++  Y   G  ++
Sbjct  158  QPDVICYNLLIDAYGHKSMYQKAESTYLQLLEA---RCVPTEDTYALLLKAYCTCGLLEK  214

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + A+M++ G  P+  +YN  +D   +    ++  K++  MKR    P   +YT +I+
Sbjct  215  AEAVFAEMRKYGLPPSAAVYNAYIDGLMKGGKPEKAIKIFDRMKRESCQPTTETYTMLIN  274

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             + KA +    +K + + +    K +     +++  F++    ++  ++ + L+    + 
Sbjct  275  LFGKASKSYMALKMFNEMRSQRCKPNICTYTVLINAFAREGLCEKAEEIFEQLQEAGHEP  334

Query  590  DERLYRSALNALRDAG  637
            D   Y + + A   AG
Sbjct  335  DVYAYNALMEAYSRAG  350


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/211 (19%), Positives = 90/211 (43%), Gaps = 4/211 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSK--AEMTFSE--MEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P   T+  ++N+  ++ +  K    +   E  + +  F   ++ Y+ +++ YG    +++
Sbjct  120  PTHATWDDVINVAVQLRLNKKWYPIILIGEWLLHRSSFQPDVICYNLLIDAYGHKSMYQK  179

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A     ++ E  C P    Y  LL  +     +++ E V+ EM++  + P    Y + I 
Sbjct  180  AESTYLQLLEARCVPTEDTYALLLKAYCTCGLLEKAEAVFAEMRKYGLPPSAAVYNAYID  239

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K  + E  +K +   K    +       +++ +F K +K    +K+  ++++   K 
Sbjct  240  GLMKGGKPEKAIKIFDRMKRESCQPTTETYTMLINLFGKASKSYMALKMFNEMRSQRCKP  299

Query  590  DERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            +   Y   +NA    GL  +A+ + E    A
Sbjct  300  NICTYTVLINAFAREGLCEKAEEIFEQLQEA  330



>gb|EMT10539.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=906

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 113/209 (54%), Gaps = 1/209 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A  V++++ S GC+    TY +++N + R G+  KAE  F EM+Q G +  + AY++
Sbjct  607  PMSAMKVFKEMQSLGCKANICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNA  666

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y + G  + A  + + M+  GCEP+   YN L+D +GR+   ++ E V++ +KR+ 
Sbjct  667  LMEAYSRAGFPQAAAEIFSLMQHMGCEPDRASYNILVDAYGRSGLHREAEAVFESLKRQG  726

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P   S+  +++A++++  +  C +       +G   D      M+  + +  ++D++ 
Sbjct  727  MAPTMKSHMLLLAAHARSGNVARCEEVMAQLHKSGLAPDTFALNAMLNAYGRAGRLDDME  786

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAG  637
            +LL  ++   T+ D   Y  A+NA   AG
Sbjct  787  RLLAAMERRGTR-DVGTYNVAVNAYGRAG  814


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/192 (26%), Positives = 97/192 (51%), Gaps = 1/192 (1%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            R A  V+E L  QG  P   ++  +L  + R G  ++ E   +++ + G      A ++M
Sbjct  713  REAEAVFESLKRQGMAPTMKSHMLLLAAHARSGNVARCEEVMAQLHKSGLAPDTFALNAM  772

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            +N YG+ GR  +  RL+A M+ RG   +V  YN  ++ +GRA  ++++E     ++ R +
Sbjct  773  LNAYGRAGRLDDMERLLAAMERRGTR-DVGTYNVAVNAYGRAGYLERMEAAVASLEGRGL  831

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
              D V++TS + AYS+ +E   C++ + +    G   D   A  +V   S   + +++  
Sbjct  832  AADVVTWTSRMGAYSRKQEYRRCLEIFAEMVDAGCYPDAGTATALVAACSDERQGEQVTA  891

Query  554  LLQDLKTDETKL  589
            +++ +  +   L
Sbjct  892  IVRSMHKEAKTL  903


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 92/206 (45%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  VY+++  + C     TY  ++N+Y +      A   F EM+  G    I  Y+++VN
Sbjct  575  AVEVYQRMKRERCRTNTETYTLMINVYGKSKQPMSAMKVFKEMQSLGCKANICTYTALVN  634

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M++ G EP+V+ YN L++ + RA   +   +++  M+     P
Sbjct  635  AFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGFPQAAAEIFSLMQHMGCEP  694

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY ++         ++  K  G         +++   ++   V    +++
Sbjct  695  DRASYNILVDAYGRSGLHREAEAVFESLKRQGMAPTMKSHMLLLAAHARSGNVARCEEVM  754

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              L       D     + LNA   AG
Sbjct  755  AQLHKSGLAPDTFALNAMLNAYGRAG  780


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 96/230 (42%), Gaps = 46/230 (20%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDK----------  169
            A  +Y  L+   C P + TYA +L  YC  G   +AE   SEM + G             
Sbjct  494  AEAMYAALLEARCVPTEDTYALLLRAYCAAGSLHRAEGVISEMREHGIPPSRSLSISTRV  553

Query  170  -CIVAYSS-----------------------------------MVNMYGKTGRHKEATRL  241
             C   Y++                                   M+N+YGK+ +   A ++
Sbjct  554  DCATVYNAYLDGLLKARCAEKAVEVYQRMKRERCRTNTETYTLMINVYGKSKQPMSAMKV  613

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
              +M+  GC+ N+  Y  L++   R    ++ E+V++EM++    PD  +Y +++ AYS+
Sbjct  614  FKEMQSLGCKANICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSR  673

Query  422  AKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
            A   ++  + +   +  G + DRA   I+V  + +     E   + + LK
Sbjct  674  AGFPQAAAEIFSLMQHMGCEPDRASYNILVDAYGRSGLHREAEAVFESLK  723


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/208 (24%), Positives = 93/208 (45%), Gaps = 15/208 (7%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEME----QKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P    +  +LN+  ++ +  + +   S  E    +  F   +V Y+ +++ YG+T R  +
Sbjct  434  PTHALWDDVLNVAVQLRLSRQWDPIISVCEWIVHRSSFRPDVVCYNLLIDAYGRTRRLGK  493

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD-------RV  388
            A  + A + E  C P    Y  LL  +  A ++ + E V  EM+   + P        RV
Sbjct  494  AEAMYAALLEARCVPTEDTYALLLRAYCAAGSLHRAEGVISEMREHGIPPSRSLSISTRV  553

Query  389  SYTSVISAY----SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
               +V +AY     KA+  E  V+ YQ  K    +T+     +M+ V+ K  +    +K+
Sbjct  554  DCATVYNAYLDGLLKARCAEKAVEVYQRMKRERCRTNTETYTLMINVYGKSKQPMSAMKV  613

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
             +++++   K +   Y + +NA    GL
Sbjct  614  FKEMQSLGCKANICTYTALVNAFAREGL  641



>gb|AHC02090.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
gratissima]
Length=363

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  57   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  113

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  114  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  173

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  174  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  233

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  234  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  272


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 104/211 (49%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  94   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  153

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  154  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  213

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  214  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  273

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
              LK+ +            N  RD  + I A
Sbjct  274  HXLKSPD------------NIPRDTAIHILA  292


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 85/184 (46%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  181  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  240

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++   +K     PD +   + I   + A  
Sbjct  241  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHXLKS----PDNIPRDTAIHILAGAGR  296

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  297  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  356

Query  611  ALNA  622
             LNA
Sbjct  357  VLNA  360


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160



>gb|ACU25764.1| pentatricopeptide repeat-containing protein [Dipyrena glaberrima]
Length=426

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 119/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P  V+Y+++L +Y     + +A   F+EM +    KC++  ++ 
Sbjct  96   REARSLISEMRTAGVMPNTVSYSTLLTMYVENKKFLEALTVFAEMREI---KCLLDLTTC  152

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  153  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  212

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++SK+ K+D 
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWSKIGKLDR  272

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  273  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 111/215 (52%), Gaps = 6/215 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A TV+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  133  ALTVFAEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  192

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  193  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQSRGIEP  252

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS +SK  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  253  NSITYSTIISIWSKIGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  312

Query  560  QDLK-TDETKLDERLYRSALNALRDAGLEIRAKWL  661
             +LK  D    D     +A++ L  +G    A W+
Sbjct  313  HELKRPDNIPRD-----TAIHILAGSGRIEEATWV  342


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/197 (21%), Positives = 96/197 (49%), Gaps = 0/197 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +
Sbjct  3    RALSPDRYTYSTLITHFGKEGLFDAALAWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSK  62

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+ VSY+++++
Sbjct  63   AISIFSRLKRSGFSPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTVSYSTLLT  122

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + 
Sbjct  123  MYVENKKFLEALTVFAEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEP  182

Query  590  DERLYRSALNALRDAGL  640
            +   Y + L    DA L
Sbjct  183  NVVSYNTLLRVYGDAEL  199


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 76/183 (42%), Gaps = 31/183 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ S+G EP  +TY++I++I+ +IG   +A M F ++   G +   V Y +M+ 
Sbjct  238  ANNLIQEMQSRGIEPNSITYSTIISIWSKIGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  297

Query  200  MYGKTGRHKEATRLVAKMKERGCEPN----------------VWIYNTLLD---------  304
             Y + G    A RL+ ++K     P                  W++   +D         
Sbjct  298  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGSGRIEEATWVFRQAIDAGEVKDITV  357

Query  305  ----IH--GRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
                IH   +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  358  FERMIHLFSKYKKYSNVVEVFDKMRGLGYFPDSNVTALVLNAYGKLHEFDKANNVYIEMQ  417

Query  467  LNG  475
              G
Sbjct  418  DEG  420



>gb|AHC02095.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
looseri]
Length=377

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  56   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  112

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  113  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  172

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  173  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  232

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  233  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  271


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  93   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  152

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  153  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  212

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  213  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  272

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  273  HELKSPD------------NIPRDTAIHILA  291


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  180  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  239

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  240  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  295

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  296  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  355

Query  611  ALNA  622
             LNA
Sbjct  356  VLNA  359


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  198  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  257

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  258  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  317

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  318  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  377



>gb|AHC02101.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
scorodonioides]
Length=377

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  40   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  96

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  97   NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  156

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  157  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  216

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  217  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  255


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  77   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  136

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  137  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  196

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  197  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  256

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  257  HELKSPD------------NIPRDTAIHILA  275


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  164  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  223

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  224  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  279

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   ++++   ++      D  +   
Sbjct  280  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVIEVFDKMRGLGYFPDSNVIAL  339

Query  611  ALNA  622
             LNA
Sbjct  340  VLNA  343


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  400
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY++
Sbjct  4    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYST  63

Query  401  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  580
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  64   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  123

Query  581  TKLDERLYRSALNALRDAGL  640
             + +   Y + L    DA L
Sbjct  124  IEPNVVSYNTLLRVYGDAEL  143


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  182  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  241

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  242  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  301

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  302  FERMIHLFSKYKKYANVIEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  361



>ref|XP_003610900.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES93858.1| PPR containing plant-like protein [Medicago truncatula]
Length=1508

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 102/202 (50%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++EKL S G  P  VTY S+L  + + G   K      EM + GF K  + Y+++++
Sbjct  390  AEHLFEKLKSNGFSPDAVTYNSLLYAFSKEGNTEKVRDISEEMVKMGFGKDEMTYNTIIH  449

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGK GRH EA RL   MK  G  P+   Y  L+D+ G+AS +++  KV  EM    V P
Sbjct  450  MYGKHGRHDEALRLYRDMKSSGRNPDAVTYTVLIDLLGKASKIEEASKVMSEMLDAGVKP  509

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y+++I AY+K        + +   + +G K D     +M+  F + N++ +   L 
Sbjct  510  TLHTYSALICAYAKVGRRVEAEETFNRMRESGIKADHLAYSVMLDFFLRFNEIKKAAALY  569

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q++       D  LY   L AL
Sbjct  570  QEMIEAGFTPDTGLYEVMLPAL  591


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 96/197 (49%), Gaps = 0/197 (0%)
 Frame = +2

Query  11    PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
             P    ++  K+ S G EP + TY S++  + +  +Y +AE  F E+   G+      Y  
Sbjct  1015  PEEGLSLMHKMKSLGLEPKRDTYRSMIAAFSKQQLYDQAEELFEELRSNGYKLDRSFYHL  1074

Query  191   MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
             M+ MY  +G H++A  L+  MKE G EPN    + L+  +G++   ++ +++ K ++   
Sbjct  1075  MMKMYRTSGDHQKAENLLEIMKEAGIEPNTATMHLLMVSYGKSGQPEEADRILKNLRTMG  1134

Query  371   VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
              V D + Y+SVI AY K  + ++ ++   + K    + D  +    +   S   +V++  
Sbjct  1135  AVLDTLPYSSVIDAYLKKGDAKAGIEKLTEMKEAAIEPDHRIWTCFIRAASLSGEVNDAN  1194

Query  551   KLLQDLKTDETKLDERL  601
              LL  L+     L  RL
Sbjct  1195  NLLNALQAVGFDLPIRL  1211


 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 98/207 (47%), Gaps = 3/207 (1%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P  +TY ++++   R     +A   FS ME       +  Y++M+++YG+ G   +A
Sbjct  331  GLRPDIITYNTLISACSRESNLKEAIGVFSHMESNRCQPDLWTYNAMISVYGRCGFALKA  390

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
              L  K+K  G  P+   YN+LL    +  N ++V  + +EM +     D ++Y ++I  
Sbjct  391  EHLFEKLKSNGFSPDAVTYNSLLYAFSKEGNTEKVRDISEEMVKMGFGKDEMTYNTIIHM  450

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
            Y K    +  ++ Y+D K +G   D     +++ +  K +K++E  K++ ++     K  
Sbjct  451  YGKHGRHDEALRLYRDMKSSGRNPDAVTYTVLIDLLGKASKIEEASKVMSEMLDAGVKPT  510

Query  593  ERLYRSALNALRDAGLEIRAKWLQESF  673
               Y + + A    G  + A   +E+F
Sbjct  511  LHTYSALICAYAKVGRRVEA---EETF  534


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 94/200 (47%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+  + S  C+P   TY +++++Y R G   KAE  F +++  GF    V Y+S++ 
Sbjct  355  AIGVFSHMESNRCQPDLWTYNAMISVYGRCGFALKAEHLFEKLKSNGFSPDAVTYNSLLY  414

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  ++   +  +M + G   +   YNT++ ++G+     +  +++++MK     P
Sbjct  415  AFSKEGNTEKVRDISEEMVKMGFGKDEMTYNTIIHMYGKHGRHDEALRLYRDMKSSGRNP  474

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+YT +I    KA ++E   K   +    G K        ++  ++K+ +  E  +  
Sbjct  475  DAVTYTVLIDLLGKASKIEEASKVMSEMLDAGVKPTLHTYSALICAYAKVGRRVEAEETF  534

Query  560  QDLKTDETKLDERLYRSALN  619
              ++    K D   Y   L+
Sbjct  535  NRMRESGIKADHLAYSVMLD  554


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 96/181 (53%), Gaps = 0/181 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            + E++V  G    ++TY +I+++Y + G + +A   + +M+  G +   V Y+ ++++ G
Sbjct  428  ISEEMVKMGFGKDEMTYNTIIHMYGKHGRHDEALRLYRDMKSSGRNPDAVTYTVLIDLLG  487

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K  + +EA++++++M + G +P +  Y+ L+  + +     + E+ +  M+   +  D +
Sbjct  488  KASKIEEASKVMSEMLDAGVKPTLHTYSALICAYAKVGRRVEAEETFNRMRESGIKADHL  547

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +Y+ ++  + +  E++     YQ+    G   D  +  +M+    + N  D + +++QD 
Sbjct  548  AYSVMLDFFLRFNEIKKAAALYQEMIEAGFTPDTGLYEVMLPALVRENMGDVIERVVQDT  607

Query  569  K  571
            K
Sbjct  608  K  608


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 93/194 (48%), Gaps = 0/194 (0%)
 Frame = +2

Query  86    ILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
             +L  + + G   + +  ++ M+  G+   +  Y  M+ +  +  R ++   ++++M E G
Sbjct  900   MLEAFAQAGNLFEVQKVYNGMKAAGYFPTMHLYRLMIGLLCRFKRVRDVRVMLSEMGEAG  959

Query  266   CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
              +P++ I+N++L ++      + +  +++ ++   + PD  +Y ++I+ Y +    E  +
Sbjct  960   FKPDLQIFNSVLKLYSSIEEFQNMGVIYQMIQDAGLAPDEETYNTLITMYCRDHRPEEGL  1019

Query  446   KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
                   K  G +  R     M+  FSK    D+  +L ++L+++  KLD   Y   +   
Sbjct  1020  SLMHKMKSLGLEPKRDTYRSMIAAFSKQQLYDQAEELFEELRSNGYKLDRSFYHLMMKMY  1079

Query  626   RDAGLEIRAKWLQE  667
             R +G   +A+ L E
Sbjct  1080  RTSGDHQKAENLLE  1093


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 73/164 (45%), Gaps = 0/164 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +Y  + S G  P  VTY  ++++  +     +A    SEM   G    +  YS+++ 
Sbjct  460  ALRLYRDMKSSGRNPDAVTYTVLIDLLGKASKIEEASKVMSEMLDAGVKPTLHTYSALIC  519

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K GR  EA     +M+E G + +   Y+ +LD   R + +K+   +++EM      P
Sbjct  520  AYAKVGRRVEAEETFNRMRESGIKADHLAYSVMLDFFLRFNEIKKAAALYQEMIEAGFTP  579

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            D   Y  ++ A  +    +   +  QD K  G      ++ ++V
Sbjct  580  DTGLYEVMLPALVRENMGDVIERVVQDTKELGSMNPHDISSVLV  623


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/164 (23%), Positives = 80/164 (49%), Gaps = 0/164 (0%)
 Frame = +2

Query  29    VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
             VY  + + G  P    Y  ++ + CR        +  SEM + GF   +  ++S++ +Y 
Sbjct  916   VYNGMKAAGYFPTMHLYRLMIGLLCRFKRVRDVRVMLSEMGEAGFKPDLQIFNSVLKLYS  975

Query  209   KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
                  +    +   +++ G  P+   YNTL+ ++ R    ++   +  +MK   + P R 
Sbjct  976   SIEEFQNMGVIYQMIQDAGLAPDEETYNTLITMYCRDHRPEEGLSLMHKMKSLGLEPKRD  1035

Query  389   SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF  520
             +Y S+I+A+SK +  +   + +++ + NG K DR+   +M+ ++
Sbjct  1036  TYRSMIAAFSKQQLYDQAEELFEELRSNGYKLDRSFYHLMMKMY  1079


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/179 (23%), Positives = 85/179 (47%), Gaps = 10/179 (6%)
 Frame = +2

Query  107  IGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            + +++KAE   ++  Q         Y++M+ +Y + G  ++   +   M+ERGCEP++  
Sbjct  250  VEIFAKAESVIADTVQ--------VYNAMMGVYARNGNFEKVNEMFNLMRERGCEPDIVS  301

Query  287  YNTLLD--IHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQD  460
            +NTL++  +   A+      ++  E+ +  + PD ++Y ++ISA S+   L+  +  +  
Sbjct  302  FNTLINAKVKSCATVSGLAIELLDEVGKFGLRPDIITYNTLISACSRESNLKEAIGVFSH  361

Query  461  FKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  637
             + N  + D      M+ V+ +     +   L + LK++    D   Y S L A    G
Sbjct  362  MESNRCQPDLWTYNAMISVYGRCGFALKAEHLFEKLKSNGFSPDAVTYNSLLYAFSKEG  420


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 87/190 (46%), Gaps = 0/190 (0%)
 Frame = +2

Query  53    GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
             G +P    + S+L +Y  I  +    + +  ++  G       Y++++ MY +  R +E 
Sbjct  959   GFKPDLQIFNSVLKLYSSIEEFQNMGVIYQMIQDAGLAPDEETYNTLITMYCRDHRPEEG  1018

Query  233   TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
               L+ KMK  G EP    Y +++    +     Q E++++E++      DR  Y  ++  
Sbjct  1019  LSLMHKMKSLGLEPKRDTYRSMIAAFSKQQLYDQAEELFEELRSNGYKLDRSFYHLMMKM  1078

Query  413   YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
             Y  + + +      +  K  G + + A   +++  + K  + +E  ++L++L+T    LD
Sbjct  1079  YRTSGDHQKAENLLEIMKEAGIEPNTATMHLLMVSYGKSGQPEEADRILKNLRTMGAVLD  1138

Query  593   ERLYRSALNA  622
                Y S ++A
Sbjct  1139  TLPYSSVIDA  1148


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/208 (21%), Positives = 89/208 (43%), Gaps = 8/208 (4%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKG--FDKCIVAYSS  190
            +A+ ++  +   G EP +  Y S++++YCRIG    A+      E+     D   V    
Sbjct  735  IASQLFSDMRFNGVEPSECLYQSMVSVYCRIGFPETAQHLLYHAEKNDIILDNVTVHIID  794

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  YGK    + A  +V  +++R  + +  ++N L+  +  +   ++   ++  M R  
Sbjct  795  IIETYGKLKMWQSAESIVENLRQRCSKMDRKVWNALIHAYAFSGCYERARAIFNTMMREG  854

Query  371  VVPDRVSYTSVISAY---SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
              P   S   ++ A     +  EL   ++  QD  L   K  ++   +M+  F++   + 
Sbjct  855  PSPTVESVNGLLQALIVDGRLSELYVVIQELQDMDL---KISKSSILLMLEAFAQAGNLF  911

Query  542  ELVKLLQDLKTDETKLDERLYRSALNAL  625
            E+ K+   +K         LYR  +  L
Sbjct  912  EVQKVYNGMKAAGYFPTMHLYRLMIGLL  939



>emb|CDP11249.1| unnamed protein product [Coffea canephora]
Length=596

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 113/208 (54%), Gaps = 0/208 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ S+ C+P   TY +++N + R G+  KAE  F  +++ G +  + AY++++
Sbjct  298  MALKVFHEMRSKRCKPNICTYTALVNAFARDGLCEKAEEIFELLQEAGHEPDVYAYNALM  357

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + MK  GCEP+   YN ++D +GRA  ++  E V+++MK+  + 
Sbjct  358  EAYSRAGFPSGAAEIFSLMKHMGCEPDRASYNIMVDAYGRAGLLEDAEAVFEQMKQLGMS  417

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYS+   ++ C +   + + +G K D  +   M+ ++ ++ + +++ ++
Sbjct  418  PTMKSHMLLLSAYSRTSNVQKCEEILNEMQKSGLKPDTFVLNSMLNLYGRLGQFEKMEEV  477

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L+ +K      D   Y   +N    AG 
Sbjct  478  LEAMKNGPYAADVSTYNILINIYGRAGF  505


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 102/190 (54%), Gaps = 0/190 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E++   G  P   ++  +L+ Y R     K E   +EM++ G        +SM+N
Sbjct  404  AEAVFEQMKQLGMSPTMKSHMLLLSAYSRTSNVQKCEEILNEMQKSGLKPDTFVLNSMLN  463

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG+ G+ ++   ++  MK      +V  YN L++I+GRA   +++E+++  +  +K+ P
Sbjct  464  LYGRLGQFEKMEEVLEAMKNGPYAADVSTYNILINIYGRAGFFEKMEEIFLSLPAKKLKP  523

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++TS + AYS+ K  + C++ +++   NG   D   A +++   S  ++++++  ++
Sbjct  524  DVVTWTSRLGAYSRKKLYKKCLEIFEEMIDNGCYPDAGTAKVLLSSCSSEDQIEQVTHVI  583

Query  560  QDLKTDETKL  589
              +   E  L
Sbjct  584  TTIHKGERPL  593


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/206 (25%), Positives = 99/206 (48%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +  P+ A  +++++    C+P   TY  ++N+Y +      A   F EM  K     I  
Sbjct  259  RNAPK-ALEIFQRMERDHCQPSTDTYTMLINLYGKDHKSYMALKVFHEMRSKRCKPNICT  317

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y+++VN + + G  ++A  +   ++E G EP+V+ YN L++ + RA       +++  MK
Sbjct  318  YTALVNAFARDGLCEKAEEIFELLQEAGHEPDVYAYNALMEAYSRAGFPSGAAEIFSLMK  377

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
                 PDR SY  ++ AY +A  LE     ++  K  G         +++  +S+ + V 
Sbjct  378  HMGCEPDRASYNIMVDAYGRAGLLEDAEAVFEQMKQLGMSPTMKSHMLLLSAYSRTSNVQ  437

Query  542  ELVKLLQDLKTDETKLDERLYRSALN  619
            +  ++L +++    K D  +  S LN
Sbjct  438  KCEEILNEMQKSGLKPDTFVLNSMLN  463


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/219 (23%), Positives = 96/219 (44%), Gaps = 35/219 (16%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS---  190
            A ++Y +L+   C P + TYA +   YC  G   KAE  F+EM Q G     V Y++   
Sbjct  194  AESIYVELLEAHCIPTEDTYALLTKAYCTSGQLEKAEAIFTEMRQHGLPPSTVVYNAYID  253

Query  191  --------------------------------MVNMYGKTGRHKEATRLVAKMKERGCEP  274
                                            ++N+YGK  +   A ++  +M+ + C+P
Sbjct  254  GLMKLRNAPKALEIFQRMERDHCQPSTDTYTMLINLYGKDHKSYMALKVFHEMRSKRCKP  313

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
            N+  Y  L++   R    ++ E++++ ++     PD  +Y +++ AYS+A       + +
Sbjct  314  NICTYTALVNAFARDGLCEKAEEIFELLQEAGHEPDVYAYNALMEAYSRAGFPSGAAEIF  373

Query  455  QDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               K  G + DRA   IMV  + +   +++   + + +K
Sbjct  374  SLMKHMGCEPDRASYNIMVDAYGRAGLLEDAEAVFEQMK  412


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 96/201 (48%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E L   G EP    Y +++  Y R G  S A   FS M+  G +    +Y+ MV+
Sbjct  334  AEEIFELLQEAGHEPDVYAYNALMEAYSRAGFPSGAAEIFSLMKHMGCEPDRASYNIMVD  393

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G  ++A  +  +MK+ G  P +  +  LL  + R SN+++ E++  EM++  + P
Sbjct  394  AYGRAGLLEDAEAVFEQMKQLGMSPTMKSHMLLLSAYSRTSNVQKCEEILNEMQKSGLKP  453

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  + E   +  +  K      D +   I++ ++ +    +++ ++ 
Sbjct  454  DTFVLNSMLNLYGRLGQFEKMEEVLEAMKNGPYAADVSTYNILINIYGRAGFFEKMEEIF  513

Query  560  QDLKTDETKLDERLYRSALNA  622
              L   + K D   + S L A
Sbjct  514  LSLPAKKLKPDVVTWTSRLGA  534


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/163 (18%), Positives = 74/163 (45%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  QKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK  331
            +  F   I+ Y+ +++ YG+    K+A  +  ++ E  C P    Y  L   +  +  ++
Sbjct  168  RSSFQPDIICYNLLIDAYGQKSLIKKAESIYVELLEAHCIPTEDTYALLTKAYCTSGQLE  227

Query  332  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            + E ++ EM++  + P  V Y + I    K +     ++ +Q  + +  +       +++
Sbjct  228  KAEAIFTEMRQHGLPPSTVVYNAYIDGLMKLRNAPKALEIFQRMERDHCQPSTDTYTMLI  287

Query  512  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             ++ K +K    +K+  ++++   K +   Y + +NA    GL
Sbjct  288  NLYGKDHKSYMALKVFHEMRSKRCKPNICTYTALVNAFARDGL  330



>gb|EAZ21897.1| hypothetical protein OsJ_05550 [Oryza sativa Japonica Group]
Length=595

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 111/209 (53%), Gaps = 1/209 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  +  V+ ++ S GC+P   TY +++N + R G+  KAE  F EM+Q G +  + AY++
Sbjct  296  PMSSMKVFNEMKSIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNA  355

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y + G  + A+ + + M+  GCEP+   YN L+D +GRA   +  E V++E+K+R 
Sbjct  356  LMEAYSRAGLPQGASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRG  415

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P   S+  +++A++++     C +       +G   D      M+  +++  ++D++ 
Sbjct  416  MSPTMKSHMLLLAAHARSGNATRCEEVMAQLHKSGLTPDTFALNAMLNAYARAGRLDDME  475

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAG  637
            +L   ++      D   Y  A+NA   AG
Sbjct  476  RLFAAMER-RGDADVGTYNVAVNAYGRAG  503


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 99/225 (44%), Gaps = 35/225 (16%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KR    A ++Y  L+   C P + TYA +L  YC  G   +AE   SEM + G       
Sbjct  188  KRQLNKAESIYMALLEAQCVPTEDTYALLLRAYCNAGSLHRAEGVISEMREHGIPPNATV  247

Query  182  YSS-----------------------------------MVNMYGKTGRHKEATRLVAKMK  256
            Y++                                   M+N+YGK  +   + ++  +MK
Sbjct  248  YNAYLDGLLKARCTEKAVEVYQRMKRERCRANTETFTLMINVYGKAKQPMSSMKVFNEMK  307

Query  257  ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
              GC+PN+  Y  L++   R    ++ E+V++EM++    PD  +Y +++ AYS+A   +
Sbjct  308  SIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQ  367

Query  437  SCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               + +   +  G + DRA   I+V  + +    ++   + ++LK
Sbjct  368  GASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELK  412


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 94/206 (46%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  VY+++  + C     T+  ++N+Y +      +   F+EM+  G    I  Y+++VN
Sbjct  264  AVEVYQRMKRERCRANTETFTLMINVYGKAKQPMSSMKVFNEMKSIGCKPNICTYTALVN  323

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M++ G EP+V+ YN L++ + RA   +   +++  M+     P
Sbjct  324  AFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMQHMGCEP  383

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A   E     +++ K  G         +++   ++        +++
Sbjct  384  DRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHMLLLAAHARSGNATRCEEVM  443

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              L       D     + LNA   AG
Sbjct  444  AQLHKSGLTPDTFALNAMLNAYARAG  469


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/221 (23%), Positives = 102/221 (46%), Gaps = 36/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCI-----  175
            P+ A+ ++  +   GCEP + +Y  +++ Y R G++  AE  F E++Q+G    +     
Sbjct  366  PQGASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHML  425

Query  176  ------------------------------VAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                                           A ++M+N Y + GR  +  RL A M+ RG
Sbjct  426  LLAAHARSGNATRCEEVMAQLHKSGLTPDTFALNAMLNAYARAGRLDDMERLFAAMERRG  485

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
             + +V  YN  ++ +GRA  + ++E  +  +  R +  D V++T+ + AY++ KE   CV
Sbjct  486  -DADVGTYNVAVNAYGRAGYVGRMEAAFAAVAARGLAADVVTWTARMGAYARRKEYGRCV  544

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
               ++    G   D   A +++   S   +V+++  +++ +
Sbjct  545  GMVEEMVDAGCYPDAGTARVLLAACSDERQVEQVTAIVRSM  585


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 72/163 (44%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  QKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK  331
            +  F   I+ Y+ ++  YGK  +  +A  +   + E  C P    Y  LL  +  A ++ 
Sbjct  168  RSSFRPDIICYNLLIESYGKKRQLNKAESIYMALLEAQCVPTEDTYALLLRAYCNAGSLH  227

Query  332  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            + E V  EM+   + P+   Y + +    KA+  E  V+ YQ  K    + +     +M+
Sbjct  228  RAEGVISEMREHGIPPNATVYNAYLDGLLKARCTEKAVEVYQRMKRERCRANTETFTLMI  287

Query  512  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             V+ K  +    +K+  ++K+   K +   Y + +NA    GL
Sbjct  288  NVYGKAKQPMSSMKVFNEMKSIGCKPNICTYTALVNAFAREGL  330



>gb|AHC02085.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
chamaedryfolia]
Length=408

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  102  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  158

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  159  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  218

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  219  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  278

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  279  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  139  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  198

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  199  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  258

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  259  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  318

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  319  HELKSPD------------NIPRDTAIHILA  337


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/204 (20%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  
Sbjct  2    LFDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSR  61

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  
Sbjct  62   KLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTA  121

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SY+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   +
Sbjct  122  SYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGM  181

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +    + +   Y + L    DA L
Sbjct  182  RKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  226  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  285

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  286  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  341

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FS+  K   +V++   ++      D  +   
Sbjct  342  IEEATYVFRQAIDAGEVKDITVFERMIHLFSRYKKYANVVEVFDKMRGLGYFPDSNVIAL  401

Query  611  ALNA  622
             LNA
Sbjct  402  VLNA  405



>gb|AHC02103.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
scorodonioides]
Length=393

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  56   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  112

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  113  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  172

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  173  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  232

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  233  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  271


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  93   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  152

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  153  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  212

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  213  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  272

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  273  HELKSPD------------NIPRDTAIHILA  291


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  180  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  239

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  240  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  295

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  296  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  355

Query  611  ALNA  622
             LNA
Sbjct  356  VLNA  359


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  198  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  257

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  258  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  317

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  318  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  377



>ref|XP_002528160.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF34211.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=569

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 116/220 (53%), Gaps = 0/220 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  ++ ++ SQ C+P   TY +++N + R G+  KAE  F ++++ G +  + AY++++
Sbjct  271  MALKLFNEMRSQKCKPNICTYTALVNAFAREGLCEKAEEIFEQLQEDGHEPDVYAYNALM  330

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN ++D +GR    +  + V++EMKR  + 
Sbjct  331  EAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRGGLHEDAQAVFEEMKRLGIT  390

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYSKA ++  C     +   +G + D  +   M+ ++ ++ +  ++ ++
Sbjct  391  PTMKSHMLLLSAYSKAGDVAKCEDIVNELHESGLEPDTFVLNSMLNLYGRLGQFGKMEEV  450

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            L  +++     D   Y   +N    AG   + + L +S A
Sbjct  451  LTAMESGPYATDISTYNILINIYGRAGFFEKMEGLFQSLA  490


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 108/217 (50%), Gaps = 6/217 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            ++A T Y +L+   C P + TYA +L  YC  G+  KAE  F+EM + G     + Y++ 
Sbjct  165  KMAETTYFELIEARCIPTEDTYALLLKAYCTSGLLEKAEAIFAEMRKYGLPPSAIVYNAY  224

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            ++   K G  + A  +  +MK   C+P+   Y  L+++HG+AS      K++ EM+ +K 
Sbjct  225  IDGLMKAGNPQRAVEIFQRMKRDCCQPSTETYTLLINLHGKASQSYMALKLFNEMRSQKC  284

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDE  544
             P+  +YT++++A+++    E   + ++  + +G + D      ++  +S+        E
Sbjct  285  KPNICTYTALVNAFAREGLCEKAEEIFEQLQEDGHEPDVYAYNALMEAYSRAGFPYGAAE  344

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            +  L+Q +  +    D   Y   ++A    GL   A+
Sbjct  345  IFSLMQHMGCEP---DRASYNIMVDAYGRGGLHEDAQ  378


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/229 (22%), Positives = 110/229 (48%), Gaps = 36/229 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G    + ++  
Sbjct  339  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRGGLHEDAQAVFEEMKRLGITPTMKSHML  398

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWI----------------------------  286
            +++ Y K G   +   +V ++ E G EP+ ++                            
Sbjct  399  LLSAYSKAGDVAKCEDIVNELHESGLEPDTFVLNSMLNLYGRLGQFGKMEEVLTAMESGP  458

Query  287  -------YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
                   YN L++I+GRA   +++E +++ +  + + PD V++TS + AYS+ K    C+
Sbjct  459  YATDISTYNILINIYGRAGFFEKMEGLFQSLAAKNLKPDVVTWTSRLGAYSRKKLYTKCL  518

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL-KTDETKL  589
            + +++    G   D   A +++   S  ++++++  +++ + K  ET L
Sbjct  519  EIFEEMIDAGCHPDGRTAKVLLSSCSSEDQIEQVTTVIRTMHKNMETVL  567


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/160 (19%), Positives = 74/160 (46%), Gaps = 0/160 (0%)
 Frame = +2

Query  161  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  340
            F   ++ ++ +++ YG+   +K A     ++ E  C P    Y  LL  +  +  +++ E
Sbjct  144  FQSDVMIFNLVIDAYGRKSLYKMAETTYFELIEARCIPTEDTYALLLKAYCTSGLLEKAE  203

Query  341  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF  520
             ++ EM++  + P  + Y + I    KA   +  V+ +Q  K +  +       +++ + 
Sbjct  204  AIFAEMRKYGLPPSAIVYNAYIDGLMKAGNPQRAVEIFQRMKRDCCQPSTETYTLLINLH  263

Query  521  SKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             K ++    +KL  ++++ + K +   Y + +NA    GL
Sbjct  264  GKASQSYMALKLFNEMRSQKCKPNICTYTALVNAFAREGL  303



>gb|AHC02088.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
dusenii]
Length=432

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  99   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  155

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  156  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  215

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  216  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  275

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  276  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  314


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  136  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  195

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  196  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  255

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  256  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  315

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  316  HELKSPD------------NIPRDTAIHILA  334


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/202 (20%), Positives = 98/202 (49%), Gaps = 0/202 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            +++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K 
Sbjct  1    DEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKL  60

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
              + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY
Sbjct  61   CDYSKAISIFSRLKRSGFTPDLVAYNAMINVXGKAKLFREARSLISEMRTAGVMPNTASY  120

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
            +++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++ 
Sbjct  121  STLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRK  180

Query  575  DETKLDERLYRSALNALRDAGL  640
               + +   Y + L    DA L
Sbjct  181  MGIEPNVVSYNTLLRVYGDAEL  202


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  223  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  282

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  283  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  338

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  339  IEEATYVFRQAIDAGEXKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  398

Query  611  ALNA  622
             LNA
Sbjct  399  VLNA  402


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  241  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  300

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  301  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEXKDITV  360

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  361  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  420



>gb|AHC02080.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
axillaris]
Length=393

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  56   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  112

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  113  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  172

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  173  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  232

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  233  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  271


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  93   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  152

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  153  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  212

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  213  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  272

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  273  HELKSPD------------NIPRDTAIHILA  291


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  180  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  239

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  240  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  295

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  296  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  355

Query  611  ALNA  622
             LNA
Sbjct  356  VLNA  359


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 76/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  198  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  257

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  258  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  317

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E ++    Y + +
Sbjct  318  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDNANGVYMEMQ  377



>gb|AHC02107.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
wrightii]
Length=430

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  102  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  158

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  159  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  218

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  219  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  278

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  279  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  139  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  198

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  199  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  258

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  259  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  318

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  319  HELKSPD------------NIPRDTAIHILA  337


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/204 (20%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  
Sbjct  2    LFDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSR  61

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  
Sbjct  62   KLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTA  121

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SY+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   +
Sbjct  122  SYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGM  181

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +    + +   Y + L    DA L
Sbjct  182  RKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  226  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  285

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  286  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  341

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  342  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  401

Query  611  ALNA  622
             LNA
Sbjct  402  VLNA  405


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  244  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  304  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  363

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  364  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  423



>gb|AHC02084.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
chamaedryfolia]
Length=433

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  103  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  159

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  160  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  219

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  220  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  279

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  280  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  318


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  140  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  199

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  200  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  259

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  260  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  319

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  320  HELKSPD------------NIPRDTAIHILA  338


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/204 (20%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  
Sbjct  3    LFDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSR  62

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  
Sbjct  63   KLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTA  122

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SY+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   +
Sbjct  123  SYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGM  182

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +    + +   Y + L    DA L
Sbjct  183  RKMGIEPNVVSYNTLLRVYGDAEL  206


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  227  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  286

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  287  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  342

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  343  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  402

Query  611  ALNA  622
             LNA
Sbjct  403  VLNA  406


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  245  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  304

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  305  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  364

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  365  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  424



>gb|AHC02096.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
lycioides]
Length=426

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  98   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  154

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  155  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  214

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  215  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  274

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  275  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  313


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  135  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  194

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  195  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  254

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  255  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  314

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  315  HELKSPD------------NIPRDTAIHILA  333


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 95/197 (48%), Gaps = 0/197 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +
Sbjct  5    RALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSK  64

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY+++++
Sbjct  65   AISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYSTLLT  124

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + 
Sbjct  125  MYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEP  184

Query  590  DERLYRSALNALRDAGL  640
            +   Y + L    DA L
Sbjct  185  NVVSYNTLLRVYGDAEL  201


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 84/184 (46%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  222  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  281

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  282  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  337

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
             E     ++     G   D  +   M+ +FSK  K   + ++   ++      D  +   
Sbjct  338  XEEATYVFRQAIDAGEVKDXTVFERMIHLFSKYKKYANVXEVFDKMRGLGYFPDSNVIAL  397

Query  611  ALNA  622
             LNA
Sbjct  398  VLNA  401


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 69/150 (46%), Gaps = 0/150 (0%)
 Frame = +2

Query  143  EMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS  322
            EM Q+        YS+++  +GK G    A   + KM++     ++ +Y+ L+++  +  
Sbjct  1    EMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLC  60

Query  323  NMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAG  502
            +  +   ++  +KR    PD V+Y ++I+ + KAK          + +  G   + A   
Sbjct  61   DYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYS  120

Query  503  IMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
             ++ ++ +  K  E + +  +++  +  LD
Sbjct  121  TLLTMYVENKKFLEALSVFSEMREIKCLLD  150


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 74/180 (41%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  240  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  299

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               +  +
Sbjct  300  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRXEEATYVFRQAIDAGEVKDXTV  359

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  360  FERMIHLFSKYKKYANVXEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  419



>gb|AHC02100.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
pulchra]
Length=431

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  100  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  156

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  157  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  216

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  217  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  276

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  277  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  315


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  137  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  196

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  197  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  256

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  257  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  316

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  317  HELKSPD------------NIPRDTAIHILA  335


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/203 (20%), Positives = 99/203 (49%), Gaps = 0/203 (0%)
 Frame = +2

Query  32   YEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGK  211
            ++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K
Sbjct  1    FDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRK  60

Query  212  TGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVS  391
               + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  S
Sbjct  61   LCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTAS  120

Query  392  YTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
            Y+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++
Sbjct  121  YSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMR  180

Query  572  TDETKLDERLYRSALNALRDAGL  640
                + +   Y + L    DA L
Sbjct  181  KMGIEPNVVSYNTLLRVYGDAEL  203


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  224  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  283

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  284  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  339

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  340  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  399

Query  611  ALNA  622
             LNA
Sbjct  400  VLNA  403


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  242  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  301

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  302  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  361

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  362  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  421



>gb|AHC02091.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
gratissima]
Length=438

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  102  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  158

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  159  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  218

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  219  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  278

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  279  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 104/211 (49%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  139  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  198

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  199  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  258

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  259  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  318

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
              LK+ +            N  RD  + I A
Sbjct  319  HXLKSPD------------NIPRDTAIHILA  337


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/204 (20%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  
Sbjct  2    LFDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSR  61

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  
Sbjct  62   KLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTA  121

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SY+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   +
Sbjct  122  SYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGM  181

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +    + +   Y + L    DA L
Sbjct  182  RKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 85/184 (46%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  226  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  285

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++   +K     PD +   + I   + A  
Sbjct  286  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHXLKS----PDNIPRDTAIHILAGAGR  341

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  342  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  401

Query  611  ALNA  622
             LNA
Sbjct  402  VLNA  405


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 74/180 (41%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  244  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+  +K     P                               ++ +
Sbjct  304  AYERAGLVAHAKRLLHXLKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  363

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  364  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  423



>gb|AHC02097.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
macrostachya]
Length=420

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  82   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  138

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  139  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  198

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  199  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  258

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  259  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  297


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  119  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  178

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  179  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  238

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  239  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  298

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  299  HELKSPD------------NIPRDTAIHILA  317


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  206  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  265

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  266  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  321

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  322  IEEATYXFRQAIDAGEVKDIXVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  381

Query  611  ALNA  622
             LNA
Sbjct  382  VLNA  385


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/177 (21%), Positives = 84/177 (47%), Gaps = 0/177 (0%)
 Frame = +2

Query  110  GVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIY  289
            G++  A     +MEQ      +V YS+++ +  K   + +A  + +++K  G  P++  Y
Sbjct  9    GLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAY  68

Query  290  NTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKL  469
            N ++++ G+A   ++   +  EM+   V+P+  SY+++++ Y + K+    +  + + + 
Sbjct  69   NAMINVFGKAKLFREARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMRE  128

Query  470  NGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
                 D     IM+ V+ ++    E  KL   ++    + +   Y + L    DA L
Sbjct  129  IKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  185


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  224  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  283

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  284  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYXFRQAIDAGEVKDIXV  343

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  344  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  403



>gb|EEC72578.1| hypothetical protein OsI_06020 [Oryza sativa Indica Group]
Length=738

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 112/209 (54%), Gaps = 1/209 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  +  V+ ++ S GC+P   TY +++N + R G+  KAE  F EM+Q G +  + AY++
Sbjct  439  PMSSMKVFNEMKSIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNA  498

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y + G  + A+ + + M+  GCEP+   YN L+D +GRA   +  E V++E+K+R 
Sbjct  499  LMEAYSRAGLPQGASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRG  558

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P   S+  +++A++++     C +       +G   D      M+  +++  ++D++ 
Sbjct  559  MSPTMKSHMLLLAAHARSGNATRCEEVMAQLHKSGLTPDTFALNAMLNAYARAGRLDDME  618

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAG  637
            +LL  ++      D   Y  A+NA   AG
Sbjct  619  RLLAAMER-RGDADVGTYNVAVNAYGRAG  646


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 99/225 (44%), Gaps = 35/225 (16%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KR    A ++Y  L+   C P + TYA +L  YC  G   +AE   SEM + G       
Sbjct  331  KRQLNKAESIYMALLEAQCVPTEDTYALLLRAYCNAGSLHRAEGVISEMREHGIPPNATV  390

Query  182  YSS-----------------------------------MVNMYGKTGRHKEATRLVAKMK  256
            Y++                                   M+N+YGK  +   + ++  +MK
Sbjct  391  YNAYLDGLLKARCTEKAVEVYQRMKRERCRANTETFTLMINVYGKAKQPMSSMKVFNEMK  450

Query  257  ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
              GC+PN+  Y  L++   R    ++ E+V++EM++    PD  +Y +++ AYS+A   +
Sbjct  451  SIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQ  510

Query  437  SCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               + +   +  G + DRA   I+V  + +    ++   + ++LK
Sbjct  511  GASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELK  555


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 94/206 (46%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  VY+++  + C     T+  ++N+Y +      +   F+EM+  G    I  Y+++VN
Sbjct  407  AVEVYQRMKRERCRANTETFTLMINVYGKAKQPMSSMKVFNEMKSIGCKPNICTYTALVN  466

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M++ G EP+V+ YN L++ + RA   +   +++  M+     P
Sbjct  467  AFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMQHMGCEP  526

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A   E     +++ K  G         +++   ++        +++
Sbjct  527  DRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHMLLLAAHARSGNATRCEEVM  586

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              L       D     + LNA   AG
Sbjct  587  AQLHKSGLTPDTFALNAMLNAYARAG  612


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/221 (23%), Positives = 103/221 (47%), Gaps = 36/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCI-----  175
            P+ A+ ++  +   GCEP + +Y  +++ Y R G++  AE  F E++Q+G    +     
Sbjct  509  PQGASEIFSLMQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHML  568

Query  176  ------------------------------VAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                                           A ++M+N Y + GR  +  RL+A M+ RG
Sbjct  569  LLAAHARSGNATRCEEVMAQLHKSGLTPDTFALNAMLNAYARAGRLDDMERLLAAMERRG  628

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
             + +V  YN  ++ +GRA  + ++E  +  +  R +  D V++T+ + AY++ KE   CV
Sbjct  629  -DADVGTYNVAVNAYGRAGYVGRMEAAFAAVAARGLAADVVTWTARMGAYARRKEYGRCV  687

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
               ++    G   D   A +++   S   +V+++  +++ +
Sbjct  688  GMVEEMVDAGCYPDAGTARVLLAACSDERQVEQVTAIVRSM  728


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 72/163 (44%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  QKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK  331
            +  F   I+ Y+ ++  YGK  +  +A  +   + E  C P    Y  LL  +  A ++ 
Sbjct  311  RSSFRPDIICYNLLIESYGKKRQLNKAESIYMALLEAQCVPTEDTYALLLRAYCNAGSLH  370

Query  332  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            + E V  EM+   + P+   Y + +    KA+  E  V+ YQ  K    + +     +M+
Sbjct  371  RAEGVISEMREHGIPPNATVYNAYLDGLLKARCTEKAVEVYQRMKRERCRANTETFTLMI  430

Query  512  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             V+ K  +    +K+  ++K+   K +   Y + +NA    GL
Sbjct  431  NVYGKAKQPMSSMKVFNEMKSIGCKPNICTYTALVNAFAREGL  473



>gb|AHC02106.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
wrightii]
Length=440

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  102  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  158

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  159  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  218

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  219  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  278

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  279  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  139  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  198

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  199  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  258

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  259  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  318

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  319  HELKSPD------------NIPRDTAIHILA  337


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/204 (20%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  
Sbjct  2    LFDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSR  61

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  
Sbjct  62   KLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTA  121

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SY+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   +
Sbjct  122  SYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGM  181

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +    + +   Y + L    DA L
Sbjct  182  RKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  226  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  285

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  286  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  341

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  342  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  401

Query  611  ALNA  622
             LNA
Sbjct  402  VLNA  405


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  244  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  304  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  363

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  364  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  423



>gb|AFV61114.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
lycioides]
Length=429

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  98   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  154

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  155  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  214

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  215  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  274

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  275  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  313


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  135  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  194

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  195  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  254

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  255  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  314

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  315  HELKSPD------------NIPRDTAIHILA  333


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 95/197 (48%), Gaps = 0/197 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +
Sbjct  5    RALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSK  64

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY+++++
Sbjct  65   AISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYSTLLT  124

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + 
Sbjct  125  MYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEP  184

Query  590  DERLYRSALNALRDAGL  640
            +   Y + L    DA L
Sbjct  185  NVVSYNTLLRVYGDAEL  201


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  222  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  281

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  282  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  337

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  338  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  397

Query  611  ALNA  622
             LNA
Sbjct  398  VLNA  401


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  240  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  299

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  300  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  359

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  360  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  419


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 69/150 (46%), Gaps = 0/150 (0%)
 Frame = +2

Query  143  EMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS  322
            EM Q+        YS+++  +GK G    A   + KM++     ++ +Y+ L+++  +  
Sbjct  1    EMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLC  60

Query  323  NMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAG  502
            +  +   ++  +KR    PD V+Y ++I+ + KAK          + +  G   + A   
Sbjct  61   DYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYS  120

Query  503  IMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
             ++ ++ +  K  E + +  +++  +  LD
Sbjct  121  TLLTMYVENKKFLEALSVFSEMREIKCLLD  150



>gb|ACU25763.1| pentatricopeptide repeat-containing protein [Aloysia virgata]
Length=426

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  96   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  152

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  153  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  212

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  213  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  272

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  273  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  311


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  133  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  192

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  193  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  252

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  253  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  312

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  313  HELKSPD------------NIPRDTAIHILA  331


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 95/197 (48%), Gaps = 0/197 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +
Sbjct  3    RALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSK  62

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY+++++
Sbjct  63   AISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYSTLLT  122

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + 
Sbjct  123  MYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEP  182

Query  590  DERLYRSALNALRDAGL  640
            +   Y + L    DA L
Sbjct  183  NVVSYNTLLRVYGDAEL  199


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  220  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  279

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  280  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  335

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   L+++   ++      D  +   
Sbjct  336  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANLIEVFDKMRGLGYFPDSNVIAL  395

Query  611  ALNA  622
             LNA
Sbjct  396  VLNA  399


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/180 (18%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  238  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  297

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  298  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  357

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      + +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  358  FERMIHLFSKYKKYANLIEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  417



>ref|XP_010252754.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Nelumbo nucifera]
 ref|XP_010252755.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Nelumbo nucifera]
Length=715

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 102/191 (53%), Gaps = 0/191 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A   +EK+   GC P  VTYA++++ Y R G    A   +     + +   +V +S+
Sbjct  242  PNKAVEWFEKMPQFGCNPDDVTYAAMIDAYGRAGNIDMALSLYDRARTEKWRIDLVTFST  301

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++ +YG +G    A  +  +MK  G +PN+ IYNTLLD  GRA    Q + ++KEM  + 
Sbjct  302  LIRIYGMSGNFDGALNVYEEMKALGVKPNLVIYNTLLDAMGRAKRPWQAKSLYKEMTTKG  361

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
              P+  +Y +++ AY +A+  E  +  Y++ K  G + +  +   ++ + + +   DE V
Sbjct  362  YSPNWTTYAALLRAYGRARYAEDALNVYREMKEKGLELNVVLYNTLLAMCADLGYTDEAV  421

Query  551  KLLQDLKTDET  583
            ++ +DLK  +T
Sbjct  422  QIFEDLKRSQT  432


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 96/194 (49%), Gaps = 2/194 (1%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A ++Y+++ ++G  P   TYA++L  Y R      A   + EM++KG +  +V Y++
Sbjct  347  PWQAKSLYKEMTTKGYSPNWTTYAALLRAYGRARYAEDALNVYREMKEKGLELNVVLYNT  406

Query  191  MVNMYGKTGRHKEATRLVAKMK-ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRR  367
            ++ M    G   EA ++   +K  + CEP+ W +++L+ I+     + + E +  +M   
Sbjct  407  LLAMCADLGYTDEAVQIFEDLKRSQTCEPDSWTFSSLITIYSCCGKVSEAEGMLNKMLEA  466

Query  368  KVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDEL  547
               P+    TS+I  Y KA   +  V+ +      G   D    G ++ V ++  K +EL
Sbjct  467  GFEPNIYVLTSLIQCYGKANRTDDVVRTFDRLLEMGITPDDRFCGCLLNVMTQTPK-EEL  525

Query  548  VKLLQDLKTDETKL  589
             KL+  ++   +KL
Sbjct  526  GKLIGCIERANSKL  539


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/168 (20%), Positives = 77/168 (46%), Gaps = 0/168 (0%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            + Y   L ++ +   +++AE+   EM +KG     V +S++++         +A     K
Sbjct  192  ILYNVTLKVFRKSRNFNRAEVLLEEMLKKGIKPDNVTFSTIISCARICSLPNKAVEWFEK  251

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            M + GC P+   Y  ++D +GRA N+     ++   +  K   D V+++++I  Y  +  
Sbjct  252  MPQFGCNPDDVTYAAMIDAYGRAGNIDMALSLYDRARTEKWRIDLVTFSTLIRIYGMSGN  311

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
             +  +  Y++ K  G K +  +   ++    +  +  +   L +++ T
Sbjct  312  FDGALNVYEEMKALGVKPNLVIYNTLLDAMGRAKRPWQAKSLYKEMTT  359



>gb|AHC02105.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
scorodonioides]
Length=433

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  99   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  155

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  156  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  215

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  216  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  275

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  276  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  314


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  136  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  195

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  196  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  255

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  256  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  315

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  316  HELKSPD------------NIPRDTAIHILA  334


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 97/202 (48%), Gaps = 0/202 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            +++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K 
Sbjct  1    DEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKL  60

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
              + +A  + +++K  G  P++  Y  ++++ G+A   ++   +  EM+   V+P+  SY
Sbjct  61   CDYSKAISIFSRLKRSGFTPDLVAYXAMINVFGKAKLFREARSLISEMRTAGVMPNTASY  120

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
            +++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++ 
Sbjct  121  STLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRK  180

Query  575  DETKLDERLYRSALNALRDAGL  640
               + +   Y + L    DA L
Sbjct  181  MGIEPNVVSYNTLLRVYGDAEL  202


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  223  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  282

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  283  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  338

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  339  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  398

Query  611  ALNA  622
             LNA
Sbjct  399  VLNA  402


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  241  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  300

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  301  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  360

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  361  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDXANGVYMEMQ  420



>gb|AHC02087.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
dusenii]
Length=440

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  102  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  158

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  159  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  218

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  219  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  278

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  279  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  317


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  139  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  198

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  199  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  258

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  259  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  318

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  319  HELKSPD------------NIPRDTAIHILA  337


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/204 (20%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  
Sbjct  2    LFDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSR  61

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  
Sbjct  62   KLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVXGKAKLFREARSLISEMRTAGVMPNTA  121

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SY+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   +
Sbjct  122  SYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGM  181

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +    + +   Y + L    DA L
Sbjct  182  RKMGIEPNVVSYNTLLRVYGDAEL  205


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  226  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  285

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  286  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  341

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  342  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  401

Query  611  ALNA  622
             LNA
Sbjct  402  VLNA  405


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  244  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  304  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  363

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  364  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  423



>gb|AHC02092.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
pulchra]
Length=346

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  40   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  96

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  97   NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  156

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  157  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNIGIEPNSITYSTIISIWGKVGKLDR  216

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  217  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  255


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/211 (22%), Positives = 104/211 (49%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  77   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  136

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+   + P
Sbjct  137  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNIGIEP  196

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  197  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  256

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  257  HELKSPD------------NIPRDTAIHILA  275


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 84/184 (46%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+  G +   + YS++++++GK G+   A  L  K
Sbjct  164  VTYNSMMMIYGKTLEHEKANNLIQEMQNIGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  223

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  224  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  279

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   + ++   ++      D  +   
Sbjct  280  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVXEVFDKMRGLGYFPDSNVIAL  339

Query  611  ALNA  622
             LNA
Sbjct  340  VLNA  343


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  400
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY++
Sbjct  4    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYST  63

Query  401  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  580
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  64   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  123

Query  581  TKLDERLYRSALNALRDAGL  640
             + +   Y + L    DA L
Sbjct  124  IEPNVVSYNTLLRVYGDAEL  143



>gb|AHC02102.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
virgata]
Length=425

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 118/219 (54%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  90   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  146

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  147  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  206

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  207  KDIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  266

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  267  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  305


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  127  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  186

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  187  VYGDAELFGEAIHLFRLMQRKDIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  246

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  247  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  306

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  307  HELKSPD------------NIPRDTAIHILA  325


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/193 (21%), Positives = 94/193 (49%), Gaps = 0/193 (0%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +A  +
Sbjct  1    PDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSKAISI  60

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
             +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY+++++ Y +
Sbjct  61   FSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYSTLLTMYVE  120

Query  422  AKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERL  601
             K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + +   
Sbjct  121  NKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVS  180

Query  602  YRSALNALRDAGL  640
            Y + L    DA L
Sbjct  181  YNTLLRVYGDAEL  193


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  214  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  273

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  274  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  329

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  330  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  389

Query  611  ALNA  622
             LNA
Sbjct  390  VLNA  393


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  232  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  291

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  292  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  351

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  352  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  411



>ref|XP_010442157.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial-like [Camelina sativa]
Length=714

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 106/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T +++++S+G EP +VT+ S+++ +C+ G +  AE  F  ME++G   C   Y+ M+N
Sbjct  468  AMTTFDRMLSEGIEPDRVTWNSLIDCHCKHGRHIVAEEMFESMERRGCFPCATTYNIMIN  527

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG   R  +  RL+ KMK +G  PNV  + TL+D++G++       +  +EMK   + P
Sbjct  528  SYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECLEEMKSVGLKP  587

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++    +G K        ++  F +  +  E   +L
Sbjct  588  SSTMYNALINAYAQRGLSELAVNAFRVMTSDGLKPSLLALNSLINAFGEDRRDAEAFAVL  647

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  648  QYMKENGVKPDVVTYTTLMKAL  669


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 97/208 (47%), Gaps = 0/208 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            + G      T  SI++     G   +AE  F E+ Q G      AY++++  Y KTG  K
Sbjct  302  ATGLSAKTATLVSIISALANSGRTLEAEALFEELRQSGIKPRTKAYNALLKGYVKTGPLK  361

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M++RG  P+   Y+ L+D +  A   +    V KEM+   V P+   ++ ++
Sbjct  362  DAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLL  421

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETK  586
            + Y    E +   +  ++ K  G K DR    +++  F K N +D  +     + ++  +
Sbjct  422  AGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIE  481

Query  587  LDERLYRSALNALRDAGLEIRAKWLQES  670
             D   + S ++     G  I A+ + ES
Sbjct  482  PDRVTWNSLIDCHCKHGRHIVAEEMFES  509


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 103/221 (47%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G +P +  Y  +++ + +      A  TF  M  +G +   V ++S+++ + 
Sbjct  436  VLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNSLIDCHC  495

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH  A  +   M+ RGC P    YN +++ +G       ++++  +MK + ++P+ V
Sbjct  496  KHGRHIVAEEMFESMERRGCFPCATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVV  555

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            ++T+++  Y K+      ++  ++ K  G K    M   ++  +++    +  V   + +
Sbjct  556  THTTLVDVYGKSGRFNDAIECLEEMKSVGLKPSSTMYNALINAYAQRGLSELAVNAFRVM  615

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
             +D  K       S +NA     RDA          E+FAV
Sbjct  616  TSDGLKPSLLALNSLINAFGEDRRDA----------EAFAV  646


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 75/157 (48%), Gaps = 0/157 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G +P    Y ++L  Y + G    AE   SEME++G       YS +++
Sbjct  328  AEALFEELRQSGIKPRTKAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLID  387

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ LL  +      ++  +V KEMK   V P
Sbjct  388  AYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKP  447

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDR  490
            DR  Y  VI  + K   L+  +  +      G + DR
Sbjct  448  DRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDR  484


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E++ S G +P    Y +++N Y + G+   A   F  M   G    ++A +S++N +G+ 
Sbjct  578  EEMKSVGLKPSSTMYNALINAYAQRGLSELAVNAFRVMTSDGLKPSLLALNSLINAFGED  637

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
             R  EA  ++  MKE G +P+V  Y TL+    R    ++V  V++EM      PDR + 
Sbjct  638  RRDAEAFAVLQYMKENGVKPDVVTYTTLMKALIRVDKFQKVPGVYEEMIMSGCKPDRKAR  697

Query  395  TSVISA  412
            + + SA
Sbjct  698  SMLRSA  703


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/192 (21%), Positives = 87/192 (45%), Gaps = 1/192 (1%)
 Frame = +2

Query  2    KRGP-RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIV  178
            K GP + A ++  ++  +G  P + TY+ +++ Y   G +  A +   EME         
Sbjct  356  KTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGDVQPNSF  415

Query  179  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  358
             +S ++  Y   G  ++  +++ +MK  G +P+   YN ++D  G+ + +      +  M
Sbjct  416  VFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRM  475

Query  359  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  538
                + PDRV++ S+I  + K        + ++  +  G         IM+  +    + 
Sbjct  476  LSEGIEPDRVTWNSLIDCHCKHGRHIVAEEMFESMERRGCFPCATTYNIMINSYGDQERW  535

Query  539  DELVKLLQDLKT  574
            D++ +LL  +K+
Sbjct  536  DDMKRLLGKMKS  547


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/207 (21%), Positives = 91/207 (44%), Gaps = 0/207 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ +L  Y   G + K      EM+  G       Y+ +++
Sbjct  398  ARIVLKEMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVID  457

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +N+L+D H +       E++++ M+RR   P
Sbjct  458  TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNSLIDCHCKHGRHIVAEEMFESMERRGCFP  517

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++Y   +  +   +     K  G   +      +V V+ K  + ++ ++ L
Sbjct  518  CATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECL  577

Query  560  QDLKTDETKLDERLYRSALNALRDAGL  640
            +++K+   K    +Y + +NA    GL
Sbjct  578  EEMKSVGLKPSSTMYNALINAYAQRGL  604


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 78/176 (44%), Gaps = 0/176 (0%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            + + G  S+A       +  G         S+++    +GR  EA  L  ++++ G +P 
Sbjct  284  FAKSGDPSRALQLLGMAQATGLSAKTATLVSIISALANSGRTLEAEALFEELRQSGIKPR  343

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               YN LL  + +   +K  E +  EM++R V PD  +Y+ +I AY  A   ES     +
Sbjct  344  TKAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLK  403

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            + +    + +  +   ++  +    +  +  ++L+++K+   K D + Y   ++  
Sbjct  404  EMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTF  459



>ref|XP_007213618.1| hypothetical protein PRUPE_ppa002169mg [Prunus persica]
 gb|EMJ14817.1| hypothetical protein PRUPE_ppa002169mg [Prunus persica]
Length=706

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 110/194 (57%), Gaps = 6/194 (3%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC---IVA  181
            P  A   +EK+ S GC P  VTY+++++ Y R G   K +M FS  ++    K     V 
Sbjct  232  PDKAVEWFEKMPSFGCNPDDVTYSAMIDAYGRSG---KVDMAFSLYDRARTSKWRIDPVT  288

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            +S+++ ++G++G       +  +MK  G +PN+ IYNTLLD  GRA    Q +K+++EM 
Sbjct  289  FSTLIKIHGQSGNFDGCLNVYEEMKAIGAKPNLVIYNTLLDAMGRAKRPWQAKKIYREMI  348

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
             ++  P+ V+Y +++ AY +A+  +  +  Y++ K  G + +  +   ++ + + +   D
Sbjct  349  NKEFSPNWVTYAALLRAYGRARYGDDALNVYREMKEKGMELNVILYNTLLAMCADVGYAD  408

Query  542  ELVKLLQDLKTDET  583
            E V++ +D+K+ ET
Sbjct  409  EAVEIFKDMKSSET  422


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 78/180 (43%), Gaps = 36/180 (20%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY--  184
            P  A  +Y +++++   P  VTYA++L  Y R      A   + EM++KG +  ++ Y  
Sbjct  337  PWQAKKIYREMINKEFSPNWVTYAALLRAYGRARYGDDALNVYREMKEKGMELNVILYNT  396

Query  185  ----------------------------------SSMVNMYGKTGRHKEATRLVAKMKER  262
                                              SSM+ +Y  +G+  EA  ++ +M E 
Sbjct  397  LLAMCADVGYADEAVEIFKDMKSSETWKPDSWTFSSMITIYSCSGKVTEAETMLNEMLEA  456

Query  263  GCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESC  442
            G +PN++I  +L+  +G+A     V +++ ++    + PD      +++  ++  + E C
Sbjct  457  GFQPNIFILTSLIQCYGKAKRTDDVVRIFNQLLELGITPDERFCGCLLNVMTQTPKEELC  516


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 80/175 (46%), Gaps = 1/175 (1%)
 Frame = +2

Query  101  CRIGV-YSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            CR G    +AE  F E+ ++G     V +S+M++    +    +A     KM   GC P+
Sbjct  191  CRKGKDLDRAEKLFDELLKRGVQPDNVTFSTMISCARMSSLPDKAVEWFEKMPSFGCNPD  250

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               Y+ ++D +GR+  +     ++   +  K   D V+++++I  + ++   + C+  Y+
Sbjct  251  DVTYSAMIDAYGRSGKVDMAFSLYDRARTSKWRIDPVTFSTLIKIHGQSGNFDGCLNVYE  310

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  622
            + K  G K +  +   ++    +  +  +  K+ +++   E   +   Y + L A
Sbjct  311  EMKAIGAKPNLVIYNTLLDAMGRAKRPWQAKKIYREMINKEFSPNWVTYAALLRA  365



>ref|XP_008224621.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic [Prunus mume]
Length=706

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 110/194 (57%), Gaps = 6/194 (3%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC---IVA  181
            P  A   +EK+ S GC P  VTY+++++ Y R G   K +M FS  ++    K     V 
Sbjct  232  PDKAVEWFEKMPSFGCNPDDVTYSAMIDAYGRSG---KVDMAFSLYDRARTSKWRIDPVT  288

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            +S+++ ++G++G       +  +MK  G +PN+ IYNTLLD  GRA    Q +K+++EM 
Sbjct  289  FSTLIKIHGQSGNFDGCLNVYEEMKAIGAKPNLVIYNTLLDAMGRAKRPWQAKKIYREMI  348

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
             ++  P+ V+Y +++ AY +A+  +  +  Y++ K  G + +  +   ++ + + +   D
Sbjct  349  NKEFSPNWVTYAALLRAYGRARYGDDALNIYREMKEKGMELNVILYNTLLAMCADVGYAD  408

Query  542  ELVKLLQDLKTDET  583
            E V++ +D+K+ ET
Sbjct  409  EAVEIFKDMKSSET  422


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 78/180 (43%), Gaps = 36/180 (20%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY--  184
            P  A  +Y +++++   P  VTYA++L  Y R      A   + EM++KG +  ++ Y  
Sbjct  337  PWQAKKIYREMINKEFSPNWVTYAALLRAYGRARYGDDALNIYREMKEKGMELNVILYNT  396

Query  185  ----------------------------------SSMVNMYGKTGRHKEATRLVAKMKER  262
                                              SSM+ +Y  +G+  EA  ++ +M E 
Sbjct  397  LLAMCADVGYADEAVEIFKDMKSSETWKPDSWTFSSMITIYSCSGKVTEAETMLNEMLEA  456

Query  263  GCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESC  442
            G +PN++I  +L+  +G+A     V +++ ++    + PD      +++  ++  + E C
Sbjct  457  GFQPNIFILTSLIQCYGKAKRTDDVVRIFNQLLELGITPDERFCGCLLNVMTQTPKEELC  516


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/167 (19%), Positives = 77/167 (46%), Gaps = 0/167 (0%)
 Frame = +2

Query  122  KAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLL  301
            +AE  F E+ ++G     V +S+M++    +    +A     KM   GC P+   Y+ ++
Sbjct  199  RAEKLFDELLERGVQPDNVTFSTMISCARMSSLPDKAVEWFEKMPSFGCNPDDVTYSAMI  258

Query  302  DIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGK  481
            D +GR+  +     ++   +  K   D V+++++I  + ++   + C+  Y++ K  G K
Sbjct  259  DAYGRSGKVDMAFSLYDRARTSKWRIDPVTFSTLIKIHGQSGNFDGCLNVYEEMKAIGAK  318

Query  482  TDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNA  622
             +  +   ++    +  +  +  K+ +++   E   +   Y + L A
Sbjct  319  PNLVIYNTLLDAMGRAKRPWQAKKIYREMINKEFSPNWVTYAALLRA  365



>gb|AHC02094.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
hatschbachii]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM      KC++  ++ 
Sbjct  57   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMRDI---KCLLDLTTC  113

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  114  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  173

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  174  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  233

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  234  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  272


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  94   ALSVFSEMRDIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  153

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  154  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  213

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  214  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  273

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  274  HELKSPD------------NIPRDTAIHILA  292


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  181  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  240

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  241  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  296

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  297  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  356

Query  611  ALNA  622
             LNA
Sbjct  357  VLNA  360


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EM+   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMRDIKCLLDLTTCNIMIDVYGQLG  124

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  199  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  258

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  259  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  318

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  319  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  378



>ref|XP_008459028.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X1 [Cucumis melo]
Length=576

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 107/209 (51%), Gaps = 0/209 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
             +A  +++++ +Q C+P   T+ +++N   R G+  KAE  F +M++ G++  + AY+++
Sbjct  277  HMAMNIFDEMRTQRCKPNICTFTALVNALAREGLCEKAEEIFEQMQEAGYEPDVYAYNAL  336

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            +  Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++EMKR  +
Sbjct  337  MESYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEEMKRIGI  396

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
             P   S+  ++SAYSKA     C         +G K D  +   M+ ++ ++ +  ++  
Sbjct  397  TPTMKSHMLLLSAYSKAGNAAKCEDIIGQMHKSGLKPDTFVMNSMLNLYGRLGQFGKMED  456

Query  554  LLQDLKTDETKLDERLYRSALNALRDAGL  640
            L   ++    + D   Y   +N    AG 
Sbjct  457  LFSTMQKGPCRADISTYNILINVYGRAGF  485


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/224 (23%), Positives = 110/224 (49%), Gaps = 35/224 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P  AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G          
Sbjct  346  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEEMKRIGITPTMKSHML  405

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             + AYS                            SM+N+YG+ G+  +   L + M++  
Sbjct  406  LLSAYSKAGNAAKCEDIIGQMHKSGLKPDTFVMNSMLNLYGRLGQFGKMEDLFSTMQKGP  465

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C  ++  YN L++++GRA  ++++E++++ +  + + PD V++TS I AYS+ K  + C+
Sbjct  466  CRADISTYNILINVYGRAGFVERMEELFQLLPAKNLEPDVVTWTSRIGAYSRKKLYKRCL  525

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTD  577
            + ++     G   D   A +++   S   +++++  +++ +  D
Sbjct  526  ELFEKMIDAGCYPDGGTAKVLLSACSSEEQIEQVTNVVRTMHKD  569


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/217 (24%), Positives = 106/217 (49%), Gaps = 6/217 (3%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMY  205
            + Y +L+   C P + TYA +L  YC+ G+  KAE  F+EM + G     + Y++ ++  
Sbjct  176  STYLELLESHCIPTEDTYALLLKAYCKSGLLEKAEAVFAEMRKYGLSPSAIVYNAYIDGL  235

Query  206  GKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             K G + +A  +  +MK  GC+P    Y  L++++G+ S       ++ EM+ ++  P+ 
Sbjct  236  VKGGNNVKAVEIFQRMKRDGCQPATDTYTMLINVYGKESKSHMAMNIFDEMRTQRCKPNI  295

Query  386  VSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELVKL  556
             ++T++++A ++    E   + ++  +  G + D      ++  +S+        E+  L
Sbjct  296  CTFTALVNALAREGLCEKAEEIFEQMQEAGYEPDVYAYNALMESYSRAGFPYGAAEIFSL  355

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
            +Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  356  MQHMGCEP---DRASYNIMVDAYGRAGLHEDAQAVFE  389


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/201 (23%), Positives = 91/201 (45%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  314  AEEIFEQMQEAGYEPDVYAYNALMESYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVD  373

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H++A  +  +MK  G  P +  +  LL  + +A N  + E +  +M +  + P
Sbjct  374  AYGRAGLHEDAQAVFEEMKRIGITPTMKSHMLLLSAYSKAGNAAKCEDIIGQMHKSGLKP  433

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +       +   +    + D +   I++ V+ +   V+ + +L 
Sbjct  434  DTFVMNSMLNLYGRLGQFGKMEDLFSTMQKGPCRADISTYNILINVYGRAGFVERMEELF  493

Query  560  QDLKTDETKLDERLYRSALNA  622
            Q L     + D   + S + A
Sbjct  494  QLLPAKNLEPDVVTWTSRIGA  514


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 81/174 (47%), Gaps = 0/174 (0%)
 Frame = +2

Query  146  MEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASN  325
            + +  F   ++ Y+ +++ YG+   +K+      ++ E  C P    Y  LL  + ++  
Sbjct  146  LNKSTFRPDVIVYNLLMDAYGQRSLYKDVESTYLELLESHCIPTEDTYALLLKAYCKSGL  205

Query  326  MKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGI  505
            +++ E V+ EM++  + P  + Y + I    K       V+ +Q  K +G +       +
Sbjct  206  LEKAEAVFAEMRKYGLSPSAIVYNAYIDGLVKGGNNVKAVEIFQRMKRDGCQPATDTYTM  265

Query  506  MVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
            ++ V+ K +K    + +  +++T   K +   + + +NAL   GL  +A+ + E
Sbjct  266  LINVYGKESKSHMAMNIFDEMRTQRCKPNICTFTALVNALAREGLCEKAEEIFE  319



>gb|AHX42072.1| pentatricopeptide repeat-containing protein 11, partial [Musschia 
aurea]
Length=268

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/229 (27%), Positives = 113/229 (49%), Gaps = 6/229 (3%)
 Frame = +2

Query  5    RGPRVAA-TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            + P V A   Y +++  G  P   ++  ++N +C+ G    A + F EM + G    +V+
Sbjct  32   KSPAVVAWDFYLEILGCGYPPNLYSFNILMNKFCKEGKVKDAHLVFDEMSRSGLRPTVVS  91

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y++++N Y K G   E  RL   M+E    P+V+ Y++L++   +   M    KV+ EM 
Sbjct  92   YNTLINGYCKWGNSDEGFRLKKVMEESRLVPDVFTYSSLINGLCKGGRMDDANKVFDEMC  151

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
               +VP+ V YT++I+ + K  ++   ++ Y    + G K D  M   ++ V  K   ++
Sbjct  152  SNGLVPNDVIYTTLINGFCKDGKVSLAMELYGRMLMKGVKPDLIMYNTLINVICKSGNIN  211

Query  542  ELVKLLQDLKTDETKLDERLYRSALNAL-----RDAGLEIRAKWLQESF  673
            E  KL+ ++     K D+  Y + ++        DA LEIR + ++E  
Sbjct  212  EARKLIDEMSLKGLKADKVTYTTLIDGCCKEGDLDAALEIRKRMIREGI  260


 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 89/195 (46%), Gaps = 0/195 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++++   G  P  V+Y +++N YC+ G   +       ME+      +  YSS++N
Sbjct  73   AHLVFDEMSRSGLRPTVVSYNTLINGYCKWGNSDEGFRLKKVMEESRLVPDVFTYSSLIN  132

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K GR  +A ++  +M   G  PN  IY TL++   +   +    +++  M  + V P
Sbjct  133  GLCKGGRMDDANKVFDEMCSNGLVPNDVIYTTLINGFCKDGKVSLAMELYGRMLMKGVKP  192

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D + Y ++I+   K+  +    K   +  L G K D+     ++    K   +D  +++ 
Sbjct  193  DLIMYNTLINVICKSGNINEARKLIDEMSLKGLKADKVTYTTLIDGCCKEGDLDAALEIR  252

Query  560  QDLKTDETKLDERLY  604
            + +  +  +LD   Y
Sbjct  253  KRMIREGIELDNVAY  267


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++++ S G  P  V Y +++N +C+ G  S A   +  M  KG    ++ Y++++N
Sbjct  143  ANKVFDEMCSNGLVPNDVIYTTLINGFCKDGKVSLAMELYGRMLMKGVKPDLIMYNTLIN  202

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +  K+G   EA +L+ +M  +G + +   Y TL+D   +  ++    ++ K M R  +  
Sbjct  203  VICKSGNINEARKLIDEMSLKGLKADKVTYTTLIDGCCKEGDLDAALEIRKRMIREGIEL  262

Query  380  DRVSYT  397
            D V+YT
Sbjct  263  DNVAYT  268



>ref|XP_010648592.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X3 [Vitis vinifera]
Length=490

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 114/219 (52%), Gaps = 0/219 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ SQ C+P   T+ +++N + R G+  KAE  F ++++ G +  + AY++++
Sbjct  194  MALKVFHEMRSQKCKPNICTFTALVNAFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALM  253

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++ MKR  + 
Sbjct  254  EAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEVMKRLGIT  313

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYS+A ++  C +       +G K D  +   M+ ++ ++ + +++ ++
Sbjct  314  PTMKSHMLLLSAYSRAGKVAKCEEIVNQMHKSGIKPDTFVLNSMLNLYGRLGQFEKMEEV  373

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            L  ++      D   Y   +N    AG   R + L  S 
Sbjct  374  LTAMEKGPYPADISTYNILINIYGRAGFFARMEELFRSL  412


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 103/187 (55%), Gaps = 2/187 (1%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E +   G  P   ++  +L+ Y R G  +K E   ++M + G        +SM+N
Sbjct  300  AQAVFEVMKRLGITPTMKSHMLLLSAYSRAGKVAKCEEIVNQMHKSGIKPDTFVLNSMLN  359

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +YG+ G+ ++   ++  M E+G  P ++  YN L++I+GRA    ++E++++ +  R ++
Sbjct  360  LYGRLGQFEKMEEVLTAM-EKGPYPADISTYNILINIYGRAGFFARMEELFRSLPARNLI  418

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            PD V++TS I AYS+ K+   C++ +++    G   D   A +++   S  +++ E+  +
Sbjct  419  PDVVTWTSRIGAYSRRKQYNRCLEVFEEMIDAGCYPDGGTAKVLLSACSNGDQIQEVTTV  478

Query  557  LQDLKTD  577
            ++ +  D
Sbjct  479  IRTMHKD  485


 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 110/219 (50%), Gaps = 6/219 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y +L+   C P + TYA +L  YC  G+  KAE  F+EM + GF    V Y++ ++
Sbjct  90   AESTYLELLEARCVPTEDTYALLLKAYCTSGLLEKAEAVFAEMRKYGFPPSAVVYNAYID  149

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G  ++A  +  +MK   C+P+   Y  L++++G+AS      KV+ EM+ +K  P
Sbjct  150  GLMKGGDTQKAVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKP  209

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  ++T++++A+++    E   + ++  +  G + D      ++  +S+        E+ 
Sbjct  210  NICTFTALVNAFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIF  269

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
             L+Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  270  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQAVFE  305


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 94/200 (47%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++    C+P   TY  ++N+Y +      A   F EM  +     I  ++++VN
Sbjct  160  AVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKPNICTFTALVN  219

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +++E G EP+V+ YN L++ + RA       +++  M+     P
Sbjct  220  AFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMGCEP  279

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A   E     ++  K  G         +++  +S+  KV +  +++
Sbjct  280  DRASYNIMVDAYGRAGLHEDAQAVFEVMKRLGITPTMKSHMLLLSAYSRAGKVAKCEEIV  339

Query  560  QDLKTDETKLDERLYRSALN  619
              +     K D  +  S LN
Sbjct  340  NQMHKSGIKPDTFVLNSMLN  359


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/163 (20%), Positives = 77/163 (47%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  QKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK  331
            +  F   ++ Y+ +++ YG+   +K+A     ++ E  C P    Y  LL  +  +  ++
Sbjct  64   RSSFHPDVICYNLLIDAYGQKSLYKKAESTYLELLEARCVPTEDTYALLLKAYCTSGLLE  123

Query  332  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            + E V+ EM++    P  V Y + I    K  + +  V+ ++  K +  +   A   +++
Sbjct  124  KAEAVFAEMRKYGFPPSAVVYNAYIDGLMKGGDTQKAVEIFERMKRDRCQPSTATYTMLI  183

Query  512  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             ++ K +K    +K+  ++++ + K +   + + +NA    GL
Sbjct  184  NLYGKASKSYMALKVFHEMRSQKCKPNICTFTALVNAFAREGL  226



>gb|AFV61154.1| pentatricopeptide repeat-containing protein 123, partial [Xeroaloysia 
ovatifolia]
Length=431

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 116/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y ++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  99   REARSLISEMRTAGVMPNTASYTTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  155

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  156  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  215

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K  K+D 
Sbjct  216  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKAGKLDR  275

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  276  AAMLFQKLRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRL  314


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 106/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  136  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  195

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  196  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  255

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + KA +L+     +Q  + +G + D+ +   M+  + K   V    +LL
Sbjct  256  NSITYSTIISIWGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRLL  315

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  316  HELKSPD------------NIPRDTAIHILA  334


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/202 (20%), Positives = 98/202 (49%), Gaps = 0/202 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            +++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K 
Sbjct  1    DEMRERALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKL  60

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
              + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY
Sbjct  61   CDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASY  120

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
            T++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++ 
Sbjct  121  TTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRK  180

Query  575  DETKLDERLYRSALNALRDAGL  640
               + +   Y + L    DA L
Sbjct  181  MGIEPNVVSYNTLLRVYGDAEL  202


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  223  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKAGKLDRAAMLFQK  282

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + +A  +   +++  E+K     PD +   + I   + A  
Sbjct  283  LRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  338

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  339  IEEATYVFRQAIDAGEVRDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  398

Query  611  ALNA  622
             LNA
Sbjct  399  VLNA  402


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/180 (19%), Positives = 74/180 (41%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ + G   +A M F ++   G +   V Y +M+ 
Sbjct  241  ANNLIQEMQNRGIEPNSITYSTIISIWGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  300

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y K G    A RL+ ++K     P                               ++ +
Sbjct  301  AYEKAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVRDITV  360

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  361  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  420



>ref|XP_002865541.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41800.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=711

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 106/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T +++++S+G EP +VT+ ++++ +C+ G +  AE  F  ME++G   C   Y+ M+N
Sbjct  465  AMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMERRGCLPCATTYNIMIN  524

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG   R  +  RL+ KMK +G  PNV  + TL+D++G++       +  +EMK   + P
Sbjct  525  SYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECLEEMKSVGLKP  584

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++    +G K        ++  F +  +  E   +L
Sbjct  585  SSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGEDRRDAEAFAVL  644

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  645  QYMKENGVKPDVVTYTTLMKAL  666


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/221 (22%), Positives = 104/221 (47%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G +P +  Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  433  VLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHC  492

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH  A  +   M+ RGC P    YN +++ +G       ++++  +MK + ++P+ V
Sbjct  493  KHGRHIVAEEMFEAMERRGCLPCATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVV  552

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            ++T+++  Y K+      ++  ++ K  G K    M   ++  +++    ++ V   + +
Sbjct  553  THTTLVDVYGKSGRFNDAIECLEEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVM  612

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
             +D  K       S +NA     RDA          E+FAV
Sbjct  613  TSDGLKPSLLALNSLINAFGEDRRDA----------EAFAV  643


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 97/208 (47%), Gaps = 0/208 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            + G      T  SI++     G   +AE  F E+ Q G      AY++++  Y KTG  K
Sbjct  299  ATGLSAKTATLVSIISALANSGRTLEAEALFEELRQSGIKPRTKAYNALLKGYVKTGPLK  358

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M++RG  P+   Y+ L+D +  A   +    V KEM+   V P+   ++ ++
Sbjct  359  DAELMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMETGDVQPNSFVFSRLL  418

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETK  586
            + Y    E +   +  ++ K  G K DR    +++  F K N +D  +     + ++  +
Sbjct  419  AGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIE  478

Query  587  LDERLYRSALNALRDAGLEIRAKWLQES  670
             D   + + ++     G  I A+ + E+
Sbjct  479  PDRVTWNTLIDCHCKHGRHIVAEEMFEA  506


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 78/164 (48%), Gaps = 0/164 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G +P    Y ++L  Y + G    AE+  SEME++G       YS +++
Sbjct  325  AEALFEELRQSGIKPRTKAYNALLKGYVKTGPLKDAELMVSEMEKRGVSPDEHTYSLLID  384

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ LL  +      ++  +V KEMK   V P
Sbjct  385  AYVNAGRWESARIVLKEMETGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKP  444

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            DR  Y  VI  + K   L+  +  +      G + DR     ++
Sbjct  445  DRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLI  488


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 94/211 (45%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ +L  Y   G + K      EM+  G       Y+ +++
Sbjct  395  ARIVLKEMETGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVID  454

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H +       E++++ M+RR  +P
Sbjct  455  TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMERRGCLP  514

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++Y   +  +   +     K  G   +      +V V+ K  + ++ ++ L
Sbjct  515  CATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECL  574

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            +++K+   K    +Y + +NA    GL  +A
Sbjct  575  EEMKSVGLKPSSTMYNALINAYAQRGLSEQA  605


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 78/176 (44%), Gaps = 0/176 (0%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            + + G  S+A       +  G         S+++    +GR  EA  L  ++++ G +P 
Sbjct  281  FAKSGDPSRALQLLGMAQATGLSAKTATLVSIISALANSGRTLEAEALFEELRQSGIKPR  340

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               YN LL  + +   +K  E +  EM++R V PD  +Y+ +I AY  A   ES     +
Sbjct  341  TKAYNALLKGYVKTGPLKDAELMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLK  400

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            + +    + +  +   ++  +    +  +  ++L+++K+   K D + Y   ++  
Sbjct  401  EMETGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTF  456



>dbj|BAB10204.1| maize crp1 protein-like [Arabidopsis thaliana]
Length=680

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 106/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T +++++S+G EP +VT+ ++++ +C+ G +  AE  F  ME++G   C   Y+ M+N
Sbjct  434  AMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMERRGCLPCATTYNIMIN  493

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG   R  +  RL+ KMK +G  PNV  + TL+D++G++       +  +EMK   + P
Sbjct  494  SYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECLEEMKSVGLKP  553

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++    +G K        ++  F +  +  E   +L
Sbjct  554  SSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGEDRRDAEAFAVL  613

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  614  QYMKENGVKPDVVTYTTLMKAL  635


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/221 (22%), Positives = 104/221 (47%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G +P +  Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  402  VLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHC  461

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH  A  +   M+ RGC P    YN +++ +G       ++++  +MK + ++P+ V
Sbjct  462  KHGRHIVAEEMFEAMERRGCLPCATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVV  521

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            ++T+++  Y K+      ++  ++ K  G K    M   ++  +++    ++ V   + +
Sbjct  522  THTTLVDVYGKSGRFNDAIECLEEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVM  581

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
             +D  K       S +NA     RDA          E+FAV
Sbjct  582  TSDGLKPSLLALNSLINAFGEDRRDA----------EAFAV  612


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            + G      T  SI++     G   +AE  F E+ Q G      AY++++  Y KTG  K
Sbjct  268  ATGLSAKTATLVSIISALADSGRTLEAEALFEELRQSGIKPRTRAYNALLKGYVKTGPLK  327

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M++RG  P+   Y+ L+D +  A   +    V KEM+   V P+   ++ ++
Sbjct  328  DAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLL  387

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +    E +   +  ++ K  G K DR    +++  F K N +D 
Sbjct  388  AGFRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDH  433


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 76/164 (46%), Gaps = 0/164 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G +P    Y ++L  Y + G    AE   SEME++G       YS +++
Sbjct  294  AEALFEELRQSGIKPRTRAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLID  353

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ LL         ++  +V KEMK   V P
Sbjct  354  AYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLLAGFRDRGEWQKTFQVLKEMKSIGVKP  413

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            DR  Y  VI  + K   L+  +  +      G + DR     ++
Sbjct  414  DRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLI  457


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/211 (21%), Positives = 94/211 (45%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ +L  +   G + K      EM+  G       Y+ +++
Sbjct  364  ARIVLKEMEAGDVQPNSFVFSRLLAGFRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVID  423

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H +       E++++ M+RR  +P
Sbjct  424  TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMERRGCLP  483

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++Y   +  +   +     K  G   +      +V V+ K  + ++ ++ L
Sbjct  484  CATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECL  543

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            +++K+   K    +Y + +NA    GL  +A
Sbjct  544  EEMKSVGLKPSSTMYNALINAYAQRGLSEQA  574


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/176 (22%), Positives = 78/176 (44%), Gaps = 0/176 (0%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            + + G  SKA       +  G         S+++    +GR  EA  L  ++++ G +P 
Sbjct  250  FAKSGDPSKALQLLGMAQATGLSAKTATLVSIISALADSGRTLEAEALFEELRQSGIKPR  309

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               YN LL  + +   +K  E +  EM++R V PD  +Y+ +I AY  A   ES     +
Sbjct  310  TRAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLK  369

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            + +    + +  +   ++  F    +  +  ++L+++K+   K D + Y   ++  
Sbjct  370  EMEAGDVQPNSFVFSRLLAGFRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTF  425



>gb|ACU25762.1| pentatricopeptide repeat-containing protein [Xeroaloysia ovatifolia]
Length=426

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 116/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y ++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  96   REARSLISEMRTAGVMPNTASYTTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  152

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  153  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  212

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K  K+D 
Sbjct  213  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKAGKLDR  272

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  273  AAMLFQKLRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRL  311


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 106/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  133  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  192

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  193  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  252

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + KA +L+     +Q  + +G + D+ +   M+  + K   V    +LL
Sbjct  253  NSITYSTIISIWGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRLL  312

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  313  HELKSPD------------NIPRDTAIHILA  331


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/197 (21%), Positives = 95/197 (48%), Gaps = 0/197 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +
Sbjct  3    RALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSK  62

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SYT++++
Sbjct  63   AISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYTTLLT  122

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + 
Sbjct  123  MYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEP  182

Query  590  DERLYRSALNALRDAGL  640
            +   Y + L    DA L
Sbjct  183  NVVSYNTLLRVYGDAEL  199


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  220  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKAGKLDRAAMLFQK  279

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + +A  +   +++  E+K     PD +   + I   + A  
Sbjct  280  LRSSGVEIDQVLYQTMIVAYEKAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  335

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  336  IEEATYVFRQAIDAGEVRDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  395

Query  611  ALNA  622
             LNA
Sbjct  396  VLNA  399


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/180 (19%), Positives = 74/180 (41%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ + G   +A M F ++   G +   V Y +M+ 
Sbjct  238  ANNLIQEMQNRGIEPNSITYSTIISIWGKAGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  297

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y K G    A RL+ ++K     P                               ++ +
Sbjct  298  AYEKAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVRDITV  357

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  358  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  417



>ref|XP_008790326.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic-like [Phoenix dactylifera]
 ref|XP_008790327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic-like [Phoenix dactylifera]
 ref|XP_008790328.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, 
chloroplastic-like [Phoenix dactylifera]
Length=634

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 116/219 (53%), Gaps = 2/219 (1%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A   +EK+    C P  VTY+++++ Y R G   KA   +    Q+ +    V +++
Sbjct  159  PEKAVEWFEKMPEFECSPDYVTYSAMIDAYGRSGNIEKALGLYDRARQERWRLDPVTFAT  218

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++ +Y  +G    A  +  +MK  G +PNV IYNTL D  GRA    QV+ ++KEM ++ 
Sbjct  219  VIRVYSHSGNFDGALNVYEEMKALGVKPNVVIYNTLFDAMGRAGRPWQVKTIFKEMDKKG  278

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            +VP+R +Y +++ +Y KA+  E  +  Y+  K  G + +  +  +++ + + +  VDE  
Sbjct  279  LVPNRATYAALLRSYCKARYAEDALSVYRQMKEKGMEMNVILYNMLLSMCADIGCVDEAA  338

Query  551  KLLQDLK--TDETKLDERLYRSALNALRDAGLEIRAKWL  661
            ++  ++K   D+ K D   Y + + A   +G  + A+ L
Sbjct  339  EIFAEMKGLPDDCKPDSWSYSALITAYSCSGQVLEAEGL  377


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 91/186 (49%), Gaps = 3/186 (2%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P    T+++++  +G  P + TYA++L  YC+      A   + +M++KG +  ++ Y+ 
Sbjct  264  PWQVKTIFKEMDKKGLVPNRATYAALLRSYCKARYAEDALSVYRQMKEKGMEMNVILYNM  323

Query  191  MVNMYGKTGRHKEATRLVAKMK--ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            +++M    G   EA  + A+MK     C+P+ W Y+ L+  +  +  + + E +  EM  
Sbjct  324  LLSMCADIGCVDEAAEIFAEMKGLPDDCKPDSWSYSALITAYSCSGQVLEAEGLLNEMLE  383

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
                P+    TS+I  Y KA++ +  V+ +      G   D    G ++ V ++    +E
Sbjct  384  AGYQPNIFVLTSIIQCYGKARQTDDVVRSFDKLLELGITPDDRFCGCLLNVLTQ-TPTEE  442

Query  545  LVKLLQ  562
            L K++ 
Sbjct  443  LGKVIN  448


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/124 (22%), Positives = 61/124 (49%), Gaps = 0/124 (0%)
 Frame = +2

Query  116  YSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNT  295
            +   E  + EM ++G     V +S++++        ++A     KM E  C P+   Y+ 
Sbjct  124  WDGVEALWKEMLERGVKPDNVTFSTIISCARFCNLPEKAVEWFEKMPEFECSPDYVTYSA  183

Query  296  LLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNG  475
            ++D +GR+ N+++   ++   ++ +   D V++ +VI  YS +   +  +  Y++ K  G
Sbjct  184  MIDAYGRSGNIEKALGLYDRARQERWRLDPVTFATVIRVYSHSGNFDGALNVYEEMKALG  243

Query  476  GKTD  487
             K +
Sbjct  244  VKPN  247



>ref|XP_001777347.1| predicted protein [Physcomitrella patens]
 gb|EDQ57877.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 104/203 (51%), Gaps = 1/203 (0%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P  VTY S+LN   + G   +A++ F E++   +   +V+YS ++N  G+ G+ + A  +
Sbjct  7    PNVVTYNSLLNALAKAGQCEEAQLLFEELKAAKWTPDVVSYSCLINSLGRAGKWEAALEV  66

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
            VA+M+ +GC+PN+W YNTL+D  G+A    +  ++  EM+    VPD  +Y  +IS   K
Sbjct  67   VAEMQAKGCKPNLWTYNTLVDCLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLISTLGK  126

Query  422  AKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERL  601
            A  L      + + +  G   D      ++    K+ +  + ++LL++++      D   
Sbjct  127  AGRLSEAFTLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMT  186

Query  602  YRSALNALRDAGLEIRA-KWLQE  667
            Y S +  L   G  ++A K  QE
Sbjct  187  YSSLITGLGKDGETVKAFKLFQE  209


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 104/207 (50%), Gaps = 0/207 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T++ ++  +GC P   TY S++    ++G   KA     EME+ G    ++ YSS++ 
Sbjct  133  AFTLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMTYSSLIT  192

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK G   +A +L  +MK RG +P+   +  L+D  G+A  +    ++  EMK R V P
Sbjct  193  GLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMDALGKAGRVDDALELLDEMKERGVKP  252

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+Y ++I+ + K  +L        + K NG K D      ++    K +++DE  ++L
Sbjct  253  GVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLITGLIKASQLDEACQVL  312

Query  560  QDLKTDETKLDERLYRSALNALRDAGL  640
            + ++ +    D   Y + +N L  AGL
Sbjct  313  KKMEKEGCPPDTITYNTLINGLGKAGL  339


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 99/185 (54%), Gaps = 0/185 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
             A  V  ++ ++GC+P   TY ++++   + G + +A    +EM   G    +  Y+ ++
Sbjct  62   AALEVVAEMQAKGCKPNLWTYNTLVDCLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLI  121

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +  GK GR  EA  L A+M+ERGC P+ + YN+L+   G+    ++  ++ +EM+R    
Sbjct  122  STLGKAGRLSEAFTLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCP  181

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            PD ++Y+S+I+   K  E     K +Q+ K  G K D      ++    K  +VD+ ++L
Sbjct  182  PDVMTYSSLITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMDALGKAGRVDDALEL  241

Query  557  LQDLK  571
            L ++K
Sbjct  242  LDEMK  246


 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 102/206 (50%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++ S+GC P  VTY++++    +      A + F EME  G    +  Y S++ 
Sbjct  343  AGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYCSIIT  402

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            + GK G+  +A RL ++M+ +G  P+V  YN  L+  GR    K+  K++++MK   ++P
Sbjct  403  VLGKAGQVDDADRLFSEMRGKGLSPDVITYNAFLNSLGRGGRFKEARKIFEDMKESGLLP  462

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  +Y +++   SK KE++      ++    G   D       + + +    VDE  +LL
Sbjct  463  DVATYDALLLGLSKTKEVDDACGLLKELIEQGCAFDSLKFDECLEILTSWGNVDEAHELL  522

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
            Q   +         Y + ++AL  AG
Sbjct  523  QFANSKGLWPGASSYNALIDALAKAG  548


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 105/206 (51%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L +    P  V+Y+ ++N   R G +  A    +EM+ KG    +  Y+++V+
Sbjct  28   AQLLFEELKAAKWTPDVVSYSCLINSLGRAGKWEAALEVVAEMQAKGCKPNLWTYNTLVD  87

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK G+  EA RL+A+M++ GC P+V  YN L+   G+A  + +   ++ EM+ R  VP
Sbjct  88   CLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLISTLGKAGRLSEAFTLFAEMRERGCVP  147

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  +Y S+I    K    +  ++  ++ + +G   D      ++    K  +  +  KL 
Sbjct  148  DTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMTYSSLITGLGKDGETVKAFKLF  207

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
            Q++K    K D   + + ++AL  AG
Sbjct  208  QEMKRRGRKPDSITFTALMDALGKAG  233


 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 105/199 (53%), Gaps = 5/199 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +K+  +GC P  +TY +++N   + G+ + A   F  M+ KG +  +V YS+++ 
Sbjct  308  ACQVLKKMEKEGCPPDTITYNTLINGLGKAGLLNDAGRLFDRMKSKGCNPDVVTYSTLIT  367

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK  R + A  L  +M+  G +P+++ Y +++ + G+A  +   ++++ EM+ + + P
Sbjct  368  ALGKAARVESACVLFEEMESVGIQPDLFTYCSIITVLGKAGQVDDADRLFSEMRGKGLSP  427

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D ++Y + +++  +    +   K ++D K +G   D A    ++   SK  +VD+   LL
Sbjct  428  DVITYNAFLNSLGRGGRFKEARKIFEDMKESGLLPDVATYDALLLGLSKTKEVDDACGLL  487

Query  560  QDL-----KTDETKLDERL  601
            ++L       D  K DE L
Sbjct  488  KELIEQGCAFDSLKFDECL  506


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 108/206 (52%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++  +G +PG VTY +++  + ++G   +A     EM++ G    +V YS ++ 
Sbjct  238  ALELLDEMKERGVKPGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLIT  297

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K  +  EA +++ KM++ GC P+   YNTL++  G+A  +    +++  MK +   P
Sbjct  298  GLIKASQLDEACQVLKKMEKEGCPPDTITYNTLINGLGKAGLLNDAGRLFDRMKSKGCNP  357

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+Y+++I+A  KA  +ES    +++ +  G + D      ++ V  K  +VD+  +L 
Sbjct  358  DVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYCSIITVLGKAGQVDDADRLF  417

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
             +++      D   Y + LN+L   G
Sbjct  418  SEMRGKGLSPDVITYNAFLNSLGRGG  443


 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 104/210 (50%), Gaps = 6/210 (3%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
             GC P   TY  +++   + G  S+A   F+EM ++G       Y+S++   GK GR ++
Sbjct  108  NGCVPDVRTYNCLISTLGKAGRLSEAFTLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQK  167

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  L+ +M+  GC P+V  Y++L+   G+     +  K+++EMKRR   PD +++T+++ 
Sbjct  168  AMELLEEMERHGCPPDVMTYSSLITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMD  227

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
            A  KA  ++  ++   + K  G K        ++  F K+  + E   LL ++K +  K 
Sbjct  228  ALGKAGRVDDALELLDEMKERGVKPGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKP  287

Query  590  DERLYRSALNALRDAGLEIRAKWLQESFAV  679
            D   Y   +  L      I+A  L E+  V
Sbjct  288  DVVTYSCLITGL------IKASQLDEACQV  311


 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 101/205 (49%), Gaps = 0/205 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + E++   GC P  +TY+S++    + G   KA   F EM+++G     + ++++++
Sbjct  168  AMELLEEMERHGCPPDVMTYSSLITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMD  227

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK GR  +A  L+ +MKERG +P V  YN L+   G+  ++ +   +  EMKR    P
Sbjct  228  ALGKAGRVDDALELLDEMKERGVKPGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKP  287

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V+Y+ +I+   KA +L+   +  +  +  G   D      ++    K   +++  +L 
Sbjct  288  DVVTYSCLITGLIKASQLDEACQVLKKMEKEGCPPDTITYNTLINGLGKAGLLNDAGRLF  347

Query  560  QDLKTDETKLDERLYRSALNALRDA  634
              +K+     D   Y + + AL  A
Sbjct  348  DRMKSKGCNPDVVTYSTLITALGKA  372


 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 99/202 (49%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++   GC+P  VTY+ ++    +     +A     +ME++G     + Y++++N
Sbjct  273  AYNLLDEMKRNGCKPDVVTYSCLITGLIKASQLDEACQVLKKMEKEGCPPDTITYNTLIN  332

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              GK G   +A RL  +MK +GC P+V  Y+TL+   G+A+ ++    +++EM+   + P
Sbjct  333  GLGKAGLLNDAGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQP  392

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  +Y S+I+   KA +++   + + + +  G   D       +    +  +  E  K+ 
Sbjct  393  DLFTYCSIITVLGKAGQVDDADRLFSEMRGKGLSPDVITYNAFLNSLGRGGRFKEARKIF  452

Query  560  QDLKTDETKLDERLYRSALNAL  625
            +D+K      D   Y + L  L
Sbjct  453  EDMKESGLLPDVATYDALLLGL  474


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 103/206 (50%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++  +G +P  +T+ ++++   + G    A     EM+++G    +V Y++++ 
Sbjct  203  AFKLFQEMKRRGRKPDSITFTALMDALGKAGRVDDALELLDEMKERGVKPGVVTYNALIA  262

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK G   EA  L+ +MK  GC+P+V  Y+ L+    +AS + +  +V K+M++    P
Sbjct  263  GFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLITGLIKASQLDEACQVLKKMEKEGCPP  322

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D ++Y ++I+   KA  L    + +   K  G   D      ++    K  +V+    L 
Sbjct  323  DTITYNTLINGLGKAGLLNDAGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLF  382

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
            +++++   + D   Y S +  L  AG
Sbjct  383  EEMESVGIQPDLFTYCSIITVLGKAG  408


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 77/187 (41%), Gaps = 35/187 (19%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ ++  +G  P  +TY + LN   R G + +A   F +M++ G    +  Y +++ 
Sbjct  413  ADRLFSEMRGKGLSPDVITYNAFLNSLGRGGRFKEARKIFEDMKESGLLPDVATYDALLL  472

Query  200  MYGKTGRHKEATRLVAKMKERGCE-----------------------------------P  274
               KT    +A  L+ ++ E+GC                                    P
Sbjct  473  GLSKTKEVDDACGLLKELIEQGCAFDSLKFDECLEILTSWGNVDEAHELLQFANSKGLWP  532

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
                YN L+D   +A  + +     +++K +   PD VSY+S+ISA  +  ++++  +  
Sbjct  533  GASSYNALIDALAKAGRVSEAFNTLEDLKEQGGKPDIVSYSSLISALGQTGQIDTAFELL  592

Query  455  QDFKLNG  475
            ++    G
Sbjct  593  EEMSKRG  599



>ref|XP_010509657.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X1 [Camelina sativa]
Length=591

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/212 (26%), Positives = 112/212 (53%), Gaps = 1/212 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++ ++ S  C+P  +TY ++LN + R G+  KAE  F ++++ G +  +  Y++++  Y 
Sbjct  284  LFCEMRSHQCKPNIITYTALLNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMEAYS  343

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS-NMKQVEKVWKEMKRRKVVPDR  385
            + G    A  + + M+  GCEP+   YN ++D +GRA  +    E V++ MKR  + P  
Sbjct  344  RAGYPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSADAEAVFEAMKRLGIAPTM  403

Query  386  VSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQD  565
             S+  ++SAYS+A+++  C    ++   NG + D  +   M+ ++ ++ +  ++ K+L +
Sbjct  404  KSHMLLLSAYSRARDVTKCEAVVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAE  463

Query  566  LKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
            ++      D   Y   +N    AG   R + L
Sbjct  464  MENGPCTADISTYNILINIYGKAGFLERVEEL  495


 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 103/183 (56%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E +   G  P   ++  +L+ Y R    +K E    EM + G +      +SM+N
Sbjct  387  AEAVFEAMKRLGIAPTMKSHMLLLSAYSRARDVTKCEAVVKEMSENGVEPDTFVLNSMLN  446

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG+ G+  +  +++A+M+   C  ++  YN L++I+G+A  +++VE+++ E+K R   P
Sbjct  447  LYGRLGQFTKMEKILAEMENGPCTADISTYNILINIYGKAGFLERVEELFSELKERNFRP  506

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++TS I AYS+ K    C++ +++   +G   D   A +++   S  ++V+++  +L
Sbjct  507  DVVTWTSRIGAYSRKKLYVKCLEIFEEMIDSGCAPDGGTAKVLLSSCSSEDQVEQVTSVL  566

Query  560  QDL  568
            + +
Sbjct  567  RTM  569


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 104/212 (49%), Gaps = 7/212 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV-  196
            A ++Y +L+   C P + TYA ++  YC  G+  KAE    EM+          Y++ + 
Sbjct  175  AESLYVQLLESRCVPTEDTYALLVKAYCMAGLIEKAEAVLVEMQNHHVSPSTTVYNAYIE  234

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
             +  + G  +EA  +  +MK   C+P    YN +++++G+AS      K++ EM+  +  
Sbjct  235  GLIKRKGNTEEAINVFQRMKRDPCKPTTETYNLMINLYGKASKSFMSWKLFCEMRSHQCK  294

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDEL  547
            P+ ++YT++++A+++    E   + ++  + +G + D  +   ++  +S+        E+
Sbjct  295  PNIITYTALLNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEI  354

Query  548  VKLLQDLKTDETKLDERLYRSALNALRDAGLE  643
              L+Q +  +    D   Y   ++A   AGL 
Sbjct  355  FSLMQHMGCEP---DRASYNIMVDAYGRAGLH  383


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 80/177 (45%), Gaps = 1/177 (1%)
 Frame = +2

Query  146  MEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASN  325
            + +  F   ++ ++ +++ YG+  R+KEA  L  ++ E  C P    Y  L+  +  A  
Sbjct  147  LRRSSFQPDVICFNLLIDAYGQKFRYKEAESLYVQLLESRCVPTEDTYALLVKAYCMAGL  206

Query  326  MKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAK-ELESCVKYYQDFKLNGGKTDRAMAG  502
            +++ E V  EM+   V P    Y + I    K K   E  +  +Q  K +  K       
Sbjct  207  IEKAEAVLVEMQNHHVSPSTTVYNAYIEGLIKRKGNTEEAINVFQRMKRDPCKPTTETYN  266

Query  503  IMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            +M+ ++ K +K     KL  ++++ + K +   Y + LNA    GL  +A+ + E  
Sbjct  267  LMINLYGKASKSFMSWKLFCEMRSHQCKPNIITYTALLNAFAREGLCEKAEEIFEQL  323



>ref|XP_002451617.1| hypothetical protein SORBIDRAFT_04g004710 [Sorghum bicolor]
 gb|EES04593.1| hypothetical protein SORBIDRAFT_04g004710 [Sorghum bicolor]
Length=593

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 103/183 (56%), Gaps = 0/183 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  +  V+ ++ + GC+P   TY +++N + R G+  KAE  F EM+Q G +  + AY++
Sbjct  286  PMSSLKVFNEMKTIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNA  345

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y + G  + A+ + + M+  GCEP+   YN L+D +GRA   ++ E  ++E+K++ 
Sbjct  346  LMEAYSRAGLPQGASEIFSLMEHMGCEPDRASYNILVDAYGRAGLHQEAEAAFQELKQQG  405

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P   S+  ++SA++K+  +  C +       +G + D      M+  + +  ++D++ 
Sbjct  406  MRPTMKSHMLLLSAHAKSGNVARCEEVMAQLHKSGLRPDTFALNAMLNAYGRAGRLDDME  465

Query  551  KLL  559
            +LL
Sbjct  466  RLL  468


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/225 (25%), Positives = 98/225 (44%), Gaps = 35/225 (16%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KR    A ++Y  L+   C P + TYA +L  YC  G   +AE   SEM++ G       
Sbjct  178  KRQLNKAESIYMALLEAHCVPTEDTYALLLRAYCNSGQLHRAEGVISEMQKNGLPPTATV  237

Query  182  YSS-----------------------------------MVNMYGKTGRHKEATRLVAKMK  256
            Y++                                   M+N+YGK  +   + ++  +MK
Sbjct  238  YNAYLDGLLKARCSEKAVEVYQRMKKERCRTNTETYTLMINVYGKAKQPMSSLKVFNEMK  297

Query  257  ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
              GC+PN+  Y  L++   R    ++ E+V++EM++    PD  +Y +++ AYS+A   +
Sbjct  298  TIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQ  357

Query  437  SCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               + +   +  G + DRA   I+V  + +     E     Q+LK
Sbjct  358  GASEIFSLMEHMGCEPDRASYNILVDAYGRAGLHQEAEAAFQELK  402


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/235 (23%), Positives = 111/235 (47%), Gaps = 42/235 (18%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGF---------  163
            P+ A+ ++  +   GCEP + +Y  +++ Y R G++ +AE  F E++Q+G          
Sbjct  356  PQGASEIFSLMEHMGCEPDRASYNILVDAYGRAGLHQEAEAAFQELKQQGMRPTMKSHML  415

Query  164  -----------DKC---------------IVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                        +C                 A ++M+N YG+ GR  +  RL+  M+  G
Sbjct  416  LLSAHAKSGNVARCEEVMAQLHKSGLRPDTFALNAMLNAYGRAGRLDDMERLLGAMERGG  475

Query  266  CE-------PNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKA  424
             +       P+   YN L++++GRA  + ++E  ++ +  R +  D V++TS I AY++ 
Sbjct  476  DDDAGGGAAPDTSTYNVLVNVYGRAGYLDRMEAAFRALAARGLAADVVTWTSRIGAYARK  535

Query  425  KELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
            KE   C++ +++    G   D   A +++   S   +V+++  +++ +  D   L
Sbjct  536  KEYGRCLEIFEEMVDAGCYPDAGTAKVLLAACSDERQVEQVTAIVRSMHKDAKTL  590


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 97/206 (47%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  VY+++  + C     TY  ++N+Y +      +   F+EM+  G    I  Y+++VN
Sbjct  254  AVEVYQRMKKERCRTNTETYTLMINVYGKAKQPMSSLKVFNEMKTIGCKPNICTYTALVN  313

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M++ G EP+V+ YN L++ + RA   +   +++  M+     P
Sbjct  314  AFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMEHMGCEP  373

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A   +     +Q+ K  G +       +++   +K   V    +++
Sbjct  374  DRASYNILVDAYGRAGLHQEAEAAFQELKQQGMRPTMKSHMLLLSAHAKSGNVARCEEVM  433

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              L     + D     + LNA   AG
Sbjct  434  AQLHKSGLRPDTFALNAMLNAYGRAG  459


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/160 (24%), Positives = 72/160 (45%), Gaps = 0/160 (0%)
 Frame = +2

Query  161  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  340
            F   I+ Y+ +++ YG+  +  +A  +   + E  C P    Y  LL  +  +  + + E
Sbjct  161  FRPDIICYNLLIDAYGQKRQLNKAESIYMALLEAHCVPTEDTYALLLRAYCNSGQLHRAE  220

Query  341  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF  520
             V  EM++  + P    Y + +    KA+  E  V+ YQ  K    +T+     +M+ V+
Sbjct  221  GVISEMQKNGLPPTATVYNAYLDGLLKARCSEKAVEVYQRMKKERCRTNTETYTLMINVY  280

Query  521  SKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             K  +    +K+  ++KT   K +   Y + +NA    GL
Sbjct  281  GKAKQPMSSLKVFNEMKTIGCKPNICTYTALVNAFAREGL  320



>ref|XP_006295537.1| hypothetical protein CARUB_v10024643mg [Capsella rubella]
 gb|EOA28435.1| hypothetical protein CARUB_v10024643mg [Capsella rubella]
Length=589

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 107/204 (52%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++ ++ S  C+P   TY +++N + R G+  KAE  F ++++ G +  +  Y++++  Y 
Sbjct  284  LFCEMRSHQCKPNICTYTALVNAFAREGLCEKAEEMFEQLQEDGLEPDVYVYNALMEAYS  343

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G    A  + + M+  GCEP+   YN ++D +GRA      E V++ MKR  + P   
Sbjct  344  RAGYPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEAMKRLGIAPTMK  403

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            S+  ++SAYS+A+++  C    ++   NG + D  +   M+ ++ ++ +  ++ K+L ++
Sbjct  404  SHMLLLSAYSRARDVTKCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEM  463

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +      D   Y   +N    AG 
Sbjct  464  ENGPCTADISTYNILINVYGKAGF  487


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/221 (24%), Positives = 111/221 (50%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS----------------  142
            P  AA ++  +   GCEP + +Y  +++ Y R G++S AE  F                 
Sbjct  348  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEAMKRLGIAPTMKSHML  407

Query  143  -------------------EMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                               EM + G +      +SM+N+YG+ G+  +  +++A+M+   
Sbjct  408  LLSAYSRARDVTKCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEMENGP  467

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C  ++  YN L++++G+A  ++++E+++ E+K R   PD V++TS I AYS+ K    C+
Sbjct  468  CTADISTYNILINVYGKAGFLERIEELFSELKERNFRPDVVTWTSRIGAYSRKKLYVKCL  527

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++   +G   D   A +++   S  ++V+++  +L+ +
Sbjct  528  EIFEEMIDSGCAPDGGTAKVLLSACSSEDQVEQVTSVLRTM  568


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 91/201 (45%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  316  AEEMFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEIFSLMQHMGCEPDRASYNIMVD  375

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H +A  +   MK  G  P +  +  LL  + RA ++ + E + KEM    V P
Sbjct  376  AYGRAGLHSDAEAVFEAMKRLGIAPTMKSHMLLLSAYSRARDVTKCEAIVKEMSENGVEP  435

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +     K   + +      D +   I++ V+ K   ++ + +L 
Sbjct  436  DTFVLNSMLNLYGRLGQFTKMEKILAEMENGPCTADISTYNILINVYGKAGFLERIEELF  495

Query  560  QDLKTDETKLDERLYRSALNA  622
             +LK    + D   + S + A
Sbjct  496  SELKERNFRPDVVTWTSRIGA  516


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/221 (24%), Positives = 107/221 (48%), Gaps = 7/221 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A ++Y +L+   C P + TYA ++  YC  G+  KAE    EM+          Y++ + 
Sbjct  175  AESLYVQLLESRCVPTEDTYALLIKAYCMAGLIEKAEAVLIEMQNHHVSPSTTVYNAYIE  234

Query  200  MYGKTGRHKE-ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
               K  R+ E A  +  +MK   C+P    YN +++++G+AS      K++ EM+  +  
Sbjct  235  GLVKRKRNTEDAVDVFQRMKRDRCKPTTETYNLMINLYGKASKSYMSWKLFCEMRSHQCK  294

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDEL  547
            P+  +YT++++A+++    E   + ++  + +G + D  +   ++  +S+        E+
Sbjct  295  PNICTYTALVNAFAREGLCEKAEEMFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEI  354

Query  548  VKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  670
              L+Q +  +    D   Y   ++A   AGL   A+ + E+
Sbjct  355  FSLMQHMGCEP---DRASYNIMVDAYGRAGLHSDAEAVFEA  392


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 80/177 (45%), Gaps = 1/177 (1%)
 Frame = +2

Query  146  MEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASN  325
            + +  F   ++ ++ +V+ YG+  R+KEA  L  ++ E  C P    Y  L+  +  A  
Sbjct  147  LRRSSFQPDVICFNLLVDAYGQKFRYKEAESLYVQLLESRCVPTEDTYALLIKAYCMAGL  206

Query  326  MKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAK-ELESCVKYYQDFKLNGGKTDRAMAG  502
            +++ E V  EM+   V P    Y + I    K K   E  V  +Q  K +  K       
Sbjct  207  IEKAEAVLIEMQNHHVSPSTTVYNAYIEGLVKRKRNTEDAVDVFQRMKRDRCKPTTETYN  266

Query  503  IMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            +M+ ++ K +K     KL  ++++ + K +   Y + +NA    GL  +A+ + E  
Sbjct  267  LMINLYGKASKSYMSWKLFCEMRSHQCKPNICTYTALVNAFAREGLCEKAEEMFEQL  323



>ref|NP_199046.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q8L844.1|PP413_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM53311.1| maize crp1 protein-like [Arabidopsis thaliana]
 gb|AED94794.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=709

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 106/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T +++++S+G EP +VT+ ++++ +C+ G +  AE  F  ME++G   C   Y+ M+N
Sbjct  463  AMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMERRGCLPCATTYNIMIN  522

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG   R  +  RL+ KMK +G  PNV  + TL+D++G++       +  +EMK   + P
Sbjct  523  SYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECLEEMKSVGLKP  582

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++    +G K        ++  F +  +  E   +L
Sbjct  583  SSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGEDRRDAEAFAVL  642

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  643  QYMKENGVKPDVVTYTTLMKAL  664


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/221 (22%), Positives = 104/221 (47%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G +P +  Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  431  VLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHC  490

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH  A  +   M+ RGC P    YN +++ +G       ++++  +MK + ++P+ V
Sbjct  491  KHGRHIVAEEMFEAMERRGCLPCATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVV  550

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            ++T+++  Y K+      ++  ++ K  G K    M   ++  +++    ++ V   + +
Sbjct  551  THTTLVDVYGKSGRFNDAIECLEEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVM  610

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
             +D  K       S +NA     RDA          E+FAV
Sbjct  611  TSDGLKPSLLALNSLINAFGEDRRDA----------EAFAV  641


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            + G      T  SI++     G   +AE  F E+ Q G      AY++++  Y KTG  K
Sbjct  297  ATGLSAKTATLVSIISALADSGRTLEAEALFEELRQSGIKPRTRAYNALLKGYVKTGPLK  356

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M++RG  P+   Y+ L+D +  A   +    V KEM+   V P+   ++ ++
Sbjct  357  DAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLL  416

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +    E +   +  ++ K  G K DR    +++  F K N +D 
Sbjct  417  AGFRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDH  462


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 76/164 (46%), Gaps = 0/164 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G +P    Y ++L  Y + G    AE   SEME++G       YS +++
Sbjct  323  AEALFEELRQSGIKPRTRAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLID  382

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ LL         ++  +V KEMK   V P
Sbjct  383  AYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLLAGFRDRGEWQKTFQVLKEMKSIGVKP  442

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            DR  Y  VI  + K   L+  +  +      G + DR     ++
Sbjct  443  DRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLI  486


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/211 (21%), Positives = 94/211 (45%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ +L  +   G + K      EM+  G       Y+ +++
Sbjct  393  ARIVLKEMEAGDVQPNSFVFSRLLAGFRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVID  452

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H +       E++++ M+RR  +P
Sbjct  453  TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMERRGCLP  512

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++Y   +  +   +     K  G   +      +V V+ K  + ++ ++ L
Sbjct  513  CATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECL  572

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            +++K+   K    +Y + +NA    GL  +A
Sbjct  573  EEMKSVGLKPSSTMYNALINAYAQRGLSEQA  603


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/176 (22%), Positives = 78/176 (44%), Gaps = 0/176 (0%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            + + G  SKA       +  G         S+++    +GR  EA  L  ++++ G +P 
Sbjct  279  FAKSGDPSKALQLLGMAQATGLSAKTATLVSIISALADSGRTLEAEALFEELRQSGIKPR  338

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               YN LL  + +   +K  E +  EM++R V PD  +Y+ +I AY  A   ES     +
Sbjct  339  TRAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLK  398

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            + +    + +  +   ++  F    +  +  ++L+++K+   K D + Y   ++  
Sbjct  399  EMEAGDVQPNSFVFSRLLAGFRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTF  454



>ref|XP_007211547.1| hypothetical protein PRUPE_ppa004057mg [Prunus persica]
 gb|EMJ12746.1| hypothetical protein PRUPE_ppa004057mg [Prunus persica]
Length=532

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 111/213 (52%), Gaps = 0/213 (0%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            +R   +A  ++ ++ SQ C+P   TY +++N + R G+  KAE  F +M++ G +  + A
Sbjct  216  ERKSHMALKLFHEMRSQKCKPNICTYTALVNAFAREGLCEKAEEIFEQMQEAGHEPDVYA  275

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y++++  Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  E  ++EMK
Sbjct  276  YNALMEAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAEVAFEEMK  335

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R  + P   S+  ++SAYSKA  +  C       + +G + D  +   M+ ++ ++ ++ 
Sbjct  336  RLGITPTVKSHMLLLSAYSKAGNVTKCEDIVNQMQKSGLELDTFVINSMLNLYGRLGQLK  395

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
            ++ ++L  ++      D   Y   +N    AG 
Sbjct  396  KMEEVLTAMEKGPYAADISTYNILINIYGRAGF  428


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 104/213 (49%), Gaps = 6/213 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            + A + Y +L+   C P + TYA +L  YC+ G+  KAE  F EM + G     + + + 
Sbjct  115  KAAESTYLELLEARCIPTEDTYALLLRAYCKSGLLDKAEAVFGEMRKYGLPPSAIVFDAY  174

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            +N   K G  ++A  +  +MK   C+P+   Y TL++++G+        K++ EM+ +K 
Sbjct  175  INGLIKGGNPQKALEIFQRMKRDQCQPSTDTYTTLINLYGKERKSHMALKLFHEMRSQKC  234

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDE  544
             P+  +YT++++A+++    E   + ++  +  G + D      ++  +S+        E
Sbjct  235  KPNICTYTALVNAFAREGLCEKAEEIFEQMQEAGHEPDVYAYNALMEAYSRAGFPYGAAE  294

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLE  643
            +  L+Q +  +    D   Y   ++A   AGL 
Sbjct  295  IFSLMQHMGCEP---DRASYNIMVDAYGRAGLH  324


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 102/205 (50%), Gaps = 35/205 (17%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCI-----  175
            P  AA ++  +   GCEP + +Y  +++ Y R G++  AE+ F EM++ G    +     
Sbjct  289  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAEVAFEEMKRLGITPTVKSHML  348

Query  176  --VAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
               AYS                            SM+N+YG+ G+ K+   ++  M++  
Sbjct  349  LLSAYSKAGNVTKCEDIVNQMQKSGLELDTFVINSMLNLYGRLGQLKKMEEVLTAMEKGP  408

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
               ++  YN L++I+GRA   +++E++++ +  + + PD V++TS + AYS+ K  + C+
Sbjct  409  YAADISTYNILINIYGRAGFFEKMEELFQSLPTKNLKPDVVTWTSRLGAYSRKKLYKRCL  468

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVF  520
            + +++    G   D   A +++G F
Sbjct  469  EIFEEMIDAGCYPDGGTAKVLLGAF  493


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 98/203 (48%), Gaps = 0/203 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P+ A  +++++    C+P   TY +++N+Y +      A   F EM  +     I  Y++
Sbjct  184  PQKALEIFQRMKRDQCQPSTDTYTTLINLYGKERKSHMALKLFHEMRSQKCKPNICTYTA  243

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +VN + + G  ++A  +  +M+E G EP+V+ YN L++ + RA       +++  M+   
Sbjct  244  LVNAFAREGLCEKAEEIFEQMQEAGHEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMG  303

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
              PDR SY  ++ AY +A   E     +++ K  G         +++  +SK   V +  
Sbjct  304  CEPDRASYNIMVDAYGRAGLHEDAEVAFEEMKRLGITPTVKSHMLLLSAYSKAGNVTKCE  363

Query  551  KLLQDLKTDETKLDERLYRSALN  619
             ++  ++    +LD  +  S LN
Sbjct  364  DIVNQMQKSGLELDTFVINSMLN  386


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/201 (24%), Positives = 93/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  257  AEEIFEQMQEAGHEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVD  316

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H++A     +MK  G  P V  +  LL  + +A N+ + E +  +M++  +  
Sbjct  317  AYGRAGLHEDAEVAFEEMKRLGITPTVKSHMLLLSAYSKAGNVTKCEDIVNQMQKSGLEL  376

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +L+   +     +      D +   I++ ++ +    +++ +L 
Sbjct  377  DTFVINSMLNLYGRLGQLKKMEEVLTAMEKGPYAADISTYNILINIYGRAGFFEKMEELF  436

Query  560  QDLKTDETKLDERLYRSALNA  622
            Q L T   K D   + S L A
Sbjct  437  QSLPTKNLKPDVVTWTSRLGA  457


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 74/160 (46%), Gaps = 0/160 (0%)
 Frame = +2

Query  161  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  340
            F   ++ Y+ +++ YG+  +HK A     ++ E  C P    Y  LL  + ++  + + E
Sbjct  94   FKPDVICYNLLLDAYGQKSQHKAAESTYLELLEARCIPTEDTYALLLRAYCKSGLLDKAE  153

Query  341  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF  520
             V+ EM++  + P  + + + I+   K    +  ++ +Q  K +  +        ++ ++
Sbjct  154  AVFGEMRKYGLPPSAIVFDAYINGLIKGGNPQKALEIFQRMKRDQCQPSTDTYTTLINLY  213

Query  521  SKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             K  K    +KL  ++++ + K +   Y + +NA    GL
Sbjct  214  GKERKSHMALKLFHEMRSQKCKPNICTYTALVNAFAREGL  253



>gb|ACN28178.1| unknown [Zea mays]
 gb|AFW70286.1| hypothetical protein ZEAMMB73_980179 [Zea mays]
Length=597

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 112/213 (53%), Gaps = 4/213 (2%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  +  V+ ++ S GC+P   TY +++N + R G+  KAE  F EM+Q G +  + AY++
Sbjct  293  PMSSLRVFREMKSVGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNA  352

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y + G  + A+ + + M+  GCEP+   YN L+D  GRA   ++ E  ++E+K++ 
Sbjct  353  LMEAYSRAGLPQGASEIFSLMEHMGCEPDRASYNILVDAFGRAGLHQEAEAAFQELKQQG  412

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P   S+  ++SA++++  +  C +       +G + D      M+  + +  ++D++ 
Sbjct  413  MRPTMKSHMLLLSAHARSGNVARCEEVMAQLHKSGLRPDTFALNAMLNAYGRAGRLDDME  472

Query  551  KLLQDLKTDETKL----DERLYRSALNALRDAG  637
            +L   ++  +  +    D   Y   +NA   AG
Sbjct  473  RLFAAMERGDGAIAGAPDTSTYNVMVNAYGRAG  505


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/233 (24%), Positives = 110/233 (47%), Gaps = 41/233 (18%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGF---------  163
            P+ A+ ++  +   GCEP + +Y  +++ + R G++ +AE  F E++Q+G          
Sbjct  363  PQGASEIFSLMEHMGCEPDRASYNILVDAFGRAGLHQEAEAAFQELKQQGMRPTMKSHML  422

Query  164  -----------DKC---------------IVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                        +C                 A ++M+N YG+ GR  +  RL A M ERG
Sbjct  423  LLSAHARSGNVARCEEVMAQLHKSGLRPDTFALNAMLNAYGRAGRLDDMERLFAAM-ERG  481

Query  266  -----CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
                   P+   YN +++ +GRA  + ++E  ++ +  R +  D V++TS I AY++ KE
Sbjct  482  DGAIAGAPDTSTYNVMVNAYGRAGYLDRMEAAFRSLAARGLAADVVTWTSRIGAYARKKE  541

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               C++ +++    G   D   A +++   S   +V+++  +++ +  D   L
Sbjct  542  YGQCLRVFEEMVDAGCYPDAGTAKVLLAACSDERQVEQVKAIVRSMHKDAKTL  594


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/225 (26%), Positives = 96/225 (43%), Gaps = 35/225 (16%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KR    A   Y  L+   C P + TYA +L  YC  G   +AE   SEM++ G       
Sbjct  185  KRQLSEAEAAYMALLEARCVPTEDTYALLLRAYCGSGQLHRAEGVISEMQRNGIPPTATV  244

Query  182  YSS-----------------------------------MVNMYGKTGRHKEATRLVAKMK  256
            Y++                                   M+N+YGK  +   + R+  +MK
Sbjct  245  YNAYLDGLLKARCSEKAVEVYQRMKKERCRTNTETYTLMINVYGKANQPMSSLRVFREMK  304

Query  257  ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
              GC+PN+  Y  L++   R    ++ E+V++EM++    PD  +Y +++ AYS+A   +
Sbjct  305  SVGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQ  364

Query  437  SCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               + +   +  G + DRA   I+V  F +     E     Q+LK
Sbjct  365  GASEIFSLMEHMGCEPDRASYNILVDAFGRAGLHQEAEAAFQELK  409


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 96/206 (47%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  VY+++  + C     TY  ++N+Y +      +   F EM+  G    I  Y+++VN
Sbjct  261  AVEVYQRMKKERCRTNTETYTLMINVYGKANQPMSSLRVFREMKSVGCKPNICTYTALVN  320

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M++ G EP+V+ YN L++ + RA   +   +++  M+     P
Sbjct  321  AFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMEHMGCEP  380

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ A+ +A   +     +Q+ K  G +       +++   ++   V    +++
Sbjct  381  DRASYNILVDAFGRAGLHQEAEAAFQELKQQGMRPTMKSHMLLLSAHARSGNVARCEEVM  440

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              L     + D     + LNA   AG
Sbjct  441  AQLHKSGLRPDTFALNAMLNAYGRAG  466


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 98/213 (46%), Gaps = 10/213 (5%)
 Frame = +2

Query  20   AATVYEKL--VSQGCEPGQVTYASILNIYCRIGVYSKAE--MTFSE--MEQKGFDKCIVA  181
            AA+V+E L  + Q  +     +  I+N+  ++ +  + E  +T  E  + +  F   I+ 
Sbjct  119  AASVWESLDKIPQAHD----LWDDIVNVAVQLRLNRQWEPIITVCEWVLRRSSFRPDIIC  174

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y+ +++ YG+  +  EA      + E  C P    Y  LL  +  +  + + E V  EM+
Sbjct  175  YNLLIDAYGQKRQLSEAEAAYMALLEARCVPTEDTYALLLRAYCGSGQLHRAEGVISEMQ  234

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R  + P    Y + +    KA+  E  V+ YQ  K    +T+     +M+ V+ K N+  
Sbjct  235  RNGIPPTATVYNAYLDGLLKARCSEKAVEVYQRMKKERCRTNTETYTLMINVYGKANQPM  294

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
              +++ +++K+   K +   Y + +NA    GL
Sbjct  295  SSLRVFREMKSVGCKPNICTYTALVNAFAREGL  327



>gb|KFK32934.1| hypothetical protein AALP_AA6G308200 [Arabis alpina]
Length=695

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 106/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T +++++S+G EP +VT+ ++L+ +C+ G +  AE  F  ME++G   C   Y+ M+N
Sbjct  447  AMTTFDRMLSEGIEPDRVTWNTLLDCHCKHGRHIVAEEMFEAMEKRGCIPCSTTYNIMIN  506

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG   R  +  RL+ KMK +G  PNV  + TL+D++G++       +  +EMK   + P
Sbjct  507  SYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECLEEMKSVGLKP  566

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++    +G K        ++  F +  +  E   +L
Sbjct  567  SSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGEDRRDAEAFAVL  626

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  + D   Y + + AL
Sbjct  627  QYMKENGVRPDVVTYTTLMKAL  648


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/221 (22%), Positives = 105/221 (48%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G +P +  Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  415  VLKEMKSMGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLLDCHC  474

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH  A  +   M++RGC P    YN +++ +G       ++++  +MK + ++P+ V
Sbjct  475  KHGRHIVAEEMFEAMEKRGCIPCSTTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVV  534

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            ++T+++  Y K+      ++  ++ K  G K    M   ++  +++    ++ V   + +
Sbjct  535  THTTLVDVYGKSGRFNDAIECLEEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVM  594

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
             +D  K       S +NA     RDA          E+FAV
Sbjct  595  TSDGLKPSLLALNSLINAFGEDRRDA----------EAFAV  625


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/208 (24%), Positives = 95/208 (46%), Gaps = 0/208 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            + G      T  SI++         +AE  F E+ Q G      AY++++  Y KTG  +
Sbjct  281  ATGLSAKTATLVSIISALADSARTVEAEALFEELRQSGIKPRTKAYNALLKGYVKTGPLR  340

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M++RG  P+   Y+ L+D +  A   +    V KEM+   V P+   +  ++
Sbjct  341  DAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGDVQPNSFVFGRLL  400

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETK  586
            + Y    E +   +  ++ K  G K DR    +++  F K N +D  +     + ++  +
Sbjct  401  AGYRDRGEWQKTFQVLKEMKSMGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIE  460

Query  587  LDERLYRSALNALRDAGLEIRAKWLQES  670
             D   + + L+     G  I A+ + E+
Sbjct  461  PDRVTWNTLLDCHCKHGRHIVAEEMFEA  488


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 0/157 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G +P    Y ++L  Y + G    AE   SEME++G       YS +++
Sbjct  307  AEALFEELRQSGIKPRTKAYNALLKGYVKTGPLRDAESMVSEMEKRGVSPDEHTYSLLID  366

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN +++  LL  +      ++  +V KEMK   V P
Sbjct  367  AYVNAGRWESARIVLKEMEAGDVQPNSFVFGRLLAGYRDRGEWQKTFQVLKEMKSMGVKP  426

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDR  490
            DR  Y  VI  + K   L+  +  +      G + DR
Sbjct  427  DRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDR  463


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 93/211 (44%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    +  +L  Y   G + K      EM+  G       Y+ +++
Sbjct  377  ARIVLKEMEAGDVQPNSFVFGRLLAGYRDRGEWQKTFQVLKEMKSMGVKPDRQFYNVVID  436

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTLLD H +       E++++ M++R  +P
Sbjct  437  TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLLDCHCKHGRHIVAEEMFEAMEKRGCIP  496

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++Y   +  +   +     K  G   +      +V V+ K  + ++ ++ L
Sbjct  497  CSTTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECL  556

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            +++K+   K    +Y + +NA    GL  +A
Sbjct  557  EEMKSVGLKPSSTMYNALINAYAQRGLSEQA  587


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/192 (20%), Positives = 86/192 (45%), Gaps = 1/192 (1%)
 Frame = +2

Query  2    KRGP-RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIV  178
            K GP R A ++  ++  +G  P + TY+ +++ Y   G +  A +   EME         
Sbjct  335  KTGPLRDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGDVQPNSF  394

Query  179  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  358
             +  ++  Y   G  ++  +++ +MK  G +P+   YN ++D  G+ + +      +  M
Sbjct  395  VFGRLLAGYRDRGEWQKTFQVLKEMKSMGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRM  454

Query  359  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  538
                + PDRV++ +++  + K        + ++  +  G         IM+  +    + 
Sbjct  455  LSEGIEPDRVTWNTLLDCHCKHGRHIVAEEMFEAMEKRGCIPCSTTYNIMINSYGDQERW  514

Query  539  DELVKLLQDLKT  574
            D++ +LL  +K+
Sbjct  515  DDMKRLLGKMKS  526


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/176 (20%), Positives = 78/176 (44%), Gaps = 0/176 (0%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            + + G  S+A       +  G         S+++    + R  EA  L  ++++ G +P 
Sbjct  263  FAKAGDPSRALELLGMAQATGLSAKTATLVSIISALADSARTVEAEALFEELRQSGIKPR  322

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               YN LL  + +   ++  E +  EM++R V PD  +Y+ +I AY  A   ES     +
Sbjct  323  TKAYNALLKGYVKTGPLRDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLK  382

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            + +    + +  + G ++  +    +  +  ++L+++K+   K D + Y   ++  
Sbjct  383  EMEAGDVQPNSFVFGRLLAGYRDRGEWQKTFQVLKEMKSMGVKPDRQFYNVVIDTF  438



>gb|AHC02093.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
oblanceolata]
Length=377

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  40   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  96

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M ++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  97   NIMXDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  156

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  157  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  216

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  217  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  255


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 104/211 (49%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   + ++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  77   ALSVFSEMREIKCLLDLTTCNIMXDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  136

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  137  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  196

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  197  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  256

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  257  HELKSPD------------NIPRDTAIHILA  275


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  164  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  223

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  224  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  279

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  280  IEEATYVFRQXIDAGEVKDITVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  339

Query  611  ALNA  622
             LNA
Sbjct  340  VLNA  343


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  182  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  241

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  242  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQXIDAGEVKDITV  301

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  302  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  361


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 66/140 (47%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  400
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY++
Sbjct  4    YSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASYST  63

Query  401  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  580
            +++ Y + K+    +  + + +      D     IM  V+ ++    E  KL   ++   
Sbjct  64   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMXDVYGQLGMAKEADKLFWGMRKMG  123

Query  581  TKLDERLYRSALNALRDAGL  640
             + +   Y + L    DA L
Sbjct  124  IEPNVVSYNTLLRVYGDAEL  143



>gb|AFV61115.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
macrostachya]
Length=437

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  99   REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  155

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   ++  M+R
Sbjct  156  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFXLMQR  215

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  216  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  275

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++ + A   AGL   AK L
Sbjct  276  AAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRL  314


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (50%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  136  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  195

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  196  VYGDAELFGEAIHLFXLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  255

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  256  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLL  315

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  316  HELKSPD------------NIPRDTAIHILA  334


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/202 (20%), Positives = 98/202 (49%), Gaps = 0/202 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            +++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K 
Sbjct  1    DEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKL  60

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
              + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  SY
Sbjct  61   CDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTASY  120

Query  395  TSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKT  574
            +++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++ 
Sbjct  121  STLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRK  180

Query  575  DETKLDERLYRSALNALRDAGL  640
               + +   Y + L    DA L
Sbjct  181  MGIEPNVVSYNTLLRVYGDAEL  202


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  223  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  282

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T++  + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  283  LRSSGVEIDQVLYQTMIVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  338

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   +V++   ++      D  +   
Sbjct  339  IEEATYVFRQAIDAGEVKDIMVFERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIAL  398

Query  611  ALNA  622
             LNA
Sbjct  399  VLNA  402


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 75/180 (42%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M+ 
Sbjct  241  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMIV  300

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  301  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDIMV  360

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  361  FERMIHLFSKYKKYANVVEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  420



>gb|AFV61116.1| pentatricopeptide repeat-containing protein 123, partial [Aloysia 
virgata]
Length=424

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  103  REARSLISEMRTAGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  159

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  160  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  219

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +V + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  220  KNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDR  279

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ LY++   A   AGL   AK L
Sbjct  280  AAMLFQKLRSSGVEIDQVLYQTMXVAYERAGLVAHAKRL  318


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 104/211 (49%), Gaps = 12/211 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  140  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  199

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +    NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  200  VYGDAELFGEAIHLFRLMQRKNIVQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  259

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M   + +   V    +LL
Sbjct  260  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMXVAYERAGLVAHAKRLL  319

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             +LK+ +            N  RD  + I A
Sbjct  320  HELKSPD------------NIPRDTAIHILA  338


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/204 (20%), Positives = 100/204 (49%), Gaps = 0/204 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            +++++  +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  
Sbjct  3    LFDEMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSR  62

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V+P+  
Sbjct  63   KLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMRTAGVMPNTA  122

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            SY+++++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   +
Sbjct  123  SYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGM  182

Query  569  KTDETKLDERLYRSALNALRDAGL  640
            +    + +   Y + L    DA L
Sbjct  183  RKMGIEPNVVSYNTLLRVYGDAEL  206


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 85/184 (46%), Gaps = 4/184 (2%)
 Frame = +2

Query  71   VTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAK  250
            VTY S++ IY +   + KA     EM+ +G +   + YS++++++GK G+   A  L  K
Sbjct  227  VTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQK  286

Query  251  MKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
            ++  G E +  +Y T+   + RA  +   +++  E+K     PD +   + I   + A  
Sbjct  287  LRSSGVEIDQVLYQTMXVAYERAGLVAHAKRLLHELKS----PDNIPRDTAIHILAGAGR  342

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRS  610
            +E     ++     G   D  +   M+ +FSK  K   ++++   ++      D  +   
Sbjct  343  IEEATYVFRQAIDAGEVKDITVFERMIHLFSKYKKYANVIEVFDKMRGLGYFPDSNVIAL  402

Query  611  ALNA  622
             LNA
Sbjct  403  VLNA  406


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/180 (19%), Positives = 74/180 (41%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G +   V Y +M  
Sbjct  245  ANNLIQEMQNRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQVLYQTMXV  304

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-------------------------------NVWI  286
             Y + G    A RL+ ++K     P                               ++ +
Sbjct  305  AYERAGLVAHAKRLLHELKSPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  364

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  365  FERMIHLFSKYKKYANVIEVFDKMRGLGYFPDSNVIALVLNAYGKLHEFDKANGVYMEMQ  424



>ref|XP_006279580.1| hypothetical protein CARUB_v10025981mg [Capsella rubella]
 gb|EOA12478.1| hypothetical protein CARUB_v10025981mg [Capsella rubella]
Length=708

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 106/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T +++++S+G EP +VT+ ++++ +C+ G +  AE  F  ME++G   C   Y+ M+N
Sbjct  462  AMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEDMFEAMERRGCLPCATTYNIMIN  521

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG   R  +  RL+ KMK +G  PNV  + TL+D++G++       +  +EMK   + P
Sbjct  522  SYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECLEEMKSVGLKP  581

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++    +G K        ++  F +  +  E   +L
Sbjct  582  SSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGEDRRDAEAFAVL  641

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  642  QYMKENGVKPDVVTYTTLMKAL  663


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            + G      T  SI++     G   +AE  F E+ Q G      AY++++  Y KTG  K
Sbjct  296  ATGLSAKTATLVSIISALASSGRTDEAEALFEELRQSGIKPRTKAYNALLKGYVKTGPLK  355

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M++RG  P+   Y+ L+D +  A   +    V KEM+   V P+   ++ ++
Sbjct  356  DAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLL  415

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + Y    E +   +  ++ K  G K DR    +++  F K N +D 
Sbjct  416  AGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDH  461


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/221 (22%), Positives = 104/221 (47%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G +P +  Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  430  VLKEMKSIGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHC  489

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH  A  +   M+ RGC P    YN +++ +G       ++++  +MK + ++P+ V
Sbjct  490  KHGRHIVAEDMFEAMERRGCLPCATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVV  549

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            ++T+++  Y K+      ++  ++ K  G K    M   ++  +++    ++ V   + +
Sbjct  550  THTTLVDVYGKSGRFNDAIECLEEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVM  609

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
             +D  K       S +NA     RDA          E+FAV
Sbjct  610  TSDGLKPSLLALNSLINAFGEDRRDA----------EAFAV  640


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 77/164 (47%), Gaps = 0/164 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G +P    Y ++L  Y + G    AE   SEME++G       YS +++
Sbjct  322  AEALFEELRQSGIKPRTKAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLID  381

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ LL  +      ++  +V KEMK   V P
Sbjct  382  AYVNAGRWESARIVLKEMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKP  441

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            DR  Y  VI  + K   L+  +  +      G + DR     ++
Sbjct  442  DRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLI  485


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 93/211 (44%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ +L  Y   G + K      EM+  G       Y+ +++
Sbjct  392  ARIVLKEMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVID  451

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H +       E +++ M+RR  +P
Sbjct  452  TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEDMFEAMERRGCLP  511

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++Y   +  +   +     K  G   +      +V V+ K  + ++ ++ L
Sbjct  512  CATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECL  571

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            +++K+   K    +Y + +NA    GL  +A
Sbjct  572  EEMKSVGLKPSSTMYNALINAYAQRGLSEQA  602


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 78/176 (44%), Gaps = 0/176 (0%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            + + G  S+A       +  G         S+++    +GR  EA  L  ++++ G +P 
Sbjct  278  FAKSGDPSRALQLLGMAQATGLSAKTATLVSIISALASSGRTDEAEALFEELRQSGIKPR  337

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               YN LL  + +   +K  E +  EM++R V PD  +Y+ +I AY  A   ES     +
Sbjct  338  TKAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLK  397

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            + +    + +  +   ++  +    +  +  ++L+++K+   K D + Y   ++  
Sbjct  398  EMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVIDTF  453



>ref|XP_004145440.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like 
[Cucumis sativus]
 gb|KGN66867.1| hypothetical protein Csa_1G701920 [Cucumis sativus]
Length=576

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 107/209 (51%), Gaps = 0/209 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
             +A  +++++ +Q C+P   T+ +++N   R G+  KAE  F +M++ G++  + AY+++
Sbjct  277  HMAQNIFDEMRTQRCKPNICTFTALVNALAREGLCEKAEEIFEQMQEAGYEPDVYAYNAL  336

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            +  Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++EMKR  +
Sbjct  337  MESYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEEMKRIGI  396

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
             P   S+  ++SAYS A  +  C         +G K D  +   M+ ++ ++ +  ++  
Sbjct  397  TPTMKSHMLLLSAYSSAGNVAKCEDIIGQMHKSGLKPDTFVMNSMLNLYGRLGQFGKMED  456

Query  554  LLQDLKTDETKLDERLYRSALNALRDAGL  640
            L   ++    + D   Y   +N    AG 
Sbjct  457  LFSTMQKGPCRADISTYNILINVYGRAGF  485


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/224 (23%), Positives = 110/224 (49%), Gaps = 35/224 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P  AA ++  +   GCEP + +Y  +++ Y R G++  A+  F EM++ G          
Sbjct  346  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEEMKRIGITPTMKSHML  405

Query  173  -IVAYSS----------------------------MVNMYGKTGRHKEATRLVAKMKERG  265
             + AYSS                            M+N+YG+ G+  +   L + M++  
Sbjct  406  LLSAYSSAGNVAKCEDIIGQMHKSGLKPDTFVMNSMLNLYGRLGQFGKMEDLFSTMQKGP  465

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C  ++  YN L++++GRA  ++++E++++ +  + + PD V++TS I AYS+ K  + C+
Sbjct  466  CRADISTYNILINVYGRAGFVERMEELFQLLPAKNLEPDVVTWTSRIGAYSRKKLYKRCL  525

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTD  577
            + ++     G   D   A +++   S   +++++  +++ +  D
Sbjct  526  ELFEKMIDAGCYPDGGTAKVLLSACSSEEQIEQVTNVVRTMHKD  569


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/217 (24%), Positives = 107/217 (49%), Gaps = 6/217 (3%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMY  205
            + Y +L+   C P + TYA +L  YC+ G+  KAE  F+EM + G     + Y++ ++  
Sbjct  176  STYLELLESHCIPTEDTYALLLKAYCKSGLLEKAEAVFAEMRKYGLSPSAIVYNAYIDGL  235

Query  206  GKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             K G + +A  +  +MK  GC+P    Y  L++++G+ S     + ++ EM+ ++  P+ 
Sbjct  236  VKGGNNVKAVEIFHRMKRDGCQPTTDTYTMLINVYGKESKSHMAQNIFDEMRTQRCKPNI  295

Query  386  VSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELVKL  556
             ++T++++A ++    E   + ++  +  G + D      ++  +S+        E+  L
Sbjct  296  CTFTALVNALAREGLCEKAEEIFEQMQEAGYEPDVYAYNALMESYSRAGFPYGAAEIFSL  355

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
            +Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  356  MQHMGCEP---DRASYNIMVDAYGRAGLHEDAQAVFE  389


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/201 (23%), Positives = 91/201 (45%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  314  AEEIFEQMQEAGYEPDVYAYNALMESYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVD  373

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H++A  +  +MK  G  P +  +  LL  +  A N+ + E +  +M +  + P
Sbjct  374  AYGRAGLHEDAQAVFEEMKRIGITPTMKSHMLLLSAYSSAGNVAKCEDIIGQMHKSGLKP  433

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +       +   +    + D +   I++ V+ +   V+ + +L 
Sbjct  434  DTFVMNSMLNLYGRLGQFGKMEDLFSTMQKGPCRADISTYNILINVYGRAGFVERMEELF  493

Query  560  QDLKTDETKLDERLYRSALNA  622
            Q L     + D   + S + A
Sbjct  494  QLLPAKNLEPDVVTWTSRIGA  514


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 80/179 (45%), Gaps = 0/179 (0%)
 Frame = +2

Query  146  MEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASN  325
            M +  F   ++ Y+ +++ YG+   +K+      ++ E  C P    Y  LL  + ++  
Sbjct  146  MNKSTFRPDVIVYNLLMDAYGQRSLYKDVESTYLELLESHCIPTEDTYALLLKAYCKSGL  205

Query  326  MKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGI  505
            +++ E V+ EM++  + P  + Y + I    K       V+ +   K +G +       +
Sbjct  206  LEKAEAVFAEMRKYGLSPSAIVYNAYIDGLVKGGNNVKAVEIFHRMKRDGCQPTTDTYTM  265

Query  506  MVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAVA  682
            ++ V+ K +K      +  +++T   K +   + + +NAL   GL  +A+ + E    A
Sbjct  266  LINVYGKESKSHMAQNIFDEMRTQRCKPNICTFTALVNALAREGLCEKAEEIFEQMQEA  324



>ref|XP_010094587.1| hypothetical protein L484_024883 [Morus notabilis]
 gb|EXB56341.1| hypothetical protein L484_024883 [Morus notabilis]
Length=734

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 105/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +E+++  G +P  VT+ +++N +C+ G + +AE  F EM+++G+  C   Y+ ++N
Sbjct  462  AMATFERMILDGIQPDTVTWNTLINCHCKAGRHERAEELFEEMQERGYPPCATTYNILIN  521

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +G+  R  +   L+ KM+ +G  PNV  Y TL+DI+G++          ++MK   + P
Sbjct  522  SFGEQERWDDVKVLLGKMQSQGLLPNVVTYTTLIDIYGQSGRFNDAMDCLQDMKTSGLKP  581

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  +  ++  + +G K        ++  F +  +  E   +L
Sbjct  582  SSTMYNALINAYAQRGLSEQALNAFRLMRGDGLKPSILALNSLINAFGEDRRDAEAFAVL  641

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  642  QYMKENGLKPDVVTYTTLMKAL  663


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/221 (24%), Positives = 100/221 (45%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V  ++ S G  P +  Y  +++ + +      A  TF  M   G     V +++++N + 
Sbjct  430  VLREMKSSGVRPDRHFYNVMIDTFGKFNCLDHAMATFERMILDGIQPDTVTWNTLINCHC  489

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH+ A  L  +M+ERG  P    YN L++  G       V+ +  +M+ + ++P+ V
Sbjct  490  KAGRHERAEELFEEMQERGYPPCATTYNILINSFGEQERWDDVKVLLGKMQSQGLLPNVV  549

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT++I  Y ++      +   QD K +G K    M   ++  +++    ++ +   + +
Sbjct  550  TYTTLIDIYGQSGRFNDAMDCLQDMKTSGLKPSSTMYNALINAYAQRGLSEQALNAFRLM  609

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
            + D  K       S +NA     RDA          E+FAV
Sbjct  610  RGDGLKPSILALNSLINAFGEDRRDA----------EAFAV  640


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 99/219 (45%), Gaps = 0/219 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A      + + G  P   T  ++++     G   +AE  F E++  G      AY++
Sbjct  284  PSQAMHFLAVVQAMGLSPKTATLTAVISALGNSGRIVEAEALFEEIKDGGLQPRTRAYNA  343

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y K    K+A  +V++M+  G  P+   Y+ L+D +  A   +    V KEM+   
Sbjct  344  LLKGYVKASSLKDAESVVSEMEMNGVSPDEHTYSLLIDAYANAGRWESARIVLKEMEASN  403

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            V P+   ++ ++++Y    E +   +  ++ K +G + DR    +M+  F K N +D  +
Sbjct  404  VQPNSYVFSRILASYRDRGEWQKTFQVLREMKSSGVRPDRHFYNVMIDTFGKFNCLDHAM  463

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
               + +  D  + D   + + +N    AG   RA+ L E
Sbjct  464  ATFERMILDGIQPDTVTWNTLINCHCKAGRHERAEELFE  502


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 85/184 (46%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G +P    Y ++L  Y +      AE   SEME  G       YS +++
Sbjct  322  AEALFEEIKDGGLQPRTRAYNALLKGYVKASSLKDAESVVSEMEMNGVSPDEHTYSLLID  381

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ +L  +      ++  +V +EMK   V P
Sbjct  382  AYANAGRWESARIVLKEMEASNVQPNSYVFSRILASYRDRGEWQKTFQVLREMKSSGVRP  441

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR  Y  +I  + K   L+  +  ++   L+G + D      ++    K  + +   +L 
Sbjct  442  DRHFYNVMIDTFGKFNCLDHAMATFERMILDGIQPDTVTWNTLINCHCKAGRHERAEELF  501

Query  560  QDLK  571
            ++++
Sbjct  502  EEMQ  505


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 59/117 (50%), Gaps = 0/117 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            + + + G +P    Y +++N Y + G+  +A   F  M   G    I+A +S++N +G+ 
Sbjct  572  QDMKTSGLKPSSTMYNALINAYAQRGLSEQALNAFRLMRGDGLKPSILALNSLINAFGED  631

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             R  EA  ++  MKE G +P+V  Y TL+    R     +V  V++EM      PDR
Sbjct  632  RRDAEAFAVLQYMKENGLKPDVVTYTTLMKALNRVDKFDKVPVVYEEMISSGCTPDR  688


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 85/185 (46%), Gaps = 0/185 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V  ++   G  P + TY+ +++ Y   G +  A +   EME          +S ++ 
Sbjct  357  AESVVSEMEMNGVSPDEHTYSLLIDAYANAGRWESARIVLKEMEASNVQPNSYVFSRILA  416

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G  ++  +++ +MK  G  P+   YN ++D  G+ + +      ++ M    + P
Sbjct  417  SYRDRGEWQKTFQVLREMKSSGVRPDRHFYNVMIDTFGKFNCLDHAMATFERMILDGIQP  476

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++ ++I+ + KA   E   + +++ +  G         I++  F +  + D++  LL
Sbjct  477  DTVTWNTLINCHCKAGRHERAEELFEEMQERGYPPCATTYNILINSFGEQERWDDVKVLL  536

Query  560  QDLKT  574
              +++
Sbjct  537  GKMQS  541



>emb|CDX84260.1| BnaC04g10220D [Brassica napus]
Length=643

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 112/213 (53%), Gaps = 0/213 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++ ++ S  C+P   TY +++N + R G+  KAE  F ++++ G +  +  Y++++  Y 
Sbjct  337  LFCEMRSHQCKPNICTYTALVNAFAREGLCQKAEEVFEQLQEDGLEPDVYVYNALMEAYS  396

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            + G    A  + + M+  GCEP+   YN ++D +GRA      E V+++MK+  + P   
Sbjct  397  RAGYPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEQMKKLGISPTMK  456

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            S+  ++SAYS+A+++  C    ++   NG + D  +   M+ ++ ++ +  ++ K L ++
Sbjct  457  SHMLLLSAYSRARDVTKCESIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKTLAEM  516

Query  569  KTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
            +    K D   Y   +N    AG   R + L E
Sbjct  517  EKGRCKADISTYNILINVYGKAGYLERVEELFE  549


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/221 (24%), Positives = 117/221 (53%), Gaps = 35/221 (16%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKC------  172
            P  AA ++  +   GCEP + +Y  +++ Y R G++S AE  F +M++ G          
Sbjct  401  PYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEQMKKLGISPTMKSHML  460

Query  173  -IVAYS----------------------------SMVNMYGKTGRHKEATRLVAKMKERG  265
             + AYS                            SM+N+YG+ G+  +  + +A+M++  
Sbjct  461  LLSAYSRARDVTKCESIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKTLAEMEKGR  520

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
            C+ ++  YN L++++G+A  +++VE++++E+K RK+ PD V++TS +  YS+ K    C+
Sbjct  521  CKADISTYNILINVYGKAGYLERVEELFEEVKERKLTPDVVTWTSRMGGYSRKKLYVKCL  580

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            + +++   +G   D   A +++   +   +V+++ ++++ +
Sbjct  581  EIFEEMIDSGCVPDGGTAKVLLKACASEEQVEQVTEVIRTM  621


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 89/184 (48%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E+L   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  369  AEEVFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEIFSLMQHMGCEPDRASYNIMVD  428

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H +A  +  +MK+ G  P +  +  LL  + RA ++ + E + KEM    V P
Sbjct  429  AYGRAGLHSDAEAVFEQMKKLGISPTMKSHMLLLSAYSRARDVTKCESIVKEMSENGVEP  488

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  +     K   + +    K D +   I++ V+ K   ++ + +L 
Sbjct  489  DTFVLNSMLNLYGRLGQFTKMEKTLAEMEKGRCKADISTYNILINVYGKAGYLERVEELF  548

Query  560  QDLK  571
            +++K
Sbjct  549  EEVK  552


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 107/220 (49%), Gaps = 7/220 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV-  196
            A ++Y +L+   C P + TYA ++  YC  G+  KAE    EM+          Y++ + 
Sbjct  228  AESLYVQLLESRCVPTEDTYALLVKAYCLAGLIEKAEAVLIEMQNHHVTPSATVYNAYIE  287

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
             +  + G  +EA  +  +MK   C+P    YN +++++G+AS      K++ EM+  +  
Sbjct  288  GLTKRKGNTEEAIDVFQRMKRERCKPTTETYNLMINLYGKASKSYMSWKLFCEMRSHQCK  347

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDEL  547
            P+  +YT++++A+++    +   + ++  + +G + D  +   ++  +S+        E+
Sbjct  348  PNICTYTALVNAFAREGLCQKAEEVFEQLQEDGLEPDVYVYNALMEAYSRAGYPYGAAEI  407

Query  548  VKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
              L+Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  408  FSLMQHMGCEP---DRASYNIMVDAYGRAGLHSDAEAVFE  444


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 75/166 (45%), Gaps = 1/166 (1%)
 Frame = +2

Query  146  MEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASN  325
            + +  F   ++ ++ +++ YG+  R+KEA  L  ++ E  C P    Y  L+  +  A  
Sbjct  200  LRRSSFQPDVICFNLLIDAYGQKLRYKEAESLYVQLLESRCVPTEDTYALLVKAYCLAGL  259

Query  326  MKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAK-ELESCVKYYQDFKLNGGKTDRAMAG  502
            +++ E V  EM+   V P    Y + I   +K K   E  +  +Q  K    K       
Sbjct  260  IEKAEAVLIEMQNHHVTPSATVYNAYIEGLTKRKGNTEEAIDVFQRMKRERCKPTTETYN  319

Query  503  IMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
            +M+ ++ K +K     KL  ++++ + K +   Y + +NA    GL
Sbjct  320  LMINLYGKASKSYMSWKLFCEMRSHQCKPNICTYTALVNAFAREGL  365



>gb|AFV61120.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
camara]
Length=381

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  56   REARSLISEMKTAGVXPNTTSYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  112

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  113  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  172

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  173  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  232

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  233  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  93   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  152

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  153  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  212

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  213  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  272

Query  560  QDLK  571
             +LK
Sbjct  273  HELK  276


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (46%), Gaps = 4/201 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  163  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  222

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  223  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  278

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  279  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIHLLSKYKKYSNVVEVF  338

Query  560  QDLKTDETKLDERLYRSALNA  622
              ++      D  +    LNA
Sbjct  339  DKMRGLGYFPDSNVITVVLNA  359


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 75/156 (48%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EMK   V P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTAGVXPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 80/180 (44%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS-------EMEQKGFDKCIV  178
            A  + +++ S+G EP  +TY++I++I+ ++G   +A M F        E++Q  F   IV
Sbjct  198  ANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIV  257

Query  179  AY------------------------SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            AY                         + +++    GR +EAT +  +  + G   ++ +
Sbjct  258  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  317

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD    T V++AY K +E +     Y + +
Sbjct  318  FERMIHLLSKYKKYSNVVEVFDKMRGLGYFPDSNVITVVLNAYGKLQEFDKANDVYMEMQ  377



>gb|EEC80183.1| hypothetical protein OsI_22045 [Oryza sativa Indica Group]
Length=577

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 110/202 (54%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++++LV +G +P  VTY S+L  + + G   + E    E+ + GF K  + Y++M++
Sbjct  120  AELMFKELVEKGFQPDAVTYNSLLYAFAKEGDVERVERVCEELVKAGFRKDGITYNTMIH  179

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGK GR   A  L  +M+  GC P+   Y  L+D  G+   + +  KV +EM    + P
Sbjct  180  MYGKMGRLDLALGLYDEMRAIGCTPDAVTYTVLVDSLGKMDRISEAGKVLEEMADAGLKP  239

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+++++I AY+K+   +   + +     +G K DR    +M+ VF++ ++  +L+ L 
Sbjct  240  TLVTFSALICAYAKSGRQDDAERTFDRMVESGVKPDRLAYLVMLDVFARSDETRKLMVLY  299

Query  560  QDLKTDETKLDERLYRSALNAL  625
            + +  D  K D+ LY+  L AL
Sbjct  300  RAMIKDGYKPDDGLYQVLLAAL  321


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 98/204 (48%), Gaps = 2/204 (1%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSK--AEMTFSEMEQKGFDKCIVAYSSM  193
            A  + + +  Q  EP  V++ +++N   + G  +   A     E+ Q G     + Y+++
Sbjct  13   ARQLLDAMRDQDIEPDLVSFNTLINARAKSGCLAAGVALELLHEVRQAGLRPDAITYNTL  72

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            ++   +     +A  +  +M    C P++W YN ++ +HGR    ++ E ++KE+  +  
Sbjct  73   ISACSQGSNLDDAVAVFEEMIASECRPDLWTYNAMVSVHGRCGKAQEAELMFKELVEKGF  132

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
             PD V+Y S++ A++K  ++E   +  ++    G + D      M+ ++ KM ++D  + 
Sbjct  133  QPDAVTYNSLLYAFAKEGDVERVERVCEELVKAGFRKDGITYNTMIHMYGKMGRLDLALG  192

Query  554  LLQDLKTDETKLDERLYRSALNAL  625
            L  +++      D   Y   +++L
Sbjct  193  LYDEMRAIGCTPDAVTYTVLVDSL  216


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 94/184 (51%), Gaps = 0/184 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            VA  +  ++   G  P  +TY ++++   +      A   F EM        +  Y++MV
Sbjct  49   VALELLHEVRQAGLRPDAITYNTLISACSQGSNLDDAVAVFEEMIASECRPDLWTYNAMV  108

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +++G+ G+ +EA  +  ++ E+G +P+   YN+LL    +  ++++VE+V +E+ +    
Sbjct  109  SVHGRCGKAQEAELMFKELVEKGFQPDAVTYNSLLYAFAKEGDVERVERVCEELVKAGFR  168

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
             D ++Y ++I  Y K   L+  +  Y + +  G   D     ++V    KM+++ E  K+
Sbjct  169  KDGITYNTMIHMYGKMGRLDLALGLYDEMRAIGCTPDAVTYTVLVDSLGKMDRISEAGKV  228

Query  557  LQDL  568
            L+++
Sbjct  229  LEEM  232


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 79/156 (51%), Gaps = 4/156 (3%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  +Y+++ + GC P  VTY  +++   ++   S+A     EM   G    +V +S+++
Sbjct  189  LALGLYDEMRAIGCTPDAVTYTVLVDSLGKMDRISEAGKVLEEMADAGLKPTLVTFSALI  248

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y K+GR  +A R   +M E G +P+   Y  +LD+  R+   +++  +++ M +    
Sbjct  249  CAYAKSGRQDDAERTFDRMVESGVKPDRLAYLVMLDVFARSDETRKLMVLYRAMIKDGYK  308

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQD----FKLN  472
            PD   Y  +++A +K  E +      QD    F++N
Sbjct  309  PDDGLYQVLLAALAKGNEHDEIEGVIQDMEAVFEMN  344


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/150 (23%), Positives = 74/150 (49%), Gaps = 2/150 (1%)
 Frame = +2

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ--VEKVWKEMKRR  367
            + +Y ++GR  +A +L+  M+++  EP++  +NTL++   ++  +      ++  E+++ 
Sbjct  1    MGVYARSGRFDDARQLLDAMRDQDIEPDLVSFNTLINARAKSGCLAAGVALELLHEVRQA  60

Query  368  KVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDEL  547
             + PD ++Y ++ISA S+   L+  V  +++   +  + D      MV V  +  K  E 
Sbjct  61   GLRPDAITYNTLISACSQGSNLDDAVAVFEEMIASECRPDLWTYNAMVSVHGRCGKAQEA  120

Query  548  VKLLQDLKTDETKLDERLYRSALNALRDAG  637
              + ++L     + D   Y S L A    G
Sbjct  121  ELMFKELVEKGFQPDAVTYNSLLYAFAKEG  150



>gb|AFV61146.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
rhodocnemis]
Length=345

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  39   REARSLISEMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  95

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  96   NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  155

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  156  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  215

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  216  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  254


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/207 (24%), Positives = 107/207 (52%), Gaps = 6/207 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  76   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  135

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  136  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  195

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  196  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  255

Query  560  QDLK-TDETKLDERLYRSALNALRDAG  637
             +LK  D    D     +A++ L  AG
Sbjct  256  HELKRPDNIPRD-----TAIHILAGAG  277


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (46%), Gaps = 4/201 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  146  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  205

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  206  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  261

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  262  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIHLLSKYKKYSNVVEVF  321

Query  560  QDLKTDETKLDERLYRSALNA  622
              ++      D  +    LNA
Sbjct  322  DKMRGLGYFPDSDVIAIVLNA  342


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/140 (21%), Positives = 67/140 (48%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  400
            + +A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY++
Sbjct  3    YSKAISIFSRLKRLGFMPDLVAYNAMINVFGKAKLFREARSLISEMKTAGVMPNTTSYST  62

Query  401  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDE  580
            +++ Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++   
Sbjct  63   LLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMG  122

Query  581  TKLDERLYRSALNALRDAGL  640
             + +   Y + L    DA L
Sbjct  123  IEPNVVSYNTLLRVYGDAEL  142


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 73/165 (44%), Gaps = 31/165 (19%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS-------EMEQKGFDKCIV  178
            A  + +++ S+G EP  +TY++I++I+ ++G   +A M F        E++Q  F   IV
Sbjct  181  ANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIV  240

Query  179  AY------------------------SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            AY                         + +++    GR +EAT +  +  + G   ++ +
Sbjct  241  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  300

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
            +  ++ +  +      V +V+ +M+     PD      V++AY K
Sbjct  301  FERMIHLLSKYKKYSNVVEVFDKMRGLGYFPDSDVIAIVLNAYGK  345



>gb|KDP36804.1| hypothetical protein JCGZ_08095 [Jatropha curcas]
Length=705

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 105/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +++++S+G +P  VT+ ++++ +C+   + +AE  F EM +KGF  C   ++ M+N
Sbjct  460  AMATFDRMISEGIQPDAVTWNTLIDSHCKAERHDRAEELFEEMMEKGFSPCTTTFNIMIN  519

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +G+  R  +   L+ KM+  G  PN   Y TL+DI+G++       +  ++MK   + P
Sbjct  520  SFGEQQRWDDVKSLMGKMRSLGLLPNAVTYTTLVDIYGQSGRFNDAIECLEDMKSAGLKP  579

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++  + +G K        ++  F +  +  E   +L
Sbjct  580  SSTMYNALINAYAQRGLSEQAVNAFRVMRADGLKPSLLALNSLINAFGEDRRDAEAFSVL  639

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K ++ K D   Y + + AL
Sbjct  640  QYMKENDLKPDVVTYTTLMKAL  661


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/208 (25%), Positives = 100/208 (48%), Gaps = 2/208 (1%)
 Frame = +2

Query  50   QGC--EPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRH  223
            QGC   PG  T  ++++     G   +AE  F EM+  G      AY++++  Y K G  
Sbjct  293  QGCGLSPGPATLVAVISALGDSGRTVEAEAIFEEMKDNGLKPRTRAYNALLKGYVKAGSL  352

Query  224  KEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSV  403
            K+A  +V++M++ G  P+   Y+ L+D +  A   +    V KEM+   V+P+   ++ +
Sbjct  353  KDAEFIVSEMEKTGVSPDEHTYSLLIDAYANAGRWESARIVLKEMEASNVMPNSYVFSRI  412

Query  404  ISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDET  583
            +++Y    E +   +  ++ K  G + DR    +M+  F K N +D  +     + ++  
Sbjct  413  LASYRDRGEWQKSFQVLREMKNIGVRPDRHFYNVMIDTFGKFNCLDHAMATFDRMISEGI  472

Query  584  KLDERLYRSALNALRDAGLEIRAKWLQE  667
            + D   + + +++   A    RA+ L E
Sbjct  473  QPDAVTWNTLIDSHCKAERHDRAEELFE  500


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/198 (21%), Positives = 88/198 (44%), Gaps = 4/198 (2%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P +  Y  +++ + +      A  TF  M  +G     V ++++++ + K  RH  A
Sbjct  436  GVRPDRHFYNVMIDTFGKFNCLDHAMATFDRMISEGIQPDAVTWNTLIDSHCKAERHDRA  495

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
              L  +M E+G  P    +N +++  G       V+ +  +M+   ++P+ V+YT+++  
Sbjct  496  EELFEEMMEKGFSPCTTTFNIMINSFGEQQRWDDVKSLMGKMRSLGLLPNAVTYTTLVDI  555

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
            Y ++      ++  +D K  G K    M   ++  +++    ++ V   + ++ D  K  
Sbjct  556  YGQSGRFNDAIECLEDMKSAGLKPSSTMYNALINAYAQRGLSEQAVNAFRVMRADGLKPS  615

Query  593  ERLYRSALNAL----RDA  634
                 S +NA     RDA
Sbjct  616  LLALNSLINAFGEDRRDA  633


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 76/156 (49%), Gaps = 3/156 (2%)
 Frame = +2

Query  38   KLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTG  217
            K+ S G  P  VTY ++++IY + G ++ A     +M+  G       Y++++N Y + G
Sbjct  536  KMRSLGLLPNAVTYTTLVDIYGQSGRFNDAIECLEDMKSAGLKPSSTMYNALINAYAQRG  595

Query  218  RHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYT  397
              ++A      M+  G +P++   N+L++  G      +   V + MK   + PD V+YT
Sbjct  596  LSEQAVNAFRVMRADGLKPSLLALNSLINAFGEDRRDAEAFSVLQYMKENDLKPDVVTYT  655

Query  398  SVISAYSKAKELESCVKYYQDFKLNGGKTD---RAM  496
            +++ A  +  + +     Y++  L G   D   RAM
Sbjct  656  TLMKALIRVDKFQKVPSVYEEMILAGCIPDSKARAM  691


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 82/183 (45%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G +P    Y ++L  Y + G    AE   SEME+ G       YS +++
Sbjct  320  AEAIFEEMKDNGLKPRTRAYNALLKGYVKAGSLKDAEFIVSEMEKTGVSPDEHTYSLLID  379

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+     PN ++++ +L  +      ++  +V +EMK   V P
Sbjct  380  AYANAGRWESARIVLKEMEASNVMPNSYVFSRILASYRDRGEWQKSFQVLREMKNIGVRP  439

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR  Y  +I  + K   L+  +  +      G + D      ++    K  + D   +L 
Sbjct  440  DRHFYNVMIDTFGKFNCLDHAMATFDRMISEGIQPDAVTWNTLIDSHCKAERHDRAEELF  499

Query  560  QDL  568
            +++
Sbjct  500  EEM  502


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E + S G +P    Y +++N Y + G+  +A   F  M   G    ++A +S++N +G+ 
Sbjct  570  EDMKSAGLKPSSTMYNALINAYAQRGLSEQAVNAFRVMRADGLKPSLLALNSLINAFGED  629

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  382
             R  EA  ++  MKE   +P+V  Y TL+    R    ++V  V++EM     +PD
Sbjct  630  RRDAEAFSVLQYMKENDLKPDVVTYTTLMKALIRVDKFQKVPSVYEEMILAGCIPD  685


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/185 (19%), Positives = 84/185 (45%), Gaps = 0/185 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +  ++   G  P + TY+ +++ Y   G +  A +   EME          +S ++ 
Sbjct  355  AEFIVSEMEKTGVSPDEHTYSLLIDAYANAGRWESARIVLKEMEASNVMPNSYVFSRILA  414

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G  +++ +++ +MK  G  P+   YN ++D  G+ + +      +  M    + P
Sbjct  415  SYRDRGEWQKSFQVLREMKNIGVRPDRHFYNVMIDTFGKFNCLDHAMATFDRMISEGIQP  474

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++ ++I ++ KA+  +   + +++    G         IM+  F +  + D++  L+
Sbjct  475  DAVTWNTLIDSHCKAERHDRAEELFEEMMEKGFSPCTTTFNIMINSFGEQQRWDDVKSLM  534

Query  560  QDLKT  574
              +++
Sbjct  535  GKMRS  539


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/211 (20%), Positives = 94/211 (45%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +    P    ++ IL  Y   G + K+     EM+  G       Y+ M++
Sbjct  390  ARIVLKEMEASNVMPNSYVFSRILASYRDRGEWQKSFQVLREMKNIGVRPDRHFYNVMID  449

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G +P+   +NTL+D H +A    + E++++EM  +   P
Sbjct  450  TFGKFNCLDHAMATFDRMISEGIQPDAVTWNTLIDSHCKAERHDRAEELFEEMMEKGFSP  509

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               ++  +I+++ + +  +         +  G   +      +V ++ +  + ++ ++ L
Sbjct  510  CTTTFNIMINSFGEQQRWDDVKSLMGKMRSLGLLPNAVTYTTLVDIYGQSGRFNDAIECL  569

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            +D+K+   K    +Y + +NA    GL  +A
Sbjct  570  EDMKSAGLKPSSTMYNALINAYAQRGLSEQA  600



>ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial-like [Citrus sinensis]
Length=704

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 107/202 (53%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +++++S+G EP  +T+ ++++ + + G Y +AE  F EM+++G+  C   Y+ M+N
Sbjct  459  AMAAFDRMLSEGIEPDTITWNTLIDCHFKCGRYDRAEELFEEMQERGYFPCTTTYNIMIN  518

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            + G+  R ++  RL+  M+ +G  PNV  Y TL+DI+G++       +  + MK   + P
Sbjct  519  LLGEQERWEDVKRLLGNMRAQGLLPNVVTYTTLVDIYGQSGRFDDAIECLEVMKAAGLKP  578

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    +  V  ++  + +G K        ++  F +  +  E   +L
Sbjct  579  SSTMYNALINAYARRGLSDQAVNAFRVMRTDGLKPSNLALNSLINAFGEDQRDAEAFAVL  638

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  639  QYMKENGLKPDVVTYTTLMKAL  660


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 104/221 (47%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G EP    Y  +++ + +      A   F  M  +G +   + ++++++ + 
Sbjct  427  VLKEMKSSGVEPDTHFYNVMIDTFGKYNCLHHAMAAFDRMLSEGIEPDTITWNTLIDCHF  486

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GR+  A  L  +M+ERG  P    YN ++++ G     + V+++   M+ + ++P+ V
Sbjct  487  KCGRYDRAEELFEEMQERGYFPCTTTYNIMINLLGEQERWEDVKRLLGNMRAQGLLPNVV  546

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT+++  Y ++   +  ++  +  K  G K    M   ++  +++    D+ V   + +
Sbjct  547  TYTTLVDIYGQSGRFDDAIECLEVMKAAGLKPSSTMYNALINAYARRGLSDQAVNAFRVM  606

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
            +TD  K       S +NA     RDA          E+FAV
Sbjct  607  RTDGLKPSNLALNSLINAFGEDQRDA----------EAFAV  637


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 76/160 (48%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P   TYA+++      G   +AE  F E+++ G      AY++++  Y K G  K+A
Sbjct  295  GLSPKTATYAAVITALSNSGRTIEAEAVFEELKESGLKPRTKAYNALLKGYVKMGYLKDA  354

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
              +V++M+  G  P+   Y+ L+D +  A   +    V KEM+     P+   Y+ +++ 
Sbjct  355  EFVVSEMERSGVLPDEHTYSLLIDAYANAGRWESARIVLKEMEVSHAKPNSFIYSRILAG  414

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            Y    E +   +  ++ K +G + D     +M+  F K N
Sbjct  415  YRDRGEWQRTFQVLKEMKSSGVEPDTHFYNVMIDTFGKYN  454


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 92/211 (44%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++     +P    Y+ IL  Y   G + +      EM+  G +     Y+ M++
Sbjct  389  ARIVLKEMEVSHAKPNSFIYSRILAGYRDRGEWQRTFQVLKEMKSSGVEPDTHFYNVMID  448

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H +     + E++++EM+ R   P
Sbjct  449  TFGKYNCLHHAMAAFDRMLSEGIEPDTITWNTLIDCHFKCGRYDRAEELFEEMQERGYFP  508

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I+   + +  E   +   + +  G   +      +V ++ +  + D+ ++ L
Sbjct  509  CTTTYNIMINLLGEQERWEDVKRLLGNMRAQGLLPNVVTYTTLVDIYGQSGRFDDAIECL  568

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            + +K    K    +Y + +NA    GL  +A
Sbjct  569  EVMKAAGLKPSSTMYNALINAYARRGLSDQA  599


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 83/184 (45%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E+L   G +P    Y ++L  Y ++G    AE   SEME+ G       YS +++
Sbjct  319  AEAVFEELKESGLKPRTKAYNALLKGYVKMGYLKDAEFVVSEMERSGVLPDEHTYSLLID  378

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN +IY+ +L  +      ++  +V KEMK   V P
Sbjct  379  AYANAGRWESARIVLKEMEVSHAKPNSFIYSRILAGYRDRGEWQRTFQVLKEMKSSGVEP  438

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D   Y  +I  + K   L   +  +      G + D      ++    K  + D   +L 
Sbjct  439  DTHFYNVMIDTFGKYNCLHHAMAAFDRMLSEGIEPDTITWNTLIDCHFKCGRYDRAEELF  498

Query  560  QDLK  571
            ++++
Sbjct  499  EEMQ  502


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 58/117 (50%), Gaps = 0/117 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E + + G +P    Y +++N Y R G+  +A   F  M   G     +A +S++N +G+ 
Sbjct  569  EVMKAAGLKPSSTMYNALINAYARRGLSDQAVNAFRVMRTDGLKPSNLALNSLINAFGED  628

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             R  EA  ++  MKE G +P+V  Y TL+    R     +V  V++EM      PDR
Sbjct  629  QRDAEAFAVLQYMKENGLKPDVVTYTTLMKALIRVDKFHKVPAVYEEMISSGCTPDR  685


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 83/177 (47%), Gaps = 2/177 (1%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQK-GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEP  274
            + + G  SKA M F  M Q  G       Y++++     +GR  EA  +  ++KE G +P
Sbjct  275  FAKAGDASKA-MRFLGMAQGVGLSPKTATYAAVITALSNSGRTIEAEAVFEELKESGLKP  333

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
                YN LL  + +   +K  E V  EM+R  V+PD  +Y+ +I AY+ A   ES     
Sbjct  334  RTKAYNALLKGYVKMGYLKDAEFVVSEMERSGVLPDEHTYSLLIDAYANAGRWESARIVL  393

Query  455  QDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            ++ +++  K +  +   ++  +    +     ++L+++K+   + D   Y   ++  
Sbjct  394  KEMEVSHAKPNSFIYSRILAGYRDRGEWQRTFQVLKEMKSSGVEPDTHFYNVMIDTF  450



>gb|KDP26340.1| hypothetical protein JCGZ_22312 [Jatropha curcas]
Length=577

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 112/208 (54%), Gaps = 0/208 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  ++ ++ +Q C+P   TY +++N + R G+  KAE  F ++++ G +  + AY++++
Sbjct  278  MALKLFNEMKTQKCKPNICTYTALMNAFAREGLCEKAEEIFEQLQEDGHEPDVYAYNALM  337

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++EMKR  + 
Sbjct  338  EAYSRAGFPFGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEEMKRLGIT  397

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYSKA  +  C +   +   +G + D  +   M+ ++ ++ + +++ ++
Sbjct  398  PTMKSHMLLLSAYSKAGNVTKCEEIVNELHESGLEPDTFVLNSMLNLYGRLGQFEKMEEV  457

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L  ++    + D   Y   +N    AG 
Sbjct  458  LTVMEKGPYETDISTYNILINIYGRAGF  485


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 109/217 (50%), Gaps = 6/217 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            R A + Y +L+   C P + TYA +L  YC  G+  KAE  F+EM + G     + Y++ 
Sbjct  172  RKAESAYFELLEARCVPTEDTYALLLKAYCMSGLLEKAEAVFAEMRKYGLPPSAIVYNAY  231

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            ++   K+G  + A  +  +MK   C+P+   Y  L+++HG+AS      K++ EMK +K 
Sbjct  232  IDGLMKSGNPQRAVEIFQRMKRDCCQPSTETYTLLINLHGKASQSYMALKLFNEMKTQKC  291

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDE  544
             P+  +YT++++A+++    E   + ++  + +G + D      ++  +S+        E
Sbjct  292  KPNICTYTALMNAFAREGLCEKAEEIFEQLQEDGHEPDVYAYNALMEAYSRAGFPFGAAE  351

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
            +  L+Q +  +    D   Y   ++A   AGL   A+
Sbjct  352  IFSLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQ  385


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 100/183 (55%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E++   G  P   ++  +L+ Y + G  +K E   +E+ + G +      +SM+N
Sbjct  384  AQAVFEEMKRLGITPTMKSHMLLLSAYSKAGNVTKCEEIVNELHESGLEPDTFVLNSMLN  443

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG+ G+ ++   ++  M++   E ++  YN L++I+GRA    ++E +++ +  + + P
Sbjct  444  LYGRLGQFEKMEEVLTVMEKGPYETDISTYNILINIYGRAGFFDKMEDLFQSLDTKSLKP  503

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++TS + AYS+ K    C++ ++     G   D   A +++   S  N+++++  ++
Sbjct  504  DVVTWTSRLGAYSRKKLYTRCLEIFEKMIDAGCHPDGRTAKVLLSACSNDNQIEQVTNVI  563

Query  560  QDL  568
            + +
Sbjct  564  RTM  566


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 94/201 (47%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G EP    Y +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  314  AEEIFEQLQEDGHEPDVYAYNALMEAYSRAGFPFGAAEIFSLMQHMGCEPDRASYNIMVD  373

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H++A  +  +MK  G  P +  +  LL  + +A N+ + E++  E+    + P
Sbjct  374  AYGRAGLHEDAQAVFEEMKRLGITPTMKSHMLLLSAYSKAGNVTKCEEIVNELHESGLEP  433

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  + E   +     +    +TD +   I++ ++ +    D++  L 
Sbjct  434  DTFVLNSMLNLYGRLGQFEKMEEVLTVMEKGPYETDISTYNILINIYGRAGFFDKMEDLF  493

Query  560  QDLKTDETKLDERLYRSALNA  622
            Q L T   K D   + S L A
Sbjct  494  QSLDTKSLKPDVVTWTSRLGA  514


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/203 (23%), Positives = 99/203 (49%), Gaps = 0/203 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P+ A  +++++    C+P   TY  ++N++ +      A   F+EM+ +     I  Y++
Sbjct  241  PQRAVEIFQRMKRDCCQPSTETYTLLINLHGKASQSYMALKLFNEMKTQKCKPNICTYTA  300

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++N + + G  ++A  +  +++E G EP+V+ YN L++ + RA       +++  M+   
Sbjct  301  LMNAFAREGLCEKAEEIFEQLQEDGHEPDVYAYNALMEAYSRAGFPFGAAEIFSLMQHMG  360

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
              PDR SY  ++ AY +A   E     +++ K  G         +++  +SK   V +  
Sbjct  361  CEPDRASYNIMVDAYGRAGLHEDAQAVFEEMKRLGITPTMKSHMLLLSAYSKAGNVTKCE  420

Query  551  KLLQDLKTDETKLDERLYRSALN  619
            +++ +L     + D  +  S LN
Sbjct  421  EIVNELHESGLEPDTFVLNSMLN  443


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 93/192 (48%), Gaps = 6/192 (3%)
 Frame = +2

Query  86   ILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVNMYGKTGRHKEATRLVAKMK  256
            +++ Y R  +Y KAE  + E+ +    +C+     Y+ ++  Y  +G  ++A  + A+M+
Sbjct  161  VIDAYGRKSLYRKAESAYFELLEA---RCVPTEDTYALLLKAYCMSGLLEKAEAVFAEMR  217

Query  257  ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
            + G  P+  +YN  +D   ++ N ++  ++++ MKR    P   +YT +I+ + KA +  
Sbjct  218  KYGLPPSAIVYNAYIDGLMKSGNPQRAVEIFQRMKRDCCQPSTETYTLLINLHGKASQSY  277

Query  437  SCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSAL  616
              +K + + K    K +      ++  F++    ++  ++ + L+ D  + D   Y + +
Sbjct  278  MALKLFNEMKTQKCKPNICTYTALMNAFAREGLCEKAEEIFEQLQEDGHEPDVYAYNALM  337

Query  617  NALRDAGLEIRA  652
             A   AG    A
Sbjct  338  EAYSRAGFPFGA  349


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/163 (20%), Positives = 76/163 (47%), Gaps = 0/163 (0%)
 Frame = +2

Query  152  QKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK  331
            +  F   ++ ++ +++ YG+   +++A     ++ E  C P    Y  LL  +  +  ++
Sbjct  148  RSSFQSDVMIFNLVIDAYGRKSLYRKAESAYFELLEARCVPTEDTYALLLKAYCMSGLLE  207

Query  332  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            + E V+ EM++  + P  + Y + I    K+   +  V+ +Q  K +  +       +++
Sbjct  208  KAEAVFAEMRKYGLPPSAIVYNAYIDGLMKSGNPQRAVEIFQRMKRDCCQPSTETYTLLI  267

Query  512  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             +  K ++    +KL  ++KT + K +   Y + +NA    GL
Sbjct  268  NLHGKASQSYMALKLFNEMKTQKCKPNICTYTALMNAFAREGL  310



>ref|XP_010648584.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X1 [Vitis vinifera]
 ref|XP_002276864.2| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
isoform X2 [Vitis vinifera]
Length=574

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 114/219 (52%), Gaps = 0/219 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ SQ C+P   T+ +++N + R G+  KAE  F ++++ G +  + AY++++
Sbjct  278  MALKVFHEMRSQKCKPNICTFTALVNAFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALM  337

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++ MKR  + 
Sbjct  338  EAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEVMKRLGIT  397

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYS+A ++  C +       +G K D  +   M+ ++ ++ + +++ ++
Sbjct  398  PTMKSHMLLLSAYSRAGKVAKCEEIVNQMHKSGIKPDTFVLNSMLNLYGRLGQFEKMEEV  457

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            L  ++      D   Y   +N    AG   R + L  S 
Sbjct  458  LTAMEKGPYPADISTYNILINIYGRAGFFARMEELFRSL  496


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 103/187 (55%), Gaps = 2/187 (1%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E +   G  P   ++  +L+ Y R G  +K E   ++M + G        +SM+N
Sbjct  384  AQAVFEVMKRLGITPTMKSHMLLLSAYSRAGKVAKCEEIVNQMHKSGIKPDTFVLNSMLN  443

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +YG+ G+ ++   ++  M E+G  P ++  YN L++I+GRA    ++E++++ +  R ++
Sbjct  444  LYGRLGQFEKMEEVLTAM-EKGPYPADISTYNILINIYGRAGFFARMEELFRSLPARNLI  502

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            PD V++TS I AYS+ K+   C++ +++    G   D   A +++   S  +++ E+  +
Sbjct  503  PDVVTWTSRIGAYSRRKQYNRCLEVFEEMIDAGCYPDGGTAKVLLSACSNGDQIQEVTTV  562

Query  557  LQDLKTD  577
            ++ +  D
Sbjct  563  IRTMHKD  569


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 110/219 (50%), Gaps = 6/219 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y +L+   C P + TYA +L  YC  G+  KAE  F+EM + GF    V Y++ ++
Sbjct  174  AESTYLELLEARCVPTEDTYALLLKAYCTSGLLEKAEAVFAEMRKYGFPPSAVVYNAYID  233

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G  ++A  +  +MK   C+P+   Y  L++++G+AS      KV+ EM+ +K  P
Sbjct  234  GLMKGGDTQKAVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKP  293

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  ++T++++A+++    E   + ++  +  G + D      ++  +S+        E+ 
Sbjct  294  NICTFTALVNAFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIF  353

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
             L+Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  354  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQAVFE  389


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 94/200 (47%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++    C+P   TY  ++N+Y +      A   F EM  +     I  ++++VN
Sbjct  244  AVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKPNICTFTALVN  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +++E G EP+V+ YN L++ + RA       +++  M+     P
Sbjct  304  AFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMGCEP  363

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A   E     ++  K  G         +++  +S+  KV +  +++
Sbjct  364  DRASYNIMVDAYGRAGLHEDAQAVFEVMKRLGITPTMKSHMLLLSAYSRAGKVAKCEEIV  423

Query  560  QDLKTDETKLDERLYRSALN  619
              +     K D  +  S LN
Sbjct  424  NQMHKSGIKPDTFVLNSMLN  443


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/197 (18%), Positives = 90/197 (46%), Gaps = 4/197 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSE----MEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P   T+  I+N+  ++ +  + +         + +  F   ++ Y+ +++ YG+   +K+
Sbjct  114  PNHTTWDDIINVAVQLRLNKQWDAIVLICGWILYRSSFHPDVICYNLLIDAYGQKSLYKK  173

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A     ++ E  C P    Y  LL  +  +  +++ E V+ EM++    P  V Y + I 
Sbjct  174  AESTYLELLEARCVPTEDTYALLLKAYCTSGLLEKAEAVFAEMRKYGFPPSAVVYNAYID  233

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K  + +  V+ ++  K +  +   A   +++ ++ K +K    +K+  ++++ + K 
Sbjct  234  GLMKGGDTQKAVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKP  293

Query  590  DERLYRSALNALRDAGL  640
            +   + + +NA    GL
Sbjct  294  NICTFTALVNAFAREGL  310



>ref|XP_006605878.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like 
isoform X2 [Glycine max]
 gb|KHN11471.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=558

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 108/208 (52%), Gaps = 0/208 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  ++ +++S  C+P   TY +++N + R G+  KAE  F +M++ G +  + AY++++
Sbjct  260  MALKLFHEMMSHDCKPNICTYTALVNAFAREGLCEKAEEVFEQMQEAGLEPDVYAYNALM  319

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN L+D +G+A      E V+K+MKR  + 
Sbjct  320  EAYSRAGYPYGAAEIFSLMQHMGCEPDRASYNILVDAYGKAGFQDDAEAVFKDMKRVGIT  379

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYSK   +  C +       +G K D  +   M+ ++ ++ +  ++ ++
Sbjct  380  PTMKSHMVLLSAYSKMGSVNKCEEILNQMCKSGLKLDTYVLNSMLNLYGRLGQFGKMEEV  439

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L+ ++      D   Y   +N    AG 
Sbjct  440  LRVMEKGSYVADISTYNILINRYGQAGF  467


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 97/200 (49%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++    C+P   TY  ++N+Y + G    A   F EM        I  Y+++VN
Sbjct  226  AEEIFKRMKKDACKPTTETYTMLINLYGKAGKSFMALKLFHEMMSHDCKPNICTYTALVN  285

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M+E G EP+V+ YN L++ + RA       +++  M+     P
Sbjct  286  AFAREGLCEKAEEVFEQMQEAGLEPDVYAYNALMEAYSRAGYPYGAAEIFSLMQHMGCEP  345

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY KA   +     ++D K  G         +++  +SKM  V++  ++L
Sbjct  346  DRASYNILVDAYGKAGFQDDAEAVFKDMKRVGITPTMKSHMVLLSAYSKMGSVNKCEEIL  405

Query  560  QDLKTDETKLDERLYRSALN  619
              +     KLD  +  S LN
Sbjct  406  NQMCKSGLKLDTYVLNSMLN  425


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 97/219 (44%), Gaps = 35/219 (16%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS---  190
            A + Y +L+   C P + TYA ++  YC  G+  KAE  F+EM   G     V Y++   
Sbjct  156  AESTYLQLLEARCIPTEDTYALLIKAYCISGLLEKAEAVFAEMRNYGLPSSAVVYNAYIN  215

Query  191  --------------------------------MVNMYGKTGRHKEATRLVAKMKERGCEP  274
                                            ++N+YGK G+   A +L  +M    C+P
Sbjct  216  GLMKGGNSDKAEEIFKRMKKDACKPTTETYTMLINLYGKAGKSFMALKLFHEMMSHDCKP  275

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
            N+  Y  L++   R    ++ E+V+++M+   + PD  +Y +++ AYS+A       + +
Sbjct  276  NICTYTALVNAFAREGLCEKAEEVFEQMQEAGLEPDVYAYNALMEAYSRAGYPYGAAEIF  335

Query  455  QDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               +  G + DRA   I+V  + K    D+   + +D+K
Sbjct  336  SLMQHMGCEPDRASYNILVDAYGKAGFQDDAEAVFKDMK  374


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 95/189 (50%), Gaps = 0/189 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  AA ++  +   GCEP + +Y  +++ Y + G    AE  F +M++ G    + ++  
Sbjct  328  PYGAAEIFSLMQHMGCEPDRASYNILVDAYGKAGFQDDAEAVFKDMKRVGITPTMKSHMV  387

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +++ Y K G   +   ++ +M + G + + ++ N++L+++GR     ++E+V + M++  
Sbjct  388  LLSAYSKMGSVNKCEEILNQMCKSGLKLDTYVLNSMLNLYGRLGQFGKMEEVLRVMEKGS  447

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
             V D  +Y  +I+ Y +A  +E     +Q     G K D       +G +SK     + +
Sbjct  448  YVADISTYNILINRYGQAGFIERMEDLFQLLPSKGLKPDVVTWTSRIGAYSKKKLYLKCL  507

Query  551  KLLQDLKTD  577
            ++ +++  D
Sbjct  508  EIFEEMIDD  516


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 100/186 (54%), Gaps = 0/186 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++ +   G  P   ++  +L+ Y ++G  +K E   ++M + G        +SM+N
Sbjct  366  AEAVFKDMKRVGITPTMKSHMVLLSAYSKMGSVNKCEEILNQMCKSGLKLDTYVLNSMLN  425

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG+ G+  +   ++  M++     ++  YN L++ +G+A  ++++E +++ +  + + P
Sbjct  426  LYGRLGQFGKMEEVLRVMEKGSYVADISTYNILINRYGQAGFIERMEDLFQLLPSKGLKP  485

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++TS I AYSK K    C++ +++   +G   D   A +++   S  ++ +++  ++
Sbjct  486  DVVTWTSRIGAYSKKKLYLKCLEIFEEMIDDGCYPDGGTAKVLLAACSNEDQTEQVTTVI  545

Query  560  QDLKTD  577
            + +  D
Sbjct  546  RTMHKD  551



>ref|XP_008790496.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008790573.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Phoenix dactylifera]
 ref|XP_008790660.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Phoenix dactylifera]
Length=402

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 106/201 (53%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + + +  +G +P + TY ++LN  C+ G   +A   FS+ME++GF   +VAY+ ++ 
Sbjct  109  ALRLLDVMTQKGVDPNEFTYCTLLNGLCKRGRIEEAIRFFSQMEERGFGDNVVAYNILIC  168

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G  +EA +L+  MK +G +P+V  YNTL+D + +   ++    +  +M+R+ + P
Sbjct  169  GFCKMGNMEEARKLLQDMKRKGTKPDVITYNTLMDGYCKIGKIEAAHDLLSDMERQCLRP  228

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + VSY ++++ + K  +LE      ++    G + D     I+     K  +  +   LL
Sbjct  229  NVVSYNTLMAGFCKVGDLERAANLVEEMAGKGVELDVVSYSILSDGMCKAGRYQDTENLL  288

Query  560  QDLKTDETKLDERLYRSALNA  622
              +  +E + D  +Y   LNA
Sbjct  289  HHMAENEIEPDAMMYSCILNA  309


 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 102/206 (50%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + E+++ +GC P  VTY  ++   C+ G+  +A      M QKG D     Y +++N
Sbjct  74   AMGMIEEMICRGCSPNVVTYTGVMGGLCKEGMVEEALRLLDVMTQKGVDPNEFTYCTLLN  133

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K GR +EA R  ++M+ERG   NV  YN L+    +  NM++  K+ ++MKR+   P
Sbjct  134  GLCKRGRIEEAIRFFSQMEERGFGDNVVAYNILICGFCKMGNMEEARKLLQDMKRKGTKP  193

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D ++Y +++  Y K  ++E+      D +    + +      ++  F K+  ++    L+
Sbjct  194  DVITYNTLMDGYCKIGKIEAAHDLLSDMERQCLRPNVVSYNTLMAGFCKVGDLERAANLV  253

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
            +++     +LD   Y    + +  AG
Sbjct  254  EEMAGKGVELDVVSYSILSDGMCKAG  279


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 105/203 (52%), Gaps = 0/203 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            ++A  +Y ++V  G +   VTY   +N  C+     +A++ F EM + GF   ++ Y+++
Sbjct  2    KLAMMLYTRIVKMGVKGNVVTYTGFINGLCQERRLVEAKLLFDEMLETGFSPNVITYTAL  61

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            ++   + G+ +EA  ++ +M  RGC PNV  Y  ++    +   +++  ++   M ++ V
Sbjct  62   IHGLCEYGQLEEAMGMIEEMICRGCSPNVVTYTGVMGGLCKEGMVEEALRLLDVMTQKGV  121

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
             P+  +Y ++++   K   +E  ++++   +  G   +     I++  F KM  ++E  K
Sbjct  122  DPNEFTYCTLLNGLCKRGRIEEAIRFFSQMEERGFGDNVVAYNILICGFCKMGNMEEARK  181

Query  554  LLQDLKTDETKLDERLYRSALNA  622
            LLQD+K   TK D   Y + ++ 
Sbjct  182  LLQDMKRKGTKPDVITYNTLMDG  204


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 102/219 (47%), Gaps = 0/219 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++++++  G  P  +TY ++++  C  G   +A     EM  +G    +V Y+ ++ 
Sbjct  39   AKLLFDEMLETGFSPNVITYTALIHGLCEYGQLEEAMGMIEEMICRGCSPNVVTYTGVMG  98

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G  +EA RL+  M ++G +PN + Y TLL+   +   +++  + + +M+ R    
Sbjct  99   GLCKEGMVEEALRLLDVMTQKGVDPNEFTYCTLLNGLCKRGRIEEAIRFFSQMEERGFGD  158

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + V+Y  +I  + K   +E   K  QD K  G K D      ++  + K+ K++    LL
Sbjct  159  NVVAYNILICGFCKMGNMEEARKLLQDMKRKGTKPDVITYNTLMDGYCKIGKIEAAHDLL  218

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
             D++    + +   Y + +      G   RA  L E  A
Sbjct  219  SDMERQCLRPNVVSYNTLMAGFCKVGDLERAANLVEEMA  257


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/173 (24%), Positives = 88/173 (51%), Gaps = 0/173 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +G +P  +TY ++++ YC+IG    A    S+ME++     +V+Y++++  + K G  + 
Sbjct  189  KGTKPDVITYNTLMDGYCKIGKIEAAHDLLSDMERQCLRPNVVSYNTLMAGFCKVGDLER  248

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  LV +M  +G E +V  Y+ L D   +A   +  E +   M   ++ PD + Y+ +++
Sbjct  249  AANLVEEMAGKGVELDVVSYSILSDGMCKAGRYQDTENLLHHMAENEIEPDAMMYSCILN  308

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            AY K   L+      +     G +T+  +   ++  F    ++ E +++L ++
Sbjct  309  AYCKNMRLQEAKSIIRRMTEKGHQTNIVIHNAILQGFCIKGEIKEAIRVLNEI  361


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 82/170 (48%), Gaps = 0/170 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            Q   P  V+Y +++  +C++G   +A     EM  KG +  +V+YS + +   K GR+++
Sbjct  224  QCLRPNVVSYNTLMAGFCKVGDLERAANLVEEMAGKGVELDVVSYSILSDGMCKAGRYQD  283

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
               L+  M E   EP+  +Y+ +L+ + +   +++ + + + M  +    + V + +++ 
Sbjct  284  TENLLHHMAENEIEPDAMMYSCILNAYCKNMRLQEAKSIIRRMTEKGHQTNIVIHNAILQ  343

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
             +    E++  ++   +  LN       M  + +    +  ++D+ + LL
Sbjct  344  GFCIKGEIKEAIRVLNEIILNDIAPSTVMVSLFLEYICRFGQLDKFLDLL  393


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/139 (24%), Positives = 66/139 (47%), Gaps = 0/139 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            AA + E++  +G E   V+Y+ + +  C+ G Y   E     M +   +   + YS ++N
Sbjct  249  AANLVEEMAGKGVELDVVSYSILSDGMCKAGRYQDTENLLHHMAENEIEPDAMMYSCILN  308

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K  R +EA  ++ +M E+G + N+ I+N +L        +K+  +V  E+    + P
Sbjct  309  AYCKNMRLQEAKSIIRRMTEKGHQTNIVIHNAILQGFCIKGEIKEAIRVLNEIILNDIAP  368

Query  380  DRVSYTSVISAYSKAKELE  436
              V  +  +    +  +L+
Sbjct  369  STVMVSLFLEYICRFGQLD  387



>ref|XP_007157017.1| hypothetical protein PHAVU_002G036500g [Phaseolus vulgaris]
 gb|ESW29011.1| hypothetical protein PHAVU_002G036500g [Phaseolus vulgaris]
Length=1484

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 107/205 (52%), Gaps = 0/205 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            PR A  ++ +L S+G  P  VTY S+L  + R G   K      EM +KGF +  + Y++
Sbjct  369  PRKAQELFTELESKGFLPDAVTYNSLLYAFSREGNTEKVRDICEEMVKKGFGRDEMTYNT  428

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +++MYGK GRH +A +L   MK  G  P+   Y  L+D  G+AS +++   V  EM    
Sbjct  429  IIHMYGKQGRHNQALQLYRDMKTFGRNPDAVTYTVLIDSLGKASKVEEAANVMSEMLDAG  488

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            V P   +Y+++I AY+KA   E   + +   + +G K D     +M+  F + N++ + +
Sbjct  489  VKPTLHTYSALICAYTKAGRGEEAEETFNCMRKSGIKADHLAYSVMLDFFLRFNEMKKAM  548

Query  551  KLLQDLKTDETKLDERLYRSALNAL  625
             L  ++  +    D  LY   ++AL
Sbjct  549  GLYHEMIREGFTPDNGLYEVMMHAL  573


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 97/205 (47%), Gaps = 0/205 (0%)
 Frame = +2

Query  11    PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
             P    ++  K+ + G EP   TY S++  + +  +Y +AE  F E+   G+      Y  
Sbjct  997   PEEGLSLMNKMRTLGLEPKLDTYRSLITAFGKQRMYEQAEELFEELRSDGYKLDRAFYHL  1056

Query  191   MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
             M+ MY  +G H +A  L+A MKE G EP +   + L+  +G +   ++ E V K +K   
Sbjct  1057  MMKMYRTSGDHLKAENLLAMMKESGIEPTISTMHLLMVSYGESGQPEEAENVLKNLKTTG  1116

Query  371   VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
             VV D + Y+SVI AY +    E+ ++  ++ K  G + D  +    +   S     DE +
Sbjct  1117  VVLDTLPYSSVIDAYLRKGNFEAGIEKLKEMKEAGIEPDHRIWTCFIRAASLSEGADEAI  1176

Query  551   KLLQDLKTDETKLDERLYRSALNAL  625
              LL  L+     L  RL +    +L
Sbjct  1177  ILLNALQGSGFDLPIRLLKEKSESL  1201


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/221 (24%), Positives = 106/221 (48%), Gaps = 3/221 (1%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P +A  +  ++   G  P  +TY ++++   R   + +A   FS+ME       +  Y++
Sbjct  299  PNLALQLLHEVRRSGIRPDIITYNTLISACSRESNFEEAIAVFSDMESHRCQPDLWTYNA  358

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            M+++ G+ GR ++A  L  +++ +G  P+   YN+LL    R  N ++V  + +EM ++ 
Sbjct  359  MISVCGRCGRPRKAQELFTELESKGFLPDAVTYNSLLYAFSREGNTEKVRDICEEMVKKG  418

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
               D ++Y ++I  Y K       ++ Y+D K  G   D     +++    K +KV+E  
Sbjct  419  FGRDEMTYNTIIHMYGKQGRHNQALQLYRDMKTFGRNPDAVTYTVLIDSLGKASKVEEAA  478

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
             ++ ++     K     Y + + A   AG   R +  +E+F
Sbjct  479  NVMSEMLDAGVKPTLHTYSALICAYTKAG---RGEEAEETF  516


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 92/194 (47%), Gaps = 3/194 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P     A+IL +  +    + A   F+  E    D   V Y++M+ +Y ++GR  +   L
Sbjct  210  PNARMVATILGVLGKANQEALAVEIFTRAESSVGDTVQV-YNAMMGVYARSGRFNKVKEL  268

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQ--VEKVWKEMKRRKVVPDRVSYTSVISAY  415
            +  M+ERGC P++  +NTL++   ++  M+     ++  E++R  + PD ++Y ++ISA 
Sbjct  269  LDLMRERGCVPDLVSFNTLINARMKSGAMEPNLALQLLHEVRRSGIRPDIITYNTLISAC  328

Query  416  SKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDE  595
            S+    E  +  + D + +  + D      M+ V  +  +  +  +L  +L++     D 
Sbjct  329  SRESNFEEAIAVFSDMESHRCQPDLWTYNAMISVCGRCGRPRKAQELFTELESKGFLPDA  388

Query  596  RLYRSALNALRDAG  637
              Y S L A    G
Sbjct  389  VTYNSLLYAFSREG  402


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/195 (24%), Positives = 86/195 (44%), Gaps = 4/195 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +Y  + + G  P  VTY  +++   +     +A    SEM   G    +  YS+++ 
Sbjct  442  ALQLYRDMKTFGRNPDAVTYTVLIDSLGKASKVEEAANVMSEMLDAGVKPTLHTYSALIC  501

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K GR +EA      M++ G + +   Y+ +LD   R + MK+   ++ EM R    P
Sbjct  502  AYTKAGRGEEAEETFNCMRKSGIKADHLAYSVMLDFFLRFNEMKKAMGLYHEMIREGFTP  561

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D   Y  ++ A  K        +  +D +  GG   + ++ ++V    K    D   K+L
Sbjct  562  DNGLYEVMMHALVKENMWGVVDRIIEDMEQLGGMNPQIISSVLV----KGGCYDHAAKML  617

Query  560  QDLKTDETKLDERLY  604
            +   ++  +LD  ++
Sbjct  618  RVAISNGFELDHEIF  632


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 88/205 (43%), Gaps = 2/205 (1%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKG--FDKCIVAYSS  190
            VA+ ++  +   G EP +  Y +++++ CR+G+   A       E+ G   D  +  Y  
Sbjct  717  VASQIFSDMRFNGVEPSECLYQAMVSVNCRMGLPETAHHLLYHAEKNGIILDNNVSVYVD  776

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +V  YGK    ++A  LV  +++R  + +  ++N L+  +  +   ++   ++  M R  
Sbjct  777  IVETYGKLKIWQKAESLVGGLRQRSSKVDRKVWNALIHAYAFSGCYERARAIFNTMMRDG  836

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
              P   S   ++ A    + L       Q+ +  G K  ++   + +  F++   + E+ 
Sbjct  837  PSPTVDSVNGLLQALIVDRRLNELYVVIQELQDMGLKISKSSILLTLEAFAQAGSLFEVQ  896

Query  551  KLLQDLKTDETKLDERLYRSALNAL  625
            K+   +K         LYR  L  L
Sbjct  897  KIYNGMKAAGYFPTMHLYRIMLRLL  921


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 93/206 (45%), Gaps = 1/206 (0%)
 Frame = +2

Query  53    GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
             G +P      S+L +Y  I  +    + + +++          Y++++ MY +  R +E 
Sbjct  941   GFKPDLQICNSVLKLYLGINDFKSMGIIYQKIKDADLKPDGETYNTLIIMYCRDCRPEEG  1000

Query  233   TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
               L+ KM+  G EP +  Y +L+   G+    +Q E++++E++      DR  Y  ++  
Sbjct  1001  LSLMNKMRTLGLEPKLDTYRSLITAFGKQRMYEQAEELFEELRSDGYKLDRAFYHLMMKM  1060

Query  413   YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
             Y  + +           K +G +   +   +++  + +  + +E   +L++LKT    LD
Sbjct  1061  YRTSGDHLKAENLLAMMKESGIEPTISTMHLLMVSYGESGQPEEAENVLKNLKTTGVVLD  1120

Query  593   ERLYRSALNA-LRDAGLEIRAKWLQE  667
                Y S ++A LR    E   + L+E
Sbjct  1121  TLPYSSVIDAYLRKGNFEAGIEKLKE  1146



>ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citrus clementina]
 ref|XP_006435343.1| hypothetical protein CICLE_v10000451mg [Citrus clementina]
 gb|ESR48582.1| hypothetical protein CICLE_v10000451mg [Citrus clementina]
 gb|ESR48583.1| hypothetical protein CICLE_v10000451mg [Citrus clementina]
Length=704

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 107/202 (53%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +++++S+G EP  +T+ ++++ + + G Y +AE  F EM+++G+  C   Y+ M+N
Sbjct  459  AMAAFDRMLSEGIEPDTITWNTLIDCHFKCGRYDRAEELFEEMQERGYFPCTTTYNIMIN  518

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            + G+  R ++  RL+  M+ +G  PNV  Y TL+DI+G++       +  + MK   + P
Sbjct  519  LLGEQERWEDVKRLLGNMRAQGLLPNVVTYTTLVDIYGQSGRFDDAIECLEVMKAAGLKP  578

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    +  V  ++  + +G K        ++  F +  +  E   +L
Sbjct  579  SSTMYNALINAYARRGLSDQAVNAFRVMRTDGLKPSNLALNSLINAFGEDQRDAEAFAVL  638

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  K D   Y + + AL
Sbjct  639  QYMKENGLKPDVVTYTTLMKAL  660


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 104/221 (47%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G EP    Y  +++ + +      A   F  M  +G +   + ++++++ + 
Sbjct  427  VLKEMKSSGVEPDTHFYNVMIDTFGKYNCLHHAMAAFDRMLSEGIEPDTITWNTLIDCHF  486

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GR+  A  L  +M+ERG  P    YN ++++ G     + V+++   M+ + ++P+ V
Sbjct  487  KCGRYDRAEELFEEMQERGYFPCTTTYNIMINLLGEQERWEDVKRLLGNMRAQGLLPNVV  546

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT+++  Y ++   +  ++  +  K  G K    M   ++  +++    D+ V   + +
Sbjct  547  TYTTLVDIYGQSGRFDDAIECLEVMKAAGLKPSSTMYNALINAYARRGLSDQAVNAFRVM  606

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
            +TD  K       S +NA     RDA          E+FAV
Sbjct  607  RTDGLKPSNLALNSLINAFGEDQRDA----------EAFAV  637


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 76/160 (48%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P   TYA+++      G   +AE  F E+++ G      A+++++  Y K G  K+A
Sbjct  295  GLSPKTATYAAVITALSNSGRTIEAEAVFEELKESGLKPRTKAFNALLKGYVKMGYLKDA  354

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
              +V++M+  G  P+   Y+ L+D +  A   +    V KEM+     P+   Y+ +++ 
Sbjct  355  EFVVSEMERSGVLPDEHTYSLLIDAYANAGRWESARIVLKEMEVSHAKPNSFIYSRILAG  414

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            Y    E +   +  ++ K +G + D     +M+  F K N
Sbjct  415  YRDRGEWQRTFQVLKEMKSSGVEPDTHFYNVMIDTFGKYN  454


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 92/211 (44%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++     +P    Y+ IL  Y   G + +      EM+  G +     Y+ M++
Sbjct  389  ARIVLKEMEVSHAKPNSFIYSRILAGYRDRGEWQRTFQVLKEMKSSGVEPDTHFYNVMID  448

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H +     + E++++EM+ R   P
Sbjct  449  TFGKYNCLHHAMAAFDRMLSEGIEPDTITWNTLIDCHFKCGRYDRAEELFEEMQERGYFP  508

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I+   + +  E   +   + +  G   +      +V ++ +  + D+ ++ L
Sbjct  509  CTTTYNIMINLLGEQERWEDVKRLLGNMRAQGLLPNVVTYTTLVDIYGQSGRFDDAIECL  568

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            + +K    K    +Y + +NA    GL  +A
Sbjct  569  EVMKAAGLKPSSTMYNALINAYARRGLSDQA  599


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 83/184 (45%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E+L   G +P    + ++L  Y ++G    AE   SEME+ G       YS +++
Sbjct  319  AEAVFEELKESGLKPRTKAFNALLKGYVKMGYLKDAEFVVSEMERSGVLPDEHTYSLLID  378

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN +IY+ +L  +      ++  +V KEMK   V P
Sbjct  379  AYANAGRWESARIVLKEMEVSHAKPNSFIYSRILAGYRDRGEWQRTFQVLKEMKSSGVEP  438

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D   Y  +I  + K   L   +  +      G + D      ++    K  + D   +L 
Sbjct  439  DTHFYNVMIDTFGKYNCLHHAMAAFDRMLSEGIEPDTITWNTLIDCHFKCGRYDRAEELF  498

Query  560  QDLK  571
            ++++
Sbjct  499  EEMQ  502


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 58/117 (50%), Gaps = 0/117 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E + + G +P    Y +++N Y R G+  +A   F  M   G     +A +S++N +G+ 
Sbjct  569  EVMKAAGLKPSSTMYNALINAYARRGLSDQAVNAFRVMRTDGLKPSNLALNSLINAFGED  628

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             R  EA  ++  MKE G +P+V  Y TL+    R     +V  V++EM      PDR
Sbjct  629  QRDAEAFAVLQYMKENGLKPDVVTYTTLMKALIRVDKFHKVPAVYEEMILSGCTPDR  685


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 83/177 (47%), Gaps = 2/177 (1%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQK-GFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEP  274
            + + G  SKA M F  M Q  G       Y++++     +GR  EA  +  ++KE G +P
Sbjct  275  FAKAGDASKA-MRFLGMAQGVGLSPKTATYAAVITALSNSGRTIEAEAVFEELKESGLKP  333

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
                +N LL  + +   +K  E V  EM+R  V+PD  +Y+ +I AY+ A   ES     
Sbjct  334  RTKAFNALLKGYVKMGYLKDAEFVVSEMERSGVLPDEHTYSLLIDAYANAGRWESARIVL  393

Query  455  QDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            ++ +++  K +  +   ++  +    +     ++L+++K+   + D   Y   ++  
Sbjct  394  KEMEVSHAKPNSFIYSRILAGYRDRGEWQRTFQVLKEMKSSGVEPDTHFYNVMIDTF  450



>emb|CBI27156.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 114/219 (52%), Gaps = 0/219 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ SQ C+P   T+ +++N + R G+  KAE  F ++++ G +  + AY++++
Sbjct  329  MALKVFHEMRSQKCKPNICTFTALVNAFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALM  388

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++ MKR  + 
Sbjct  389  EAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEVMKRLGIT  448

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYS+A ++  C +       +G K D  +   M+ ++ ++ + +++ ++
Sbjct  449  PTMKSHMLLLSAYSRAGKVAKCEEIVNQMHKSGIKPDTFVLNSMLNLYGRLGQFEKMEEV  508

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            L  ++      D   Y   +N    AG   R + L  S 
Sbjct  509  LTAMEKGPYPADISTYNILINIYGRAGFFARMEELFRSL  547


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 103/187 (55%), Gaps = 2/187 (1%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E +   G  P   ++  +L+ Y R G  +K E   ++M + G        +SM+N
Sbjct  435  AQAVFEVMKRLGITPTMKSHMLLLSAYSRAGKVAKCEEIVNQMHKSGIKPDTFVLNSMLN  494

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +YG+ G+ ++   ++  M E+G  P ++  YN L++I+GRA    ++E++++ +  R ++
Sbjct  495  LYGRLGQFEKMEEVLTAM-EKGPYPADISTYNILINIYGRAGFFARMEELFRSLPARNLI  553

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            PD V++TS I AYS+ K+   C++ +++    G   D   A +++   S  +++ E+  +
Sbjct  554  PDVVTWTSRIGAYSRRKQYNRCLEVFEEMIDAGCYPDGGTAKVLLSACSNGDQIQEVTTV  613

Query  557  LQDLKTD  577
            ++ +  D
Sbjct  614  IRTMHKD  620


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 110/219 (50%), Gaps = 6/219 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y +L+   C P + TYA +L  YC  G+  KAE  F+EM + GF    V Y++ ++
Sbjct  225  AESTYLELLEARCVPTEDTYALLLKAYCTSGLLEKAEAVFAEMRKYGFPPSAVVYNAYID  284

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G  ++A  +  +MK   C+P+   Y  L++++G+AS      KV+ EM+ +K  P
Sbjct  285  GLMKGGDTQKAVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKP  344

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  ++T++++A+++    E   + ++  +  G + D      ++  +S+        E+ 
Sbjct  345  NICTFTALVNAFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIF  404

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
             L+Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  405  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQAVFE  440


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 94/200 (47%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++    C+P   TY  ++N+Y +      A   F EM  +     I  ++++VN
Sbjct  295  AVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKPNICTFTALVN  354

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +++E G EP+V+ YN L++ + RA       +++  M+     P
Sbjct  355  AFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMGCEP  414

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A   E     ++  K  G         +++  +S+  KV +  +++
Sbjct  415  DRASYNIMVDAYGRAGLHEDAQAVFEVMKRLGITPTMKSHMLLLSAYSRAGKVAKCEEIV  474

Query  560  QDLKTDETKLDERLYRSALN  619
              +     K D  +  S LN
Sbjct  475  NQMHKSGIKPDTFVLNSMLN  494


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/197 (18%), Positives = 90/197 (46%), Gaps = 4/197 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSE----MEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P   T+  I+N+  ++ +  + +         + +  F   ++ Y+ +++ YG+   +K+
Sbjct  165  PNHTTWDDIINVAVQLRLNKQWDAIVLICGWILYRSSFHPDVICYNLLIDAYGQKSLYKK  224

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A     ++ E  C P    Y  LL  +  +  +++ E V+ EM++    P  V Y + I 
Sbjct  225  AESTYLELLEARCVPTEDTYALLLKAYCTSGLLEKAEAVFAEMRKYGFPPSAVVYNAYID  284

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K  + +  V+ ++  K +  +   A   +++ ++ K +K    +K+  ++++ + K 
Sbjct  285  GLMKGGDTQKAVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKP  344

Query  590  DERLYRSALNALRDAGL  640
            +   + + +NA    GL
Sbjct  345  NICTFTALVNAFAREGL  361



>gb|AFV61121.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
cujabensis]
Length=359

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  56   REARSLISEMKTXGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  112

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  113  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  172

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  173  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  232

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  233  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  93   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  152

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  153  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  212

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  213  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  272

Query  560  QDLK  571
             +LK
Sbjct  273  HELK  276


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (46%), Gaps = 4/201 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  163  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  222

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  223  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  278

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  279  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIHLLSKYKKYSNVVEVF  338

Query  560  QDLKTDETKLDERLYRSALNA  622
              ++      D  +    LNA
Sbjct  339  DKMRGLGYFPDSNVIAVVLNA  359


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTXGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159



>gb|AFV61141.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
macrophylla]
Length=381

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  56   REARSLISEMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  112

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  113  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  172

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  173  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  232

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  233  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  271


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  93   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  152

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  153  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  212

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  213  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  272

Query  560  QDLK  571
             +LK
Sbjct  273  HELK  276


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (46%), Gaps = 4/201 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  163  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  222

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  223  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  278

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  279  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIHLLSKXKKYSNVVEVF  338

Query  560  QDLKTDETKLDERLYRSALNA  622
              ++      D  +    LNA
Sbjct  339  NKMRGLGYFPDSDVIAXVLNA  359


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  4    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  63

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  64   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  123

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  124  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  159


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/180 (21%), Positives = 79/180 (44%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS-------EMEQKGFDKCIV  178
            A  + +++ S+G EP  +TY++I++I+ ++G   +A M F        E++Q  F   IV
Sbjct  198  ANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIV  257

Query  179  AY------------------------SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            AY                         + +++    GR +EAT +  +  + G   ++ +
Sbjct  258  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  317

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K +E +     Y + +
Sbjct  318  FERMIHLLSKXKKYSNVVEVFNKMRGLGYFPDSDVIAXVLNAYGKLQEFDKANDVYMEMQ  377



>ref|XP_003555869.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like 
isoform X1 [Glycine max]
Length=576

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 108/208 (52%), Gaps = 0/208 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  ++ +++S  C+P   TY +++N + R G+  KAE  F +M++ G +  + AY++++
Sbjct  278  MALKLFHEMMSHDCKPNICTYTALVNAFAREGLCEKAEEVFEQMQEAGLEPDVYAYNALM  337

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN L+D +G+A      E V+K+MKR  + 
Sbjct  338  EAYSRAGYPYGAAEIFSLMQHMGCEPDRASYNILVDAYGKAGFQDDAEAVFKDMKRVGIT  397

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYSK   +  C +       +G K D  +   M+ ++ ++ +  ++ ++
Sbjct  398  PTMKSHMVLLSAYSKMGSVNKCEEILNQMCKSGLKLDTYVLNSMLNLYGRLGQFGKMEEV  457

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L+ ++      D   Y   +N    AG 
Sbjct  458  LRVMEKGSYVADISTYNILINRYGQAGF  485


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 97/200 (49%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++    C+P   TY  ++N+Y + G    A   F EM        I  Y+++VN
Sbjct  244  AEEIFKRMKKDACKPTTETYTMLINLYGKAGKSFMALKLFHEMMSHDCKPNICTYTALVN  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M+E G EP+V+ YN L++ + RA       +++  M+     P
Sbjct  304  AFAREGLCEKAEEVFEQMQEAGLEPDVYAYNALMEAYSRAGYPYGAAEIFSLMQHMGCEP  363

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY KA   +     ++D K  G         +++  +SKM  V++  ++L
Sbjct  364  DRASYNILVDAYGKAGFQDDAEAVFKDMKRVGITPTMKSHMVLLSAYSKMGSVNKCEEIL  423

Query  560  QDLKTDETKLDERLYRSALN  619
              +     KLD  +  S LN
Sbjct  424  NQMCKSGLKLDTYVLNSMLN  443


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 97/219 (44%), Gaps = 35/219 (16%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS---  190
            A + Y +L+   C P + TYA ++  YC  G+  KAE  F+EM   G     V Y++   
Sbjct  174  AESTYLQLLEARCIPTEDTYALLIKAYCISGLLEKAEAVFAEMRNYGLPSSAVVYNAYIN  233

Query  191  --------------------------------MVNMYGKTGRHKEATRLVAKMKERGCEP  274
                                            ++N+YGK G+   A +L  +M    C+P
Sbjct  234  GLMKGGNSDKAEEIFKRMKKDACKPTTETYTMLINLYGKAGKSFMALKLFHEMMSHDCKP  293

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
            N+  Y  L++   R    ++ E+V+++M+   + PD  +Y +++ AYS+A       + +
Sbjct  294  NICTYTALVNAFAREGLCEKAEEVFEQMQEAGLEPDVYAYNALMEAYSRAGYPYGAAEIF  353

Query  455  QDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               +  G + DRA   I+V  + K    D+   + +D+K
Sbjct  354  SLMQHMGCEPDRASYNILVDAYGKAGFQDDAEAVFKDMK  392


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 95/189 (50%), Gaps = 0/189 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  AA ++  +   GCEP + +Y  +++ Y + G    AE  F +M++ G    + ++  
Sbjct  346  PYGAAEIFSLMQHMGCEPDRASYNILVDAYGKAGFQDDAEAVFKDMKRVGITPTMKSHMV  405

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +++ Y K G   +   ++ +M + G + + ++ N++L+++GR     ++E+V + M++  
Sbjct  406  LLSAYSKMGSVNKCEEILNQMCKSGLKLDTYVLNSMLNLYGRLGQFGKMEEVLRVMEKGS  465

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
             V D  +Y  +I+ Y +A  +E     +Q     G K D       +G +SK     + +
Sbjct  466  YVADISTYNILINRYGQAGFIERMEDLFQLLPSKGLKPDVVTWTSRIGAYSKKKLYLKCL  525

Query  551  KLLQDLKTD  577
            ++ +++  D
Sbjct  526  EIFEEMIDD  534


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 100/186 (54%), Gaps = 0/186 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++ +   G  P   ++  +L+ Y ++G  +K E   ++M + G        +SM+N
Sbjct  384  AEAVFKDMKRVGITPTMKSHMVLLSAYSKMGSVNKCEEILNQMCKSGLKLDTYVLNSMLN  443

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG+ G+  +   ++  M++     ++  YN L++ +G+A  ++++E +++ +  + + P
Sbjct  444  LYGRLGQFGKMEEVLRVMEKGSYVADISTYNILINRYGQAGFIERMEDLFQLLPSKGLKP  503

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++TS I AYSK K    C++ +++   +G   D   A +++   S  ++ +++  ++
Sbjct  504  DVVTWTSRIGAYSKKKLYLKCLEIFEEMIDDGCYPDGGTAKVLLAACSNEDQTEQVTTVI  563

Query  560  QDLKTD  577
            + +  D
Sbjct  564  RTMHKD  569



>gb|KHN08489.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=446

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 106/184 (58%), Gaps = 7/184 (4%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++ ++GC+P   TY +++N  CR+G  S+A+  F EMEQKGF   +V Y+S+++
Sbjct  142  ALRIFQEMPNRGCQPDSYTYGTLINGLCRLGNISEAKELFKEMEQKGFSASVVTYTSLIH  201

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               ++    EA  L+ +MK    EPNV+ Y++L+D   +  +  Q  ++ + M ++  +P
Sbjct  202  GLCQSNNLDEAIGLLEEMKRNDIEPNVFTYSSLMDGLCKGGHSSQAMQLLEVMDKKHHLP  261

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAG-IMVGVFS------KMNKV  538
            + V+Y+++I+   K ++L   V+     ++ G K +  + G I+ G+ +        N +
Sbjct  262  NMVTYSTLINGLCKERKLREAVEILDRMRIQGLKPNAGLYGKIISGLCAAGSYQEAANFI  321

Query  539  DELV  550
            DE+V
Sbjct  322  DEMV  325


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 98/211 (46%), Gaps = 7/211 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + E++     EP   TY+S+++  C+ G  S+A      M++K     +V YS+++N
Sbjct  212  AIGLLEEMKRNDIEPNVFTYSSLMDGLCKGGHSSQAMQLLEVMDKKHHLPNMVTYSTLIN  271

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K  + +EA  ++ +M+ +G +PN  +Y  ++     A + ++      EM    + P
Sbjct  272  GLCKERKLREAVEILDRMRIQGLKPNAGLYGKIISGLCAAGSYQEAANFIDEMVLGGISP  331

Query  380  DRVSYTSVISAYSKAKE-LESCVKYYQDFKLNGGKTDRAMA------GIMVGVFSKMNKV  538
            +R S++  +  ++   + L + V   + F+L      R ++        +V  F K   +
Sbjct  332  NRASWSLHVRMHNMVVQGLCNNVDPPRAFQLYLSMRTRCISVEIDTFDCLVKCFCKRGDL  391

Query  539  DELVKLLQDLKTDETKLDERLYRSALNALRD  631
             +  ++L+++  D    DE ++   +  L D
Sbjct  392  HKAARILEEMVLDGCIPDEGVWNVVIGGLWD  422


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/188 (23%), Positives = 86/188 (46%), Gaps = 7/188 (4%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVNMYGKTGRHKEATRLV  244
            T+  I++    +  +  AE     M+Q   +KC+V    + S+   YG+  R  +A R+ 
Sbjct  19   TFGLIISRLVTVNQFRPAEGMLERMKQ---EKCMVTEDIFLSICRGYGRVHRPLDAIRVF  75

Query  245  AKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKA  424
             KM+     P    Y T+LDI    +++K+    ++EM+   +    VS   +I A  K 
Sbjct  76   HKMEGFQLRPTQKAYLTILDILVEENHVKRAIGFYREMRELGIPSSVVSLNILIKALCKN  135

Query  425  KE-LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERL  601
            KE ++S ++ +Q+    G + D    G ++    ++  + E  +L ++++          
Sbjct  136  KETVDSALRIFQEMPNRGCQPDSYTYGTLINGLCRLGNISEAKELFKEMEQKGFSASVVT  195

Query  602  YRSALNAL  625
            Y S ++ L
Sbjct  196  YTSLIHGL  203



>ref|XP_010276204.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
[Nelumbo nucifera]
 ref|XP_010276206.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 
[Nelumbo nucifera]
Length=584

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 113/221 (51%), Gaps = 0/221 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
             +A  ++ ++ +Q C+P   TY +++N + R G+  KAE  F E+++ G +  +  Y+++
Sbjct  285  HMALKIFREMKNQKCKPNICTYTALINAFAREGLCEKAEEVFEELQEVGHEPDVYTYNAL  344

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            +  Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++E+KR  +
Sbjct  345  MEAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEELKRLGM  404

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
             P   S+  ++SAYSK   +E C +       +G + D  +   M+  + +M +  ++ +
Sbjct  405  TPTMKSHMLLLSAYSKTGNVEKCEEIVNQMHKSGLRPDTFVLNSMLNTYGRMGQFKKMEE  464

Query  554  LLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESFA  676
            +L  ++    + D   Y   +N    AG   + + L ES  
Sbjct  465  VLSAMENGPYEADISTYNILINIYGRAGFLDKMEDLFESLP  505


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 101/186 (54%), Gaps = 0/186 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E+L   G  P   ++  +L+ Y + G   K E   ++M + G        +SM+N
Sbjct  392  AQAVFEELKRLGMTPTMKSHMLLLSAYSKTGNVEKCEEIVNQMHKSGLRPDTFVLNSMLN  451

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G+ K+   +++ M+    E ++  YN L++I+GRA  + ++E +++ +  + + P
Sbjct  452  TYGRMGQFKKMEEVLSAMENGPYEADISTYNILINIYGRAGFLDKMEDLFESLPSKNLKP  511

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++TS + AYS+ K    C+K +++   +G   D   A +++   S  ++++++  ++
Sbjct  512  DVVTWTSRMGAYSRKKLYTKCIKIFEEMIDSGCYPDGGTAKVLLSACSSEDQIEQVTTVI  571

Query  560  QDLKTD  577
            + +  D
Sbjct  572  RTMHKD  577


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 106/215 (49%), Gaps = 6/215 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y  L+   C P + TYA ++  Y   G   KAE  F+EM + G    +V Y++ ++
Sbjct  182  AESAYLGLLQARCVPTEDTYALLIRAYSISGFIEKAEAIFAEMRKYGVPPSVVVYNAYID  241

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K    ++A  +  +MK   C+P+   Y  L++++G+AS      K+++EMK +K  P
Sbjct  242  GLMKGRNTQKALDIFERMKRDNCQPSTETYTMLINLYGKASKSHMALKIFREMKNQKCKP  301

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  +YT++I+A+++    E   + +++ +  G + D      ++  +S+        E+ 
Sbjct  302  NICTYTALINAFAREGLCEKAEEVFEELQEVGHEPDVYTYNALMEAYSRAGFPYGAAEIF  361

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L+Q +  +    D   Y   ++A   AGL   A+
Sbjct  362  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQ  393


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 98/206 (48%), Gaps = 0/206 (0%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAY  184
            R  + A  ++E++    C+P   TY  ++N+Y +      A   F EM+ +     I  Y
Sbjct  247  RNTQKALDIFERMKRDNCQPSTETYTMLINLYGKASKSHMALKIFREMKNQKCKPNICTY  306

Query  185  SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
            ++++N + + G  ++A  +  +++E G EP+V+ YN L++ + RA       +++  M+ 
Sbjct  307  TALINAFAREGLCEKAEEVFEELQEVGHEPDVYTYNALMEAYSRAGFPYGAAEIFSLMQH  366

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
                PDR SY  ++ AY +A   E     +++ K  G         +++  +SK   V++
Sbjct  367  MGCEPDRASYNIMVDAYGRAGLHEDAQAVFEELKRLGMTPTMKSHMLLLSAYSKTGNVEK  426

Query  545  LVKLLQDLKTDETKLDERLYRSALNA  622
              +++  +     + D  +  S LN 
Sbjct  427  CEEIVNQMHKSGLRPDTFVLNSMLNT  452


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/201 (23%), Positives = 96/201 (48%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E+L   G EP   TY +++  Y R G    A   FS M+  G +    +Y+ MV+
Sbjct  322  AEEVFEELQEVGHEPDVYTYNALMEAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVD  381

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G H++A  +  ++K  G  P +  +  LL  + +  N+++ E++  +M +  + P
Sbjct  382  AYGRAGLHEDAQAVFEELKRLGMTPTMKSHMLLLSAYSKTGNVEKCEEIVNQMHKSGLRP  441

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y +  + +   +     +    + D +   I++ ++ +   +D++  L 
Sbjct  442  DTFVLNSMLNTYGRMGQFKKMEEVLSAMENGPYEADISTYNILINIYGRAGFLDKMEDLF  501

Query  560  QDLKTDETKLDERLYRSALNA  622
            + L +   K D   + S + A
Sbjct  502  ESLPSKNLKPDVVTWTSRMGA  522


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/165 (18%), Positives = 77/165 (47%), Gaps = 0/165 (0%)
 Frame = +2

Query  146  MEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASN  325
            + +  F   ++ Y+ +++ YG+  ++K+A      + +  C P    Y  L+  +  +  
Sbjct  154  LHRSSFQADVMCYNLLIDAYGQKFQYKKAESAYLGLLQARCVPTEDTYALLIRAYSISGF  213

Query  326  MKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGI  505
            +++ E ++ EM++  V P  V Y + I    K +  +  +  ++  K +  +       +
Sbjct  214  IEKAEAIFAEMRKYGVPPSVVVYNAYIDGLMKGRNTQKALDIFERMKRDNCQPSTETYTM  273

Query  506  MVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
            ++ ++ K +K    +K+ +++K  + K +   Y + +NA    GL
Sbjct  274  LINLYGKASKSHMALKIFREMKNQKCKPNICTYTALINAFAREGL  318



>ref|XP_010246501.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, 
mitochondrial [Nelumbo nucifera]
Length=1069

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 99/182 (54%), Gaps = 0/182 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            ++EKL+  G +P Q+ Y +++ I CR G+  KA     +M ++G     V Y++++N Y 
Sbjct  788  MHEKLIVMGFKPDQMVYNTLIAILCRRGMTRKANHALKDMIRRGISANTVTYNALINGYC  847

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K+   K+A  L ++M   G  PNV  YNTLL     A  M++ +K++ EMK+R V+PD  
Sbjct  848  KSSHLKKAAALYSQMLAEGISPNVITYNTLLSGFSTAGLMQEADKIFDEMKKRGVIPDAT  907

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +Y  +I+ Y      +  +K Y D    G          ++  F K+ K+ ++ +L++++
Sbjct  908  TYDILITGYGNMGNKKKSIKLYYDMISEGFIPSTGTFNALISDFVKVGKMVQVRELIKEM  967

Query  569  KT  574
            +T
Sbjct  968  QT  969


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 106/220 (48%), Gaps = 3/220 (1%)
 Frame = +2

Query  2    KRGPRV--AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCI  175
            KRG R+  A  ++++    G  P ++ Y S+++ + ++G  S A  T  EM Q   D  +
Sbjct  603  KRGGRMQEAEVLFKEWTQSGLSPDRINYTSLIDGFFKVGKESDAFETAKEMAQNKIDFDV  662

Query  176  VAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE  355
            V Y+  +N   K G+  EA  +   M+E G  P+   YN +++ + +  N++   K+W E
Sbjct  663  VVYNVFINGLLKLGKFDEAQSMYTGMREMGMFPDCATYNIMINEYCKDGNLENALKLWNE  722

Query  356  MKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNK  535
            M+   + P  ++  +++  + KA ++   +    +  + G   +     +++   SKMN 
Sbjct  723  MRSCGLFPKSLTCNTLVGEFCKAGKMHKAIDLLNEMVVAGFHPNLVTHKVVLDACSKMNG  782

Query  536  VDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             D + ++ + L     K D+ +Y + +  L   G+  +A 
Sbjct  783  -DSIFEMHEKLIVMGFKPDQMVYNTLIAILCRRGMTRKAN  821


 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 102/203 (50%), Gaps = 4/203 (2%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E+++  GC P  V  +SI+N  C+ G  ++  +   EME++G      +YSS+++ + KT
Sbjct  371  EEMLKSGCLPDVVFCSSIVNGLCKSGRLTEGRLFLREMERRGAAPNHFSYSSLIDSFAKT  430

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHG--RASNMKQVEKVWKEMKRRKVVPDRV  388
            G   +A  L  +M  RG   ++ +YN L  IHG  +   + + E ++  +   +VVP+ +
Sbjct  431  GNIIDAHILQGEMVVRGIAFDLVVYNNL--IHGLFKVGKVDEAEDLFCALPMLQVVPNYI  488

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +Y+ +I+  SKA ++   V   Q  +    + +  +   ++  ++K   +D  V  +Q +
Sbjct  489  TYSILINGRSKAGDMMGAVSVVQVMERKHLRPNVIIYSSLINGYTKQGMLDAAVDYMQRM  548

Query  569  KTDETKLDERLYRSALNALRDAG  637
            K      +  ++ + ++    AG
Sbjct  549  KDQNVSPNVFIFGTLIDGYLKAG  571


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/175 (23%), Positives = 85/175 (49%), Gaps = 0/175 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V + +  +   P  + Y+S++N Y + G+   A      M+ +     +  + ++++
Sbjct  506  AVSVVQVMERKHLRPNVIIYSSLINGYTKQGMLDAAVDYMQRMKDQNVSPNVFIFGTLID  565

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K G+ ++A  L  +M  RG E N +I +  ++ + R   M++ E ++KE  +  + P
Sbjct  566  GYLKAGKQEDAIALYDEMGWRGLEVNKFILDVFVNNYKRGGRMQEAEVLFKEWTQSGLSP  625

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            DR++YTS+I  + K  +     +  ++   N    D  +  + +    K+ K DE
Sbjct  626  DRINYTSLIDGFFKVGKESDAFETAKEMAQNKIDFDVVVYNVFINGLLKLGKFDE  680


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 87/171 (51%), Gaps = 1/171 (1%)
 Frame = +2

Query  2    KRG-PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIV  178
            +RG  R A    + ++ +G     VTY +++N YC+     KA   +S+M  +G    ++
Sbjct  813  RRGMTRKANHALKDMIRRGISANTVTYNALINGYCKSSHLKKAAALYSQMLAEGISPNVI  872

Query  179  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  358
             Y+++++ +   G  +EA ++  +MK+RG  P+   Y+ L+  +G   N K+  K++ +M
Sbjct  873  TYNTLLSGFSTAGLMQEADKIFDEMKKRGVIPDATTYDILITGYGNMGNKKKSIKLYYDM  932

Query  359  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
                 +P   ++ ++IS + K  ++    +  ++ +  G   + +   I++
Sbjct  933  ISEGFIPSTGTFNALISDFVKVGKMVQVRELIKEMQTKGVSPNSSTYDILI  983


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 86/183 (47%), Gaps = 0/183 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +Y+++  +G E  +      +N Y R G   +AE+ F E  Q G     + Y+S+++
Sbjct  576  AIALYDEMGWRGLEVNKFILDVFVNNYKRGGRMQEAEVLFKEWTQSGLSPDRINYTSLID  635

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G+  +A     +M +   + +V +YN  ++   +     + + ++  M+   + P
Sbjct  636  GFFKVGKESDAFETAKEMAQNKIDFDVVVYNVFINGLLKLGKFDEAQSMYTGMREMGMFP  695

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  +Y  +I+ Y K   LE+ +K + + +  G          +VG F K  K+ + + LL
Sbjct  696  DCATYNIMINEYCKDGNLENALKLWNEMRSCGLFPKSLTCNTLVGEFCKAGKMHKAIDLL  755

Query  560  QDL  568
             ++
Sbjct  756  NEM  758


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/192 (22%), Positives = 89/192 (46%), Gaps = 0/192 (0%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P  +TY+ ++N   + G    A      ME+K     ++ YSS++N Y K G    A   
Sbjct  485  PNYITYSILINGRSKAGDMMGAVSVVQVMERKHLRPNVIIYSSLINGYTKQGMLDAAVDY  544

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
            + +MK++   PNV+I+ TL+D + +A   +    ++ EM  R +  ++      ++ Y +
Sbjct  545  MQRMKDQNVSPNVFIFGTLIDGYLKAGKQEDAIALYDEMGWRGLEVNKFILDVFVNNYKR  604

Query  422  AKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERL  601
               ++     ++++  +G   DR     ++  F K+ K  +  +  +++  ++   D  +
Sbjct  605  GGRMQEAEVLFKEWTQSGLSPDRINYTSLIDGFFKVGKESDAFETAKEMAQNKIDFDVVV  664

Query  602  YRSALNALRDAG  637
            Y   +N L   G
Sbjct  665  YNVFINGLLKLG  676


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/175 (27%), Positives = 86/175 (49%), Gaps = 5/175 (3%)
 Frame = +2

Query  59   EPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS--MVNMYGKTGRHKEA  232
            E   V+Y +I+  +C+ G   +A    SEM +K  D  I +++   +V  + + G  ++A
Sbjct  173  ESDTVSYNTIIWGFCKEGFTEQALGLLSEMIKK--DVLIDSFTCNILVKGFCQIGLFRDA  230

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
              L+ K+   G   ++   NTL+D + +  +MK   K+ + M+R    PD V+Y ++IS 
Sbjct  231  ESLMGKLVNEGINQDIIGLNTLIDGYCKVGDMKAALKLKENMRREGFRPDTVTYNTLISG  290

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTD  577
            + + +E++   K   +  L G KT+     I        N V++ V    DL+ D
Sbjct  291  FYRIREIDEADKLLDEMTL-GLKTNANSFEIHTSQCQDENAVEDNVTGCSDLEPD  344


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/218 (21%), Positives = 94/218 (43%), Gaps = 1/218 (0%)
 Frame = +2

Query  2    KRGPRVAATVYE-KLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIV  178
            K G  + A + + ++V +G     V Y ++++   ++G   +AE  F  +         +
Sbjct  429  KTGNIIDAHILQGEMVVRGIAFDLVVYNNLIHGLFKVGKVDEAEDLFCALPMLQVVPNYI  488

Query  179  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  358
             YS ++N   K G    A  +V  M+ +   PNV IY++L++ + +   +       + M
Sbjct  489  TYSILINGRSKAGDMMGAVSVVQVMERKHLRPNVIIYSSLINGYTKQGMLDAAVDYMQRM  548

Query  359  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  538
            K + V P+   + ++I  Y KA + E  +  Y +    G + ++ +  + V  + +  ++
Sbjct  549  KDQNVSPNVFIFGTLIDGYLKAGKQEDAIALYDEMGWRGLEVNKFILDVFVNNYKRGGRM  608

Query  539  DELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  652
             E   L ++        D   Y S ++     G E  A
Sbjct  609  QEAEVLFKEWTQSGLSPDRINYTSLIDGFFKVGKESDA  646


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/192 (23%), Positives = 81/192 (42%), Gaps = 1/192 (1%)
 Frame = +2

Query  2    KRGPRVAATVY-EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIV  178
            K+G   AA  Y +++  Q   P    + ++++ Y + G    A   + EM  +G +    
Sbjct  534  KQGMLDAAVDYMQRMKDQNVSPNVFIFGTLIDGYLKAGKQEDAIALYDEMGWRGLEVNKF  593

Query  179  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  358
                 VN Y + GR +EA  L  +  + G  P+   Y +L+D   +        +  KEM
Sbjct  594  ILDVFVNNYKRGGRMQEAEVLFKEWTQSGLSPDRINYTSLIDGFFKVGKESDAFETAKEM  653

Query  359  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  538
             + K+  D V Y   I+   K  + +     Y   +  G   D A   IM+  + K   +
Sbjct  654  AQNKIDFDVVVYNVFINGLLKLGKFDEAQSMYTGMREMGMFPDCATYNIMINEYCKDGNL  713

Query  539  DELVKLLQDLKT  574
            +  +KL  ++++
Sbjct  714  ENALKLWNEMRS  725



>gb|AFV61125.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
micrantha]
Length=406

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  68   REARSLISEMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  124

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  125  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  184

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  185  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  244

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  245  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  283


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  105  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  164

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  165  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  224

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  225  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  284

Query  560  QDLK  571
             +LK
Sbjct  285  HELK  288


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (46%), Gaps = 4/201 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  175  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  234

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  235  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  290

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  291  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEAKDITVFERMIHLLSKYKKYSNVVEVF  350

Query  560  QDLKTDETKLDERLYRSALNA  622
              ++      D  +    LNA
Sbjct  351  DKMRGLGYFPDSNVIAVVLNA  371


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 80/168 (48%), Gaps = 0/168 (0%)
 Frame = +2

Query  137  FSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGR  316
              +MEQ      +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+
Sbjct  4    LQKMEQDQVPGDLVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGK  63

Query  317  ASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAM  496
            A   ++   +  EMK   V+P+  SY+++++ Y + K+    +  + + +      D   
Sbjct  64   AKLFREARSLISEMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTT  123

Query  497  AGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
              IM+ V+ ++    E  KL   ++    + +   Y + L    DA L
Sbjct  124  CNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  171


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/180 (21%), Positives = 79/180 (44%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS-------EMEQKGFDKCIV  178
            A  + +++ S+G EP  +TY++I++I+ ++G   +A M F        E++Q  F   IV
Sbjct  210  ANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIV  269

Query  179  AY------------------------SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            AY                         + +++    GR +EAT +  +  + G   ++ +
Sbjct  270  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEAKDITV  329

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K +E +     Y + +
Sbjct  330  FERMIHLLSKYKKYSNVVEVFDKMRGLGYFPDSNVIAVVLNAYGKLQEFDKANDVYMEMQ  389



>gb|AFV61133.1| pentatricopeptide repeat-containing protein 123, partial [Lippia 
brasiliensis]
Length=382

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  57   REARSLISEMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  113

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  114  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  173

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  174  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  233

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  234  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  272


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  94   ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  153

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  154  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  213

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  214  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  273

Query  560  QDLK  571
             +LK
Sbjct  274  HELK  277


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (46%), Gaps = 4/201 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  164  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  223

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  224  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  279

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  280  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIHLLSKYKKYXNVVEVF  339

Query  560  QDLKTDETKLDERLYRSALNA  622
              ++      D  +    LNA
Sbjct  340  DKMRGLGYFPDSNVIAVVLNA  360


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 76/156 (49%), Gaps = 0/156 (0%)
 Frame = +2

Query  173  IVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWK  352
            +V YS+++ +  K   + +A  + +++K  G  P++  YN ++++ G+A   ++   +  
Sbjct  5    LVLYSNLIELSRKLCDYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLIS  64

Query  353  EMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN  532
            EMK   V+P+  SY+++++ Y + K+    +  + + +      D     IM+ V+ ++ 
Sbjct  65   EMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLG  124

Query  533  KVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
               E  KL   ++    + +   Y + L    DA L
Sbjct  125  MAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAEL  160


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/180 (21%), Positives = 79/180 (44%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS-------EMEQKGFDKCIV  178
            A  + +++ S+G EP  +TY++I++I+ ++G   +A M F        E++Q  F   IV
Sbjct  199  ANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIV  258

Query  179  AY------------------------SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            AY                         + +++    GR +EAT +  +  + G   ++ +
Sbjct  259  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  318

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K +E +     Y + +
Sbjct  319  FERMIHLLSKYKKYXNVVEVFDKMRGLGYFPDSNVIAVVLNAYGKLQEFDKANDVYMEMQ  378



>gb|ACU25737.1| pentatricopeptide repeat-containing protein [Verbena macdougalii]
Length=426

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   F+EM +    KC++  ++ 
Sbjct  96   REARSLISEMRTAGVTPNTASYSTLLTMYVENKKFLEALSVFAEMREI---KCLLDLTTC  152

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  153  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  212

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S++  Y K  E E      Q+ +  G + +      ++ ++SK+ K+D 
Sbjct  213  KNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEPNSITYSTIISIWSKVGKLDR  272

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++    +D+ LY++ + A   AGL   AK L
Sbjct  273  AAMLFQKLRSSGVDIDQVLYQTMIVAYEKAGLVAHAKRL  311


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  133  ALSVFAEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  192

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  193  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMMMIYGKTLEHEKANNLIQEMQNRGIEP  252

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS +SK  +L+     +Q  + +G   D+ +   M+  + K   V    +LL
Sbjct  253  NSITYSTIISIWSKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIVAYEKAGLVAHAKRLL  312

Query  560  QDLK  571
             +LK
Sbjct  313  HELK  316


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 94/197 (48%), Gaps = 0/197 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +
Sbjct  3    RALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSK  62

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + +++K  G  P++  YN ++++ G+A   ++   +  EM+   V P+  SY+++++
Sbjct  63   AISIFSRLKRSGFTPDIVAYNAMINVFGKAKLFREARSLISEMRTAGVTPNTASYSTLLT  122

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + 
Sbjct  123  MYVENKKFLEALSVFAEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEP  182

Query  590  DERLYRSALNALRDAGL  640
            +   Y + L    DA L
Sbjct  183  NVVSYNTLLRVYGDAEL  199


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/180 (22%), Positives = 74/180 (41%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + +++ ++G EP  +TY++I++I+ ++G   +A M F ++   G D   V Y +M+ 
Sbjct  238  ANNLIQEMQNRGIEPNSITYSTIISIWSKVGKLDRAAMLFQKLRSSGVDIDQVLYQTMIV  297

Query  200  MYGKTGRHKEATRLVAKMKERGCEPN----------------VWIYNTLLD---------  304
             Y K G    A RL+ ++K     P                  W++   +D         
Sbjct  298  AYEKAGLVAHAKRLLHELKRPDNIPRDIAIHILVGAGRIEEATWVFRQAIDAGEVKDITV  357

Query  305  ----IH--GRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
                IH   +      V +V+ +M      PD      +++AY K  E +     Y + +
Sbjct  358  FERMIHLFSKYKKYGNVVEVFDKMCGLGYFPDSNVIALILNAYGKLHEFDKANDVYMEMQ  417



>ref|XP_006405260.1| hypothetical protein EUTSA_v10027665mg [Eutrema salsugineum]
 gb|ESQ46713.1| hypothetical protein EUTSA_v10027665mg [Eutrema salsugineum]
Length=704

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 105/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A T +++++S+G EP +VT+ ++++ +C+ G +  AE  F  ME++G   C   Y+ M+N
Sbjct  458  AMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMEKRGCLPCATTYNIMIN  517

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG   R  +  RL+ KMK +G  PNV  + TL+D++G++       +  +EMK   + P
Sbjct  518  SYGDQERWNDMKRLLGKMKSQGVLPNVVTHTTLVDVYGKSGRFNDAIECLEEMKSVGLKP  577

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++    +G K        ++  F +  +  E   +L
Sbjct  578  SSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGEDRRDAEAFAVL  637

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +    D   Y + + AL
Sbjct  638  QYMKENGVNPDVVTYTTLMKAL  659


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 105/221 (48%), Gaps = 14/221 (6%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ S G +P +  Y  +++ + +      A  TF  M  +G +   V ++++++ + 
Sbjct  426  VLKEMKSLGVKPDRQFYNVVIDTFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHC  485

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K GRH  A  +   M++RGC P    YN +++ +G       ++++  +MK + V+P+ V
Sbjct  486  KHGRHIVAEEMFEAMEKRGCLPCATTYNIMINSYGDQERWNDMKRLLGKMKSQGVLPNVV  545

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            ++T+++  Y K+      ++  ++ K  G K    M   ++  +++    ++ V   + +
Sbjct  546  THTTLVDVYGKSGRFNDAIECLEEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVM  605

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQESFAV  679
             +D  K       S +NA     RDA          E+FAV
Sbjct  606  TSDGLKPSLLALNSLINAFGEDRRDA----------EAFAV  636


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/220 (24%), Positives = 100/220 (45%), Gaps = 0/220 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A  +     + G      T  SI++     G   +AE  F E+ Q G      AY++
Sbjct  280  PSRALQILGMAQATGLSAKTATLVSIISALANSGRTLEAEALFEELRQSGIKPRTKAYNA  339

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y KTG  K+A  +V++M++RG  P+   Y+ L+D +  A   +    V KEM+   
Sbjct  340  LLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLKEMEAGD  399

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            V P+   ++ +++ Y    E +   +  ++ K  G K DR    +++  F K N +D  +
Sbjct  400  VQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSLGVKPDRQFYNVVIDTFGKFNCLDHAM  459

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQES  670
                 + ++  + D   + + ++     G  I A+ + E+
Sbjct  460  TTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEA  499


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 67/132 (51%), Gaps = 0/132 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E++ S G +P    Y +++N Y + G+  +A   F  M   G    ++A +S++N +G+ 
Sbjct  568  EEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGED  627

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSY  394
             R  EA  ++  MKE G  P+V  Y TL+    R    ++V  V++EM      PDR + 
Sbjct  628  RRDAEAFAVLQYMKENGVNPDVVTYTTLMKALIRVDKFQKVPGVYEEMIMSGCKPDRKAR  687

Query  395  TSVISAYSKAKE  430
            + + SA    K+
Sbjct  688  SMLRSALRYMKQ  699


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/211 (21%), Positives = 93/211 (44%), Gaps = 0/211 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ +L  Y   G + K      EM+  G       Y+ +++
Sbjct  388  ARIVLKEMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSLGVKPDRQFYNVVID  447

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G EP+   +NTL+D H +       E++++ M++R  +P
Sbjct  448  TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMEKRGCLP  507

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++Y   +      +     K  G   +      +V V+ K  + ++ ++ L
Sbjct  508  CATTYNIMINSYGDQERWNDMKRLLGKMKSQGVLPNVVTHTTLVDVYGKSGRFNDAIECL  567

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            +++K+   K    +Y + +NA    GL  +A
Sbjct  568  EEMKSVGLKPSSTMYNALINAYAQRGLSEQA  598


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 78/176 (44%), Gaps = 0/176 (0%)
 Frame = +2

Query  98   YCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPN  277
            + + G  S+A       +  G         S+++    +GR  EA  L  ++++ G +P 
Sbjct  274  FAKSGDPSRALQILGMAQATGLSAKTATLVSIISALANSGRTLEAEALFEELRQSGIKPR  333

Query  278  VWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQ  457
               YN LL  + +   +K  E +  EM++R V PD  +Y+ +I AY  A   ES     +
Sbjct  334  TKAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWESARIVLK  393

Query  458  DFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
            + +    + +  +   ++  +    +  +  ++L+++K+   K D + Y   ++  
Sbjct  394  EMEAGDVQPNSFVFSRLLAGYRDRGEWQKTFQVLKEMKSLGVKPDRQFYNVVIDTF  449



>gb|AFV61123.1| pentatricopeptide repeat-containing protein 123, partial [Lantana 
urticoides]
Length=423

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  86   REARSLISEMKTAGVMPNTTSYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  142

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  143  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  202

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  203  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  262

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  263  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  301


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  123  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  182

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  183  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  242

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  243  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  302

Query  560  QDLK  571
             +LK
Sbjct  303  HELK  306


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 92/189 (49%), Gaps = 0/189 (0%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKM  253
            TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +A  + +++
Sbjct  1    TYSTLITHFGKEGLFDAALSWLQKMEQDQVPGDLVLYSNLIELSRKLCDYSKAISIFSRL  60

Query  254  KERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKEL  433
            K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY+++++ Y + K+ 
Sbjct  61   KSSGFTPDLVAYNAMINVFGKAKLFREARSLISEMKTAGVMPNTTSYSTLLTMYVENKKF  120

Query  434  ESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSA  613
               +  + + +      D     IM+ V+ ++    E  KL   ++    + +   Y + 
Sbjct  121  LEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTL  180

Query  614  LNALRDAGL  640
            L    DA L
Sbjct  181  LRVYGDAEL  189


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (46%), Gaps = 4/201 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  193  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  252

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  253  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  308

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  309  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIHLLSKYKKYSNVVEVF  368

Query  560  QDLKTDETKLDERLYRSALNA  622
              ++      D  +    LNA
Sbjct  369  DKMRGLGYFPDSNVIAVVLNA  389


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/180 (21%), Positives = 79/180 (44%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS-------EMEQKGFDKCIV  178
            A  + +++ S+G EP  +TY++I++I+ ++G   +A M F        E++Q  F   IV
Sbjct  228  ANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIV  287

Query  179  AY------------------------SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            AY                         + +++    GR +EAT +  +  + G   ++ +
Sbjct  288  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  347

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K +E +     Y + +
Sbjct  348  FERMIHLLSKYKKYSNVVEVFDKMRGLGYFPDSNVIAVVLNAYGKLQEFDKANDVYMEMQ  407



>ref|XP_008347337.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial-like, partial [Malus domestica]
Length=597

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 104/202 (51%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +E+++S+G  P  VT+ ++++ +C+ G + +AE  F EM+Q G   C   Y+ M+N
Sbjct  352  AMATFERMLSEGIHPDTVTWNTLIDCHCKSGHHVRAEELFEEMQQSGCAPCATTYNIMIN  411

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +G+  R  E   L+ KM+ +G  PN+  Y TL+DI+G++       +  + MK   + P
Sbjct  412  SFGEQQRWDEVKGLLGKMQSQGLLPNIVTYTTLVDIYGKSGRFTDAIECLEVMKSAGMKP  471

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  +  ++  + +G K        ++  F +  +  E   +L
Sbjct  472  SPTMYNALINAYAQRGLSEQALNAFRVMRADGLKPSPLALNSLINAFGEDRRDTEAFSVL  531

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K ++ K D   Y + +  L
Sbjct  532  QYMKENDLKPDVVTYTTLMKTL  553


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/219 (23%), Positives = 104/219 (47%), Gaps = 0/219 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A  +   + + G  P   T  ++++     G   +AE  F EM + G      AY++
Sbjct  174  PSQAVHLLAMVQATGLSPKTATLVAVISALGNSGRVVEAEAIFEEMREGGLQPRTRAYNA  233

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y K G+ K+A  +V++M++ G  P+   Y+ L+D +  A   +    V KEM+   
Sbjct  234  LLKGYVKAGQLKDAESIVSQMEKSGISPDEHTYSLLIDAYANAGRWESARIVLKEMEASN  293

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            V P+   ++ ++++Y    E +   +  ++ K +G + DR    +M+  F K N +D  +
Sbjct  294  VQPNSYVFSRILASYRDRGEWQKSFQVLREMKSSGVRPDRHFYNVMIDTFGKSNCLDHAM  353

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
               + + ++    D   + + ++    +G  +RA+ L E
Sbjct  354  ATFERMLSEGIHPDTVTWNTLIDCHCKSGHHVRAEELFE  392


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 92/199 (46%), Gaps = 0/199 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V  ++ S G  P +  Y  +++ + +      A  TF  M  +G     V ++++++ + 
Sbjct  320  VLREMKSSGVRPDRHFYNVMIDTFGKSNCLDHAMATFERMLSEGIHPDTVTWNTLIDCHC  379

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K+G H  A  L  +M++ GC P    YN +++  G      +V+ +  +M+ + ++P+ V
Sbjct  380  KSGHHVRAEELFEEMQQSGCAPCATTYNIMINSFGEQQRWDEVKGLLGKMQSQGLLPNIV  439

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT+++  Y K+      ++  +  K  G K    M   ++  +++    ++ +   + +
Sbjct  440  TYTTLVDIYGKSGRFTDAIECLEVMKSAGMKPSPTMYNALINAYAQRGLSEQALNAFRVM  499

Query  569  KTDETKLDERLYRSALNAL  625
            + D  K       S +NA 
Sbjct  500  RADGLKPSPLALNSLINAF  518


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  35   EKLVSQ----GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNM  202
            E +VSQ    G  P + TY+ +++ Y   G +  A +   EME          +S ++  
Sbjct  248  ESIVSQMEKSGISPDEHTYSLLIDAYANAGRWESARIVLKEMEASNVQPNSYVFSRILAS  307

Query  203  YGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  382
            Y   G  +++ +++ +MK  G  P+   YN ++D  G+++ +      ++ M    + PD
Sbjct  308  YRDRGEWQKSFQVLREMKSSGVRPDRHFYNVMIDTFGKSNCLDHAMATFERMLSEGIHPD  367

Query  383  RVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQ  562
             V++ ++I  + K+       + +++ + +G         IM+  F +  + DE+  LL 
Sbjct  368  TVTWNTLIDCHCKSGHHVRAEELFEEMQQSGCAPCATTYNIMINSFGEQQRWDEVKGLLG  427

Query  563  DLKT  574
             +++
Sbjct  428  KMQS  431


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 72/151 (48%), Gaps = 0/151 (0%)
 Frame = +2

Query  38   KLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTG  217
            K+ SQG  P  VTY ++++IY + G ++ A      M+  G       Y++++N Y + G
Sbjct  428  KMQSQGLLPNIVTYTTLVDIYGKSGRFTDAIECLEVMKSAGMKPSPTMYNALINAYAQRG  487

Query  218  RHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYT  397
              ++A      M+  G +P+    N+L++  G      +   V + MK   + PD V+YT
Sbjct  488  LSEQALNAFRVMRADGLKPSPLALNSLINAFGEDRRDTEAFSVLQYMKENDLKPDVVTYT  547

Query  398  SVISAYSKAKELESCVKYYQDFKLNGGKTDR  490
            +++    +  +       Y++  ++G   DR
Sbjct  548  TLMKTLIRVDKFCKVPAVYEEMIMSGCTPDR  578


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 57/117 (49%), Gaps = 0/117 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E + S G +P    Y +++N Y + G+  +A   F  M   G     +A +S++N +G+ 
Sbjct  462  EVMKSAGMKPSPTMYNALINAYAQRGLSEQALNAFRVMRADGLKPSPLALNSLINAFGED  521

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             R  EA  ++  MKE   +P+V  Y TL+    R     +V  V++EM      PDR
Sbjct  522  RRDTEAFSVLQYMKENDLKPDVVTYTTLMKTLIRVDKFCKVPAVYEEMIMSGCTPDR  578



>gb|AIU48580.1| tetratricopeptide repeat-like superfamily protein, partial [Houttuynia 
cordata]
Length=470

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 116/216 (54%), Gaps = 3/216 (1%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++  +G     VTY S+++       Y +    + +M++ G    +V+Y+ ++N
Sbjct  226  ARELFKEMAKRGIPQTTVTYNSLMSFESN---YKEVSSVYDQMQRAGLQPDVVSYTLLIN  282

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YGK  R +EA  +  +M + G  P    YNTLLD    +  +++   V+K M+R K  P
Sbjct  283  AYGKARREEEALAVFEEMLDAGVRPTRKAYNTLLDAFAISGMVEKARTVFKSMRRDKCTP  342

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D  SYT++ISAY  A ++E   K+++  + +G + +    G ++  ++K++ V++++K+ 
Sbjct  343  DLCSYTTMISAYVNAADMEGAEKFFRRVRQDGFEPNVVTYGALLKGYAKIDDVEKIMKIY  402

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
            +D++    K ++ ++ + ++A           W +E
Sbjct  403  EDMRIQGIKPNQTIFTTIMDAHGKNDFGCAVTWYKE  438


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/234 (19%), Positives = 106/234 (45%), Gaps = 41/234 (18%)
 Frame = +2

Query  68   QVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVA  247
            ++ +  ++  Y ++G + KAEM    M + G+   + ++++++  YG+ G++ +A  +  
Sbjct  99   EMDFLMLITAYGKLGDFHKAEMILRYMTKHGYPPSVGSHTALMEAYGRAGQYNKADAIFR  158

Query  248  KMKERGCEPNVW--------------------IYNTLLD------------------IHG  313
            +M+  G EP+                      I+NTL++                  +H 
Sbjct  159  RMQSSGPEPSALTYQIILKIFVEGNKFDEAGSIFNTLINDERPTFRPDQKMFHMMIYMHK  218

Query  314  RASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRA  493
            +A +  Q  +++KEM +R +    V+Y S++S  S  KE+ S    Y   +  G + D  
Sbjct  219  KAGSYAQARELFKEMAKRGIPQTTVTYNSLMSFESNYKEVSSV---YDQMQRAGLQPDVV  275

Query  494  MAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
               +++  + K  + +E + + +++     +   + Y + L+A   +G+  +A+
Sbjct  276  SYTLLINAYGKARREEEALAVFEEMLDAGVRPTRKAYNTLLDAFAISGMVEKAR  329



>ref|XP_002510663.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52850.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=695

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 106/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   ++K++S+G +P  VT+ ++++ +C+  ++ +AE  F EM +KGF  C+  ++ M+N
Sbjct  450  AMDTFDKMLSEGIQPDTVTWNTLIDCHCKAELHERAEELFEEMMEKGFSPCVTTFNIMIN  509

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +G+  R  +   L+  M+  G  PNV  Y TL+DI+G++       +  ++MK   + P
Sbjct  510  SFGEQERWDDVKTLMGNMRSLGLLPNVVTYTTLIDIYGKSGRFSDAIECLEDMKSAGLKP  569

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++  + +  K        ++  F +  +  E   +L
Sbjct  570  SSTMYNALINAYAQKGLSEQAVNAFRLMRADSLKPSLLALNSLINAFGEDRRDAEAFSVL  629

Query  560  QDLKTDETKLDERLYRSALNAL  625
            + +K ++ K D   Y + + AL
Sbjct  630  KYMKENDLKPDVVTYTTLMKAL  651


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/207 (23%), Positives = 97/207 (47%), Gaps = 0/207 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            + G  P   T  ++++     G   +AE  F EM+  G      AY+ ++  Y K G  K
Sbjct  284  ASGLSPRTATLIAVISALGDSGRIIEAEAIFEEMKDNGLKPKTRAYNGLLKGYVKAGMLK  343

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M+  G  P+   Y+ L+D +  A   +    V KEM+   ++P+   ++ ++
Sbjct  344  DAEFIVSEMERSGVSPDECTYSLLIDAYSNAGRWESARIVLKEMEANNIMPNSYVFSRIL  403

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETK  586
            ++Y    E +   +  ++ K +G + DR    +M+  F K + +D  +     + ++  +
Sbjct  404  ASYRDRGEWQKSFQVLKEMKNSGVRPDRHFYNVMIDTFGKFSCLDHAMDTFDKMLSEGIQ  463

Query  587  LDERLYRSALNALRDAGLEIRAKWLQE  667
             D   + + ++    A L  RA+ L E
Sbjct  464  PDTVTWNTLIDCHCKAELHERAEELFE  490


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 100/218 (46%), Gaps = 4/218 (2%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V +++ + G  P +  Y  +++ + +      A  TF +M  +G     V ++++++ + 
Sbjct  418  VLKEMKNSGVRPDRHFYNVMIDTFGKFSCLDHAMDTFDKMLSEGIQPDTVTWNTLIDCHC  477

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K   H+ A  L  +M E+G  P V  +N +++  G       V+ +   M+   ++P+ V
Sbjct  478  KAELHERAEELFEEMMEKGFSPCVTTFNIMINSFGEQERWDDVKTLMGNMRSLGLLPNVV  537

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT++I  Y K+      ++  +D K  G K    M   ++  +++    ++ V   + +
Sbjct  538  TYTTLIDIYGKSGRFSDAIECLEDMKSAGLKPSSTMYNALINAYAQKGLSEQAVNAFRLM  597

Query  569  KTDETKLDERLYRSALNAL----RDAGLEIRAKWLQES  670
            + D  K       S +NA     RDA      K+++E+
Sbjct  598  RADSLKPSLLALNSLINAFGEDRRDAEAFSVLKYMKEN  635


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 73/155 (47%), Gaps = 0/155 (0%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMY  205
            T+   + S G  P  VTY ++++IY + G +S A     +M+  G       Y++++N Y
Sbjct  522  TLMGNMRSLGLLPNVVTYTTLIDIYGKSGRFSDAIECLEDMKSAGLKPSSTMYNALINAY  581

Query  206  GKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             + G  ++A      M+    +P++   N+L++  G      +   V K MK   + PD 
Sbjct  582  AQKGLSEQAVNAFRLMRADSLKPSLLALNSLINAFGEDRRDAEAFSVLKYMKENDLKPDV  641

Query  386  VSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDR  490
            V+YT+++ A  +  +       Y++  L G   DR
Sbjct  642  VTYTTLMKALIRVDKFNKVPSVYEEMILAGCTPDR  676


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 85/185 (46%), Gaps = 0/185 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +  ++   G  P + TY+ +++ Y   G +  A +   EME          +S ++ 
Sbjct  345  AEFIVSEMERSGVSPDECTYSLLIDAYSNAGRWESARIVLKEMEANNIMPNSYVFSRILA  404

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G  +++ +++ +MK  G  P+   YN ++D  G+ S +      + +M    + P
Sbjct  405  SYRDRGEWQKSFQVLKEMKNSGVRPDRHFYNVMIDTFGKFSCLDHAMDTFDKMLSEGIQP  464

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++ ++I  + KA+  E   + +++    G         IM+  F +  + D++  L+
Sbjct  465  DTVTWNTLIDCHCKAELHERAEELFEEMMEKGFSPCVTTFNIMINSFGEQERWDDVKTLM  524

Query  560  QDLKT  574
             ++++
Sbjct  525  GNMRS  529


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 70/147 (48%), Gaps = 4/147 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G +P    Y  +L  Y + G+   AE   SEME+ G       YS +++
Sbjct  310  AEAIFEEMKDNGLKPKTRAYNGLLKGYVKAGMLKDAEFIVSEMERSGVSPDECTYSLLID  369

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+     PN ++++ +L  +      ++  +V KEMK   V P
Sbjct  370  AYSNAGRWESARIVLKEMEANNIMPNSYVFSRILASYRDRGEWQKSFQVLKEMKNSGVRP  429

Query  380  DRVSYTSVISAYSKAKELESCVKYYQD  460
            DR  Y  +I  + K     SC+ +  D
Sbjct  430  DRHFYNVMIDTFGKF----SCLDHAMD  452



>ref|XP_008377072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial-like [Malus domestica]
Length=721

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 104/202 (51%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +E+++S+G  P  VT+ ++++ +C+ G + +AE  F EM+Q G   C   Y+ M+N
Sbjct  476  AMATFERMLSEGIHPDTVTWNTLIDCHCKSGHHVRAEELFEEMQQSGCAPCATTYNIMIN  535

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +G+  R  E   L+ KM+ +G  PN+  Y TL+DI+G++       +  + MK   + P
Sbjct  536  SFGEQQRWDEVKGLLGKMQSQGLLPNIVTYTTLVDIYGKSGRFTDAIECLEVMKSAGMKP  595

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  +  ++  + +G K        ++  F +  +  E   +L
Sbjct  596  SPTMYNALINAYAQRGLSEQALNAFRVMRADGLKPSPLALNSLINAFGEDRRDTEAFSVL  655

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K ++ K D   Y + +  L
Sbjct  656  QYMKENDLKPDVVTYTTLMKTL  677


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/219 (23%), Positives = 104/219 (47%), Gaps = 0/219 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A  +   + + G  P   T  ++++     G   +AE  F EM + G      AY++
Sbjct  298  PSQAVHLLAMVQATGLSPKTATLVAVISALGNSGRVVEAEAIFEEMREGGLQPRTRAYNA  357

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y K G+ K+A  +V++M++ G  P+   Y+ L+D +  A   +    V KEM+   
Sbjct  358  LLKGYVKAGQLKDAESIVSQMEKSGISPDEHTYSLLIDAYANAGRWESARIVLKEMEASN  417

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            V P+   ++ ++++Y    E +   +  ++ K +G + DR    +M+  F K N +D  +
Sbjct  418  VQPNSYVFSRILASYRDRGEWQKSFQVLREMKSSGVRPDRHFYNVMIDTFGKSNCLDHAM  477

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
               + + ++    D   + + ++    +G  +RA+ L E
Sbjct  478  ATFERMLSEGIHPDTVTWNTLIDCHCKSGHHVRAEELFE  516


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 92/199 (46%), Gaps = 0/199 (0%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V  ++ S G  P +  Y  +++ + +      A  TF  M  +G     V ++++++ + 
Sbjct  444  VLREMKSSGVRPDRHFYNVMIDTFGKSNCLDHAMATFERMLSEGIHPDTVTWNTLIDCHC  503

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K+G H  A  L  +M++ GC P    YN +++  G      +V+ +  +M+ + ++P+ V
Sbjct  504  KSGHHVRAEELFEEMQQSGCAPCATTYNIMINSFGEQQRWDEVKGLLGKMQSQGLLPNIV  563

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT+++  Y K+      ++  +  K  G K    M   ++  +++    ++ +   + +
Sbjct  564  TYTTLVDIYGKSGRFTDAIECLEVMKSAGMKPSPTMYNALINAYAQRGLSEQALNAFRVM  623

Query  569  KTDETKLDERLYRSALNAL  625
            + D  K       S +NA 
Sbjct  624  RADGLKPSPLALNSLINAF  642


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 86/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  35   EKLVSQ----GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNM  202
            E +VSQ    G  P + TY+ +++ Y   G +  A +   EME          +S ++  
Sbjct  372  ESIVSQMEKSGISPDEHTYSLLIDAYANAGRWESARIVLKEMEASNVQPNSYVFSRILAS  431

Query  203  YGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  382
            Y   G  +++ +++ +MK  G  P+   YN ++D  G+++ +      ++ M    + PD
Sbjct  432  YRDRGEWQKSFQVLREMKSSGVRPDRHFYNVMIDTFGKSNCLDHAMATFERMLSEGIHPD  491

Query  383  RVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQ  562
             V++ ++I  + K+       + +++ + +G         IM+  F +  + DE+  LL 
Sbjct  492  TVTWNTLIDCHCKSGHHVRAEELFEEMQQSGCAPCATTYNIMINSFGEQQRWDEVKGLLG  551

Query  563  DLKT  574
             +++
Sbjct  552  KMQS  555


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 72/151 (48%), Gaps = 0/151 (0%)
 Frame = +2

Query  38   KLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTG  217
            K+ SQG  P  VTY ++++IY + G ++ A      M+  G       Y++++N Y + G
Sbjct  552  KMQSQGLLPNIVTYTTLVDIYGKSGRFTDAIECLEVMKSAGMKPSPTMYNALINAYAQRG  611

Query  218  RHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYT  397
              ++A      M+  G +P+    N+L++  G      +   V + MK   + PD V+YT
Sbjct  612  LSEQALNAFRVMRADGLKPSPLALNSLINAFGEDRRDTEAFSVLQYMKENDLKPDVVTYT  671

Query  398  SVISAYSKAKELESCVKYYQDFKLNGGKTDR  490
            +++    +  +       Y++  ++G   DR
Sbjct  672  TLMKTLIRVDKFCKVPAVYEEMIMSGCTPDR  702


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/184 (23%), Positives = 84/184 (46%), Gaps = 3/184 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G +P    Y ++L  Y + G    AE   S+ME+ G       YS +++
Sbjct  336  AEAIFEEMREGGLQPRTRAYNALLKGYVKAGQLKDAESIVSQMEKSGISPDEHTYSLLID  395

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ +L  +      ++  +V +EMK   V P
Sbjct  396  AYANAGRWESARIVLKEMEASNVQPNSYVFSRILASYRDRGEWQKSFQVLREMKSSGVRP  455

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            DR  Y  +I  + K+  L+  +  ++     G   D      ++    K     + +EL 
Sbjct  456  DRHFYNVMIDTFGKSNCLDHAMATFERMLSEGIHPDTVTWNTLIDCHCKSGHHVRAEELF  515

Query  551  KLLQ  562
            + +Q
Sbjct  516  EEMQ  519


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 57/117 (49%), Gaps = 0/117 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E + S G +P    Y +++N Y + G+  +A   F  M   G     +A +S++N +G+ 
Sbjct  586  EVMKSAGMKPSPTMYNALINAYAQRGLSEQALNAFRVMRADGLKPSPLALNSLINAFGED  645

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             R  EA  ++  MKE   +P+V  Y TL+    R     +V  V++EM      PDR
Sbjct  646  RRDTEAFSVLQYMKENDLKPDVVTYTTLMKTLIRVDKFCKVPAVYEEMIMSGCTPDR  702



>ref|NP_001144813.1| uncharacterized protein LOC100277891 [Zea mays]
 gb|ACG43156.1| hypothetical protein [Zea mays]
Length=597

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 103/187 (55%), Gaps = 0/187 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  +  V+ ++ S GC+P   TY +++N + R G+  KAE  F EM+Q G +  + AY++
Sbjct  293  PMSSLRVFREMKSVGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNA  352

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y + G  + A+ + + M+  GCEP+   YN L+D  GRA   ++ E  ++E+K++ 
Sbjct  353  LMEAYSRAGLPQGASEIFSLMEHMGCEPDRASYNILVDAFGRAGLHQEAEAAFQELKQQG  412

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P   S+  ++SA++++  +  C +       +G + D      M+  + +  ++D++ 
Sbjct  413  MRPTMKSHMLLLSAHARSGNVARCEEVMAQLHKSGLRPDTFALNAMLNAYGRAGRLDDME  472

Query  551  KLLQDLK  571
            +L   ++
Sbjct  473  RLFAAME  479


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 110/233 (47%), Gaps = 41/233 (18%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGF---------  163
            P+ A+ ++  +   GCEP + +Y  +++ + R G++ +AE  F E++Q+G          
Sbjct  363  PQGASEIFSLMEHMGCEPDRASYNILVDAFGRAGLHQEAEAAFQELKQQGMRPTMKSHML  422

Query  164  -----------DKC---------------IVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
                        +C                 A ++M+N YG+ GR  +  RL A M ERG
Sbjct  423  LLSAHARSGNVARCEEVMAQLHKSGLRPDTFALNAMLNAYGRAGRLDDMERLFAAM-ERG  481

Query  266  -----CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKE  430
                   P+   YN L++ +GRA  + ++E  ++ +  R +  D V++TS I AY++ KE
Sbjct  482  DGASAGAPDTSTYNVLVNAYGRAGYLDRMEAAFRSLAARGLAADVVTWTSRIGAYARKKE  541

Query  431  LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               C++ +++    G   D   A +++   S   +V+++  +++ +  D   L
Sbjct  542  YGQCLRVFEEMVDAGCYPDAGTAKVLLAACSDERQVEQVTAIVRSMHKDAKTL  594


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/225 (26%), Positives = 96/225 (43%), Gaps = 35/225 (16%)
 Frame = +2

Query  2    KRGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA  181
            KR    A   Y  L+   C P + TYA +L  YC  G   +AE   SEM++ G       
Sbjct  185  KRQLSEAEAAYMALLEARCVPTEDTYALLLRAYCGSGQLHRAEGVISEMQRNGIPPTATV  244

Query  182  YSS-----------------------------------MVNMYGKTGRHKEATRLVAKMK  256
            Y++                                   M+N+YGK  +   + R+  +MK
Sbjct  245  YNAYLDGLLKARCSEKAVEVYQRMKKERCRTNTZTYXLMINVYGKANQPMSSLRVFREMK  304

Query  257  ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
              GC+PN+  Y  L++   R    ++ E+V++EM++    PD  +Y +++ AYS+A   +
Sbjct  305  SVGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQ  364

Query  437  SCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               + +   +  G + DRA   I+V  F +     E     Q+LK
Sbjct  365  GASEIFSLMEHMGCEPDRASYNILVDAFGRAGLHQEAEAAFQELK  409


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/206 (23%), Positives = 96/206 (47%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  VY+++  + C     TY  ++N+Y +      +   F EM+  G    I  Y+++VN
Sbjct  261  AVEVYQRMKKERCRTNTZTYXLMINVYGKANQPMSSLRVFREMKSVGCKPNICTYTALVN  320

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M++ G EP+V+ YN L++ + RA   +   +++  M+     P
Sbjct  321  AFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMEHMGCEP  380

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ A+ +A   +     +Q+ K  G +       +++   ++   V    +++
Sbjct  381  DRASYNILVDAFGRAGLHQEAEAAFQELKQQGMRPTMKSHMLLLSAHARSGNVARCEEVM  440

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              L     + D     + LNA   AG
Sbjct  441  AQLHKSGLRPDTFALNAMLNAYGRAG  466


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 98/213 (46%), Gaps = 10/213 (5%)
 Frame = +2

Query  20   AATVYEKL--VSQGCEPGQVTYASILNIYCRIGVYSKAE--MTFSE--MEQKGFDKCIVA  181
            AA+V+E L  + Q  +     +  I+N+  ++ +  + E  +T  E  + +  F   I+ 
Sbjct  119  AASVWESLDKIPQAHD----LWDDIVNVAVQLRLNRQWEPIITVCEWVLRRSSFRPDIIC  174

Query  182  YSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMK  361
            Y+ +++ YG+  +  EA      + E  C P    Y  LL  +  +  + + E V  EM+
Sbjct  175  YNLLIDAYGQKRQLSEAEAAYMALLEARCVPTEDTYALLLRAYCGSGQLHRAEGVISEMQ  234

Query  362  RRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            R  + P    Y + +    KA+  E  V+ YQ  K    +T+     +M+ V+ K N+  
Sbjct  235  RNGIPPTATVYNAYLDGLLKARCSEKAVEVYQRMKKERCRTNTZTYXLMINVYGKANQPM  294

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
              +++ +++K+   K +   Y + +NA    GL
Sbjct  295  SSLRVFREMKSVGCKPNICTYTALVNAFAREGL  327



>ref|XP_006594568.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like 
isoform X1 [Glycine max]
Length=479

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 106/184 (58%), Gaps = 7/184 (4%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++ ++GC+P   TY +++N  CR+G  S+A+  F EMEQKGF   +V Y+S+++
Sbjct  175  ALRIFQEMPNRGCQPDSYTYGTLINGLCRLGNISEAKELFKEMEQKGFSASVVTYTSLIH  234

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               ++    EA  L+ +MK    EPNV+ Y++L+D   +  +  Q  ++ + M ++  +P
Sbjct  235  GLCQSNNLDEAIGLLEEMKRNDIEPNVFTYSSLMDGLCKGGHSSQAMQLLEVMDKKHHLP  294

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAG-IMVGVFS------KMNKV  538
            + V+Y+++I+   K ++L   V+     ++ G K +  + G I+ G+ +        N +
Sbjct  295  NMVTYSTLINGLCKERKLREAVEILDRMRIQGLKPNAGLYGKIISGLCAAGSYQEAANFI  354

Query  539  DELV  550
            DE+V
Sbjct  355  DEMV  358


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 98/211 (46%), Gaps = 7/211 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + E++     EP   TY+S+++  C+ G  S+A      M++K     +V YS+++N
Sbjct  245  AIGLLEEMKRNDIEPNVFTYSSLMDGLCKGGHSSQAMQLLEVMDKKHHLPNMVTYSTLIN  304

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K  + +EA  ++ +M+ +G +PN  +Y  ++     A + ++      EM    + P
Sbjct  305  GLCKERKLREAVEILDRMRIQGLKPNAGLYGKIISGLCAAGSYQEAANFIDEMVLGGISP  364

Query  380  DRVSYTSVISAYSKAKE-LESCVKYYQDFKLNGGKTDRAMA------GIMVGVFSKMNKV  538
            +R S++  +  ++   + L + V   + F+L      R ++        +V  F K   +
Sbjct  365  NRASWSLHVRMHNMVVQGLCNNVDPPRAFQLYLSMRTRCISVEIDTFDCLVKCFCKRGDL  424

Query  539  DELVKLLQDLKTDETKLDERLYRSALNALRD  631
             +  ++L+++  D    DE ++   +  L D
Sbjct  425  HKAARILEEMVLDGCIPDEGVWNVVIGGLWD  455


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/188 (23%), Positives = 86/188 (46%), Gaps = 7/188 (4%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVNMYGKTGRHKEATRLV  244
            T+  I++    +  +  AE     M+Q   +KC+V    + S+   YG+  R  +A R+ 
Sbjct  52   TFGLIISRLVTVNQFRPAEGMLERMKQ---EKCMVTEDIFLSICRGYGRVHRPLDAIRVF  108

Query  245  AKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKA  424
             KM+     P    Y T+LDI    +++K+    ++EM+   +    VS   +I A  K 
Sbjct  109  HKMEGFQLRPTQKAYLTILDILVEENHVKRAIGFYREMRELGIPSSVVSLNILIKALCKN  168

Query  425  KE-LESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERL  601
            KE ++S ++ +Q+    G + D    G ++    ++  + E  +L ++++          
Sbjct  169  KETVDSALRIFQEMPNRGCQPDSYTYGTLINGLCRLGNISEAKELFKEMEQKGFSASVVT  228

Query  602  YRSALNAL  625
            Y S ++ L
Sbjct  229  YTSLIHGL  236



>ref|XP_011459077.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=698

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 107/202 (53%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +E+++S+G +P  VT+ ++++I+C+ G +++AE  F EM++ G   C   ++ M+N
Sbjct  452  AMATFERMLSEGIQPDTVTWNTLIDIHCKSGHHARAEELFEEMQESGCAPCATTFNIMIN  511

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              G+  R  E   L+ KM+ +G  PN+  Y TL+DI+G++       +  + MK   + P
Sbjct  512  SLGEQERWDEVKGLMGKMQSQGLLPNIVTYTTLVDIYGKSGRFNDAIECLEIMKSAGLKP  571

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  +  ++  + +G K        ++  F +  +  E   +L
Sbjct  572  SPTMYNALINAYAQRGLSELALNAFRVMRADGLKPSLLALNSLINAFGEDRRDAEAFSVL  631

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K ++ K D   Y + + AL
Sbjct  632  QYMKENDVKPDVVTYTTLMKAL  653


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/219 (22%), Positives = 100/219 (46%), Gaps = 0/219 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A      + + G  P   T  S+++     G   +AE  F EM++ G      AY++
Sbjct  274  PSQAMHFLAMVQASGLSPKTATLVSVISALGNAGRVVEAEAIFEEMKEGGLQPRTRAYNA  333

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++  Y K    ++A  +V++M+  G  P+   Y+ L+D +  A   +    V KEM+   
Sbjct  334  LLKGYVKAASLEDAESIVSQMERSGISPDEHTYSLLIDAYANAGRWESARIVLKEMEASN  393

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            V P+   ++ ++++Y    E +   +  ++ + +G   DR    +M+  F K N +D  +
Sbjct  394  VQPNSYVFSRILASYRDRGEWQKSFQVLREMRSSGVMPDRHFYNVMIDTFGKSNCLDHAM  453

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
               + + ++  + D   + + ++    +G   RA+ L E
Sbjct  454  ATFERMLSEGIQPDTVTWNTLIDIHCKSGHHARAEELFE  492


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/206 (21%), Positives = 95/206 (46%), Gaps = 4/206 (2%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V  ++ S G  P +  Y  +++ + +      A  TF  M  +G     V ++++++++ 
Sbjct  420  VLREMRSSGVMPDRHFYNVMIDTFGKSNCLDHAMATFERMLSEGIQPDTVTWNTLIDIHC  479

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K+G H  A  L  +M+E GC P    +N +++  G      +V+ +  +M+ + ++P+ V
Sbjct  480  KSGHHARAEELFEEMQESGCAPCATTFNIMINSLGEQERWDEVKGLMGKMQSQGLLPNIV  539

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT+++  Y K+      ++  +  K  G K    M   ++  +++    +  +   + +
Sbjct  540  TYTTLVDIYGKSGRFNDAIECLEIMKSAGLKPSPTMYNALINAYAQRGLSELALNAFRVM  599

Query  569  KTDETKLDERLYRSALNAL----RDA  634
            + D  K       S +NA     RDA
Sbjct  600  RADGLKPSLLALNSLINAFGEDRRDA  625


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 59/117 (50%), Gaps = 0/117 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E + S G +P    Y +++N Y + G+   A   F  M   G    ++A +S++N +G+ 
Sbjct  562  EIMKSAGLKPSPTMYNALINAYAQRGLSELALNAFRVMRADGLKPSLLALNSLINAFGED  621

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             R  EA  ++  MKE   +P+V  Y TL+    R     +V  V++EM   +V PDR
Sbjct  622  RRDAEAFSVLQYMKENDVKPDVVTYTTLMKALIRVDKFYKVPDVYEEMIHSRVTPDR  678


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/185 (22%), Positives = 87/185 (47%), Gaps = 3/185 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G +P    Y ++L  Y +      AE   S+ME+ G       YS +++
Sbjct  312  AEAIFEEMKEGGLQPRTRAYNALLKGYVKAASLEDAESIVSQMERSGISPDEHTYSLLID  371

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   GR + A  ++ +M+    +PN ++++ +L  +      ++  +V +EM+   V+P
Sbjct  372  AYANAGRWESARIVLKEMEASNVQPNSYVFSRILASYRDRGEWQKSFQVLREMRSSGVMP  431

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            DR  Y  +I  + K+  L+  +  ++     G + D      ++ +  K     + +EL 
Sbjct  432  DRHFYNVMIDTFGKSNCLDHAMATFERMLSEGIQPDTVTWNTLIDIHCKSGHHARAEELF  491

Query  551  KLLQD  565
            + +Q+
Sbjct  492  EEMQE  496


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/184 (20%), Positives = 85/184 (46%), Gaps = 4/184 (2%)
 Frame = +2

Query  35   EKLVSQ----GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNM  202
            E +VSQ    G  P + TY+ +++ Y   G +  A +   EME          +S ++  
Sbjct  348  ESIVSQMERSGISPDEHTYSLLIDAYANAGRWESARIVLKEMEASNVQPNSYVFSRILAS  407

Query  203  YGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  382
            Y   G  +++ +++ +M+  G  P+   YN ++D  G+++ +      ++ M    + PD
Sbjct  408  YRDRGEWQKSFQVLREMRSSGVMPDRHFYNVMIDTFGKSNCLDHAMATFERMLSEGIQPD  467

Query  383  RVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQ  562
             V++ ++I  + K+       + +++ + +G         IM+    +  + DE+  L+ 
Sbjct  468  TVTWNTLIDIHCKSGHHARAEELFEEMQESGCAPCATTFNIMINSLGEQERWDEVKGLMG  527

Query  563  DLKT  574
             +++
Sbjct  528  KMQS  531



>ref|XP_002456617.1| hypothetical protein SORBIDRAFT_03g039460 [Sorghum bicolor]
 gb|EES01737.1| hypothetical protein SORBIDRAFT_03g039460 [Sorghum bicolor]
Length=410

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 107/206 (52%), Gaps = 0/206 (0%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G EP   TY  ++  +CR G +  A + F EM  KG  + +V+Y+ ++    + G+ K+A
Sbjct  103  GVEPNLYTYNCLVGEWCRTGEFKSARLLFDEMPLKGVVRNVVSYNILIAGLCRHGKLKDA  162

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
             +L   M+  G  P++  +N L+D +G+A  M      + +MK   + P  V+Y  +I  
Sbjct  163  AQLFEAMRREGIHPSMVTFNLLIDGYGKAGKMSNALHFFNQMKAAGLQPSVVTYNELIGG  222

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
            + +A+++   ++ + D K       +    I++G F+K N++D   ++L +++    ++D
Sbjct  223  FCRARDIAHAIRAFSDMKERRLAPTKVTYTILIGAFAKENEMDRAFEMLSEMEKAGLEVD  282

Query  593  ERLYRSALNALRDAGLEIRAKWLQES  670
             + Y   L+AL   G  + A+ L +S
Sbjct  283  VQSYGVLLHALCMEGKMMHARKLFQS  308


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/195 (25%), Positives = 95/195 (49%), Gaps = 0/195 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++  +G     V+Y  ++   CR G    A   F  M ++G    +V ++ +++
Sbjct  127  ARLLFDEMPLKGVVRNVVSYNILIAGLCRHGKLKDAAQLFEAMRREGIHPSMVTFNLLID  186

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YGK G+   A     +MK  G +P+V  YN L+    RA ++    + + +MK R++ P
Sbjct  187  GYGKAGKMSNALHFFNQMKAAGLQPSVVTYNELIGGFCRARDIAHAIRAFSDMKERRLAP  246

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
             +V+YT +I A++K  E++   +   + +  G + D    G+++       K+    KL 
Sbjct  247  TKVTYTILIGAFAKENEMDRAFEMLSEMEKAGLEVDVQSYGVLLHALCMEGKMMHARKLF  306

Query  560  QDLKTDETKLDERLY  604
            Q + +   K +  LY
Sbjct  307  QSMDSKGVKPNNVLY  321


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 87/201 (43%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   + ++ + G +P  VTY  ++  +CR    + A   FS+M+++      V Y+ ++ 
Sbjct  197  ALHFFNQMKAAGLQPSVVTYNELIGGFCRARDIAHAIRAFSDMKERRLAPTKVTYTILIG  256

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K      A  ++++M++ G E +V  Y  LL        M    K+++ M  + V P
Sbjct  257  AFAKENEMDRAFEMLSEMEKAGLEVDVQSYGVLLHALCMEGKMMHARKLFQSMDSKGVKP  316

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + V Y  +I  Y +       ++   + + +G   + A   + + +     K  E   L+
Sbjct  317  NNVLYDMMIYGYGREGSSYKALRLIMEMRKSGLIPNVASYCLTIRLLCNEGKCQEAEALI  376

Query  560  QDLKTDETKLDERLYRSALNA  622
             D++    +  E + R   +A
Sbjct  377  GDMEDAGLQTSESICRVLFDA  397


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/187 (22%), Positives = 79/187 (42%), Gaps = 3/187 (2%)
 Frame = +2

Query  101  CRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNV  280
            C+ G  ++A   F  M + G     V Y+++++ Y   G+ +    LV +M+  G EPN+
Sbjct  49   CQSGDVAEARRVFDVMPRLGVTPNEVTYTALIHGYFVRGQREMGFALVGEMRRGGVEPNL  108

Query  281  WIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQD  460
            + YN L+    R    K    ++ EM  + VV + VSY  +I+   +  +L+   + ++ 
Sbjct  109  YTYNCLVGEWCRTGEFKSARLLFDEMPLKGVVRNVVSYNILIAGLCRHGKLKDAAQLFEA  168

Query  461  FKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL---RD  631
             +  G         +++  + K  K+   +     +K    +     Y   +      RD
Sbjct  169  MRREGIHPSMVTFNLLIDGYGKAGKMSNALHFFNQMKAAGLQPSVVTYNELIGGFCRARD  228

Query  632  AGLEIRA  652
                IRA
Sbjct  229  IAHAIRA  235



>emb|CAN70089.1| hypothetical protein VITISV_038171 [Vitis vinifera]
Length=838

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 114/219 (52%), Gaps = 0/219 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ SQ C+P   T+ +++N + R G+  KAE  F ++++ G +  + AY++++
Sbjct  221  MALKVFHEMRSQKCKPNICTFTALVNAFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALM  280

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN ++D +GRA   +  + V++ MKR  + 
Sbjct  281  EAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNIMVDAYGRAGLHEDAQAVFEVMKRLGIT  340

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYS+A ++  C +       +G K D  +   M+ ++ ++ + +++ ++
Sbjct  341  PTMKSHMLLLSAYSRAGKVAKCEEIVNQMHKSGIKPDTFVLNSMLNLYGRLGQFEKMEEV  400

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            L  ++      D   Y   +N    AG   R + L  S 
Sbjct  401  LTAMEKGPYPADISTYNILINIYGRAGFFARMEELFRSL  439


 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 110/219 (50%), Gaps = 6/219 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A + Y +L+   C P + TYA +L  YC  G+  KAE  F+EM + GF    V Y++ ++
Sbjct  117  AESTYLELLEARCVPTEDTYALLLKAYCTSGLLEKAEAVFAEMRKYGFPPSAVVYNAYID  176

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K G  ++A  +  +MK   C+P+   Y  L++++G+AS      KV+ EM+ +K  P
Sbjct  177  GLMKGGDTQKAVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKP  236

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELV  550
            +  ++T++++A+++    E   + ++  +  G + D      ++  +S+        E+ 
Sbjct  237  NICTFTALVNAFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIF  296

Query  551  KLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
             L+Q +  +    D   Y   ++A   AGL   A+ + E
Sbjct  297  SLMQHMGCEP---DRASYNIMVDAYGRAGLHEDAQAVFE  332


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 89/161 (55%), Gaps = 2/161 (1%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E +   G  P   ++  +L+ Y R G  +K E   ++M + G        +SM+N
Sbjct  327  AQAVFEVMKRLGITPTMKSHMLLLSAYSRAGKVAKCEEIVNQMHKSGIKPDTFVLNSMLN  386

Query  200  MYGKTGRHKEATRLVAKMKERGCEP-NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +YG+ G+ ++   ++  M E+G  P ++  YN L++I+GRA    ++E++++ +  R ++
Sbjct  387  LYGRLGQFEKMEEVLTAM-EKGPYPADISTYNILINIYGRAGFFARMEELFRSLPARNLI  445

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMA  499
            PD V++TS I AYS+ K+   C++ +++    G   D   A
Sbjct  446  PDVVTWTSRIGAYSRRKQYNRCLEVFEEMIDAGCYPDGGTA  486


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 94/200 (47%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++    C+P   TY  ++N+Y +      A   F EM  +     I  ++++VN
Sbjct  187  AVEIFERMKRDRCQPSTATYTMLINLYGKASKSYMALKVFHEMRSQKCKPNICTFTALVN  246

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +++E G EP+V+ YN L++ + RA       +++  M+     P
Sbjct  247  AFAREGLCEKAEEIFEQLQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMGCEP  306

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY +A   E     ++  K  G         +++  +S+  KV +  +++
Sbjct  307  DRASYNIMVDAYGRAGLHEDAQAVFEVMKRLGITPTMKSHMLLLSAYSRAGKVAKCEEIV  366

Query  560  QDLKTDETKLDERLYRSALN  619
              +     K D  +  S LN
Sbjct  367  NQMHKSGIKPDTFVLNSMLN  386


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/172 (20%), Positives = 82/172 (48%), Gaps = 0/172 (0%)
 Frame = +2

Query  152  QKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK  331
            +  F   ++ Y+ +++ YG+   +K+A     ++ E  C P    Y  LL  +  +  ++
Sbjct  91   RSSFHPDVICYNLLIDAYGQKSLYKKAESTYLELLEARCVPTEDTYALLLKAYCTSGLLE  150

Query  332  QVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMV  511
            + E V+ EM++    P  V Y + I    K  + +  V+ ++  K +  +   A   +++
Sbjct  151  KAEAVFAEMRKYGFPPSAVVYNAYIDGLMKGGDTQKAVEIFERMKRDRCQPSTATYTMLI  210

Query  512  GVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQE  667
             ++ K +K    +K+  ++++ + K +   + + +NA    GL  +A+ + E
Sbjct  211  NLYGKASKSYMALKVFHEMRSQKCKPNICTFTALVNAFAREGLCEKAEEIFE  262



>ref|XP_010227899.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227900.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227901.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227902.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227903.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
 ref|XP_010227904.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, 
chloroplastic [Brachypodium distachyon]
Length=1449

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 104/202 (51%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +LV +G +P  VTY S+L  + + G     E    E+ + GF K  + Y++M++
Sbjct  353  AERMFRELVEKGFKPDAVTYNSLLYAFAKEGDADTVERVCEELVRAGFKKDGITYNTMIH  412

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGK GR   A  L  +M+  GC P+   Y  L+D  G+   +    KV +EM    + P
Sbjct  413  MYGKMGRLDLALGLYDEMRALGCTPDAVTYTVLIDSLGKMDRISDAGKVLEEMADAGLKP  472

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+++++I AY+K    E  V+ +     +G K DR    +M+ + ++   + +L+ L 
Sbjct  473  TLVTFSALICAYAKGGRREEAVRTFSHMVASGVKPDRLAYLVMLDIIARSGDMRKLMALY  532

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +  D  + D  LY+  L AL
Sbjct  533  QTMMNDGYRPDNALYQVMLAAL  554


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 97/207 (47%), Gaps = 4/207 (2%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  +Y+++ + GC P  VTY  +++   ++   S A     EM   G    +V +S+++
Sbjct  422  LALGLYDEMRALGCTPDAVTYTVLIDSLGKMDRISDAGKVLEEMADAGLKPTLVTFSALI  481

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y K GR +EA R  + M   G +P+   Y  +LDI  R+ +M+++  +++ M      
Sbjct  482  CAYAKGGRREEAVRTFSHMVASGVKPDRLAYLVMLDIIARSGDMRKLMALYQTMMNDGYR  541

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            PD   Y  +++A +K  E +      QD ++      + ++ I++    K   + +  KL
Sbjct  542  PDNALYQVMLAALAKGNEYDEIEAVVQDMEVVCQMNPQLVSSILI----KAECISQGAKL  597

Query  557  LQDLKTDETKLDERLYRSALNALRDAG  637
            L+       + D +   S L+A    G
Sbjct  598  LKKACLQGHEPDSKSLLSILDAYETTG  624


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/194 (21%), Positives = 94/194 (48%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEM--TFSEMEQKGFDKCIVAYSSMVNMYGKTGRH  223
            Q  EP  V++ +++N   + G  +         E+ Q G    ++ Y+++++   +    
Sbjct  256  QELEPDLVSFNTLINARAKSGCLAPGSAFDLLLEVRQVGLRPDVITYNTLISACSQGSNL  315

Query  224  KEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSV  403
             +A  +  +M    C P++W YN ++ +HGR    +  E++++E+  +   PD V+Y S+
Sbjct  316  DDAVAVFEEMMASECRPDLWTYNAMVSVHGRCGKAQDAERMFRELVEKGFKPDAVTYNSL  375

Query  404  ISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDET  583
            + A++K  + ++  +  ++    G K D      M+ ++ KM ++D  + L  +++    
Sbjct  376  LYAFAKEGDADTVERVCEELVRAGFKKDGITYNTMIHMYGKMGRLDLALGLYDEMRALGC  435

Query  584  KLDERLYRSALNAL  625
              D   Y   +++L
Sbjct  436  TPDAVTYTVLIDSL  449


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 90/183 (49%), Gaps = 0/183 (0%)
 Frame = +2

Query  29    VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
             +Y  +   G  P    Y S++++ CR   Y   E+   EME+ GF+  +   ++++ MY 
Sbjct  880   IYNGMKEAGYLPNMHIYRSMISLLCRNKRYRDVELMVVEMERAGFEPDLTILNTLLLMYT  939

Query  209   KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
               G   +   +   + E G EPN   YNTL+ ++ R    ++   +  EM ++ + P   
Sbjct  940   GNGNFDKTVEVYHSILEAGLEPNEDTYNTLIVMYSRNLRPEEGFTLLNEMGKKGLTPKLE  999

Query  389   SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
             SY S+++A  KAK  E   + +++ +  G + +R++  +++ ++       +  +LL  +
Sbjct  1000  SYKSLLAASGKAKLWEQAEQLFEEIRSKGYRLNRSLYHMLMKIYRDACNHSKAEQLLASM  1059

Query  569   KTD  577
             K D
Sbjct  1060  KED  1062


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 87/172 (51%), Gaps = 0/172 (0%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G  P  +TY ++++   +      A   F EM        +  Y++MV+++G+ G+ ++A
Sbjct  294  GLRPDVITYNTLISACSQGSNLDDAVAVFEEMMASECRPDLWTYNAMVSVHGRCGKAQDA  353

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
             R+  ++ E+G +P+   YN+LL    +  +   VE+V +E+ R     D ++Y ++I  
Sbjct  354  ERMFRELVEKGFKPDAVTYNSLLYAFAKEGDADTVERVCEELVRAGFKKDGITYNTMIHM  413

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            Y K   L+  +  Y + +  G   D     +++    KM+++ +  K+L+++
Sbjct  414  YGKMGRLDLALGLYDEMRALGCTPDAVTYTVLIDSLGKMDRISDAGKVLEEM  465


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 89/197 (45%), Gaps = 0/197 (0%)
 Frame = +2

Query  11    PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
             P    T+  ++  +G  P   +Y S+L    +  ++ +AE  F E+  KG+      Y  
Sbjct  979   PEEGFTLLNEMGKKGLTPKLESYKSLLAASGKAKLWEQAEQLFEEIRSKGYRLNRSLYHM  1038

Query  191   MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
             ++ +Y     H +A +L+A MKE G EP +   + L+  +G A +  + EKV   +K   
Sbjct  1039  LMKIYRDACNHSKAEQLLASMKEDGIEPTIATMHILMTSYGTAGHPDEAEKVLNSLKSSS  1098

Query  371   VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
             +    + Y++V +AY K  +    +    + K +G K D  +    +   S   +  + +
Sbjct  1099  LEVSTLPYSTVFNAYLKNGDYNLGITKLLEMKADGVKPDHQVWTCFIRAASLCERTADAI  1158

Query  551   KLLQDLKTDETKLDERL  601
              LL  L+  E  L  RL
Sbjct  1159  LLLNSLRDCEFDLPIRL  1175


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 98/211 (46%), Gaps = 5/211 (2%)
 Frame = +2

Query  14   RVAATVYEKLVSQGC-EPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            R A   +E LV+ G   PG    A +L +  R    + AE  F     +G    +  +++
Sbjct  175  RRALDAFEWLVASGAGAPGPRVVAVVLGVLGRARQDALAESVFLRFAGEG--ATVQVFNA  232

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMK--QVEKVWKEMKR  364
            M+ +Y ++GR  +  +L+  M+ +  EP++  +NTL++   ++  +       +  E+++
Sbjct  233  MMGVYARSGRFDDVRQLLDAMRGQELEPDLVSFNTLINARAKSGCLAPGSAFDLLLEVRQ  292

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
              + PD ++Y ++ISA S+   L+  V  +++   +  + D      MV V  +  K  +
Sbjct  293  VGLRPDVITYNTLISACSQGSNLDDAVAVFEEMMASECRPDLWTYNAMVSVHGRCGKAQD  352

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAG  637
              ++ ++L     K D   Y S L A    G
Sbjct  353  AERMFRELVEKGFKPDAVTYNSLLYAFAKEG  383


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 91/205 (44%), Gaps = 6/205 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYS-SMV  196
            A+ V+  +   G EP +  Y S+++ YC++G    A     E  Q G    I++   +M+
Sbjct  702  ASQVFSDMQFIGIEPSRKIYESMISAYCKLGFPETAHQLMDEAVQSGISLNILSSRVTMI  761

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNV--WIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
              YGK    + A   V  +K+   EP++   I+N L+  +  +   +    V+  M  + 
Sbjct  762  EAYGKIKLWQHAENFVKGLKQ---EPSIDRRIWNALIHAYAESGLYEHARAVFDIMIEKG  818

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
             +P   S   ++ A      L+      Q+ +  G K  ++   +M+  F+K   + E++
Sbjct  819  PLPTIDSVNGMMRALIIDGRLDELYVIVQELQDMGFKISKSTVILMLDAFTKAGDIFEVM  878

Query  551  KLLQDLKTDETKLDERLYRSALNAL  625
            K+   +K      +  +YRS ++ L
Sbjct  879  KIYNGMKEAGYLPNMHIYRSMISLL  903


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/214 (19%), Positives = 97/214 (45%), Gaps = 0/214 (0%)
 Frame = +2

Query  29    VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
             + ++L   G +  + T   +L+ + + G   +    ++ M++ G+   +  Y SM+++  
Sbjct  845   IVQELQDMGFKISKSTVILMLDAFTKAGDIFEVMKIYNGMKEAGYLPNMHIYRSMISLLC  904

Query  209   KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
             +  R+++   +V +M+  G EP++ I NTLL ++    N  +  +V+  +    + P+  
Sbjct  905   RNKRYRDVELMVVEMERAGFEPDLTILNTLLLMYTGNGNFDKTVEVYHSILEAGLEPNED  964

Query  389   SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
             +Y ++I  YS+    E       +    G          ++    K    ++  +L +++
Sbjct  965   TYNTLIVMYSRNLRPEEGFTLLNEMGKKGLTPKLESYKSLLAASGKAKLWEQAEQLFEEI  1024

Query  569   KTDETKLDERLYRSALNALRDAGLEIRAKWLQES  670
             ++   +L+  LY   +   RDA    +A+ L  S
Sbjct  1025  RSKGYRLNRSLYHMLMKIYRDACNHSKAEQLLAS  1058



>gb|ACU25760.1| pentatricopeptide repeat-containing protein [Phyla dulcis]
Length=426

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 117/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++ + G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  96   REARSLISEMKTAGVIPNTTSYSTLLTMYVENKKFLEALSVFSEMREI---KCLLDLTTC  152

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  153  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  212

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  213  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  272

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  273  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  311


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  133  ALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  192

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  193  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  252

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  253  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  312

Query  560  QDLK  571
             +LK
Sbjct  313  HELK  316


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/197 (21%), Positives = 94/197 (48%), Gaps = 0/197 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +
Sbjct  3    RALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDQVPGDLVLYSNLIELSRKLCDYSK  62

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + +++K  G  P++  YN ++ + G+A   ++   +  EMK   V+P+  SY+++++
Sbjct  63   AISIFSRLKNSGYTPDLVAYNAMIIVFGKAKLFREARSLISEMKTAGVIPNTTSYSTLLT  122

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + 
Sbjct  123  MYVENKKFLEALSVFSEMREIKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEP  182

Query  590  DERLYRSALNALRDAGL  640
            +   Y + L    DA L
Sbjct  183  NVVSYNTLLRVYGDAEL  199


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 92/201 (46%), Gaps = 4/201 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  203  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  262

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  263  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  318

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  319  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIHLLSKYKKYANVVEVF  378

Query  560  QDLKTDETKLDERLYRSALNA  622
              ++      D  +    LNA
Sbjct  379  DKMRGLGYFPDSNVIAIVLNA  399


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/180 (21%), Positives = 78/180 (43%), Gaps = 31/180 (17%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS-------EMEQKGFDKCIV  178
            A  + +++ S+G EP  +TY++I++I+ ++G   +A M F        E++Q  F   IV
Sbjct  238  ANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIV  297

Query  179  AY------------------------SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            AY                         + +++    GR +EAT +  +  + G   ++ +
Sbjct  298  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  357

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFK  466
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y + +
Sbjct  358  FERMIHLLSKYKKYANVVEVFDKMRGLGYFPDSNVIAIVLNAYGKLHEFDKANDVYMEMQ  417



>gb|KHN33805.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=489

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 104/202 (51%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A   +E+++S+G  P  VT+ ++++ +C+ G +  AE  FSEM+Q+G+  CI  Y+ M+N
Sbjct  244  AMATFERMLSEGIPPDIVTWNTLIDCHCKSGRHDMAEELFSEMQQRGYSPCITTYNIMIN  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
              G+  R ++ T  ++KM+ +G +PN   Y TL+D++G++       +  + +K     P
Sbjct  304  SMGEQQRWEQVTAFLSKMQSQGLQPNSITYTTLVDVYGKSGRFSDAIECLEVLKSTGFKP  363

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
                Y ++I+AY++    E  V  ++     G          ++  F +  +  E   +L
Sbjct  364  TSTMYNALINAYAQRGLSELAVNAFRLMTTEGLTPSLLALNSLINAFGEDRRDAEAFAVL  423

Query  560  QDLKTDETKLDERLYRSALNAL  625
            Q +K +  + D   Y + + AL
Sbjct  424  QYMKENNIEPDVVTYTTLMKAL  445


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/217 (25%), Positives = 104/217 (48%), Gaps = 6/217 (3%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            V + + S G +P +  Y  +++ + +      A  TF  M  +G    IV ++++++ + 
Sbjct  212  VLKDMKSSGVQPDRHFYNVMIDTFGKYNCLDHAMATFERMLSEGIPPDIVTWNTLIDCHC  271

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
            K+GRH  A  L ++M++RG  P +  YN +++  G     +QV     +M+ + + P+ +
Sbjct  272  KSGRHDMAEELFSEMQQRGYSPCITTYNIMINSMGEQQRWEQVTAFLSKMQSQGLQPNSI  331

Query  389  SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
            +YT+++  Y K+      ++  +  K  G K    M   ++  +++   + EL      L
Sbjct  332  TYTTLVDVYGKSGRFSDAIECLEVLKSTGFKPTSTMYNALINAYAQ-RGLSELAVNAFRL  390

Query  569  KTDETKLDERLYRSALNALRDAGLEIRAKWLQESFAV  679
             T E      L   ALN+L +A  E R     E+FAV
Sbjct  391  MTTEGLTPSLL---ALNSLINAFGEDRRD--AEAFAV  422


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 89/182 (49%), Gaps = 0/182 (0%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            S G  P   T  +++      G   +AE  F E+ + G +    AY++++  Y +TG  K
Sbjct  78   SNGLNPKPSTLVAVILALGNSGRTHEAEALFEEIRENGLEPRTRAYNALLKGYVRTGSLK  137

Query  227  EATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVI  406
            +A  +V++M++ G +P+   Y+ L+D++  A   +    V KEM+   V P+   ++ ++
Sbjct  138  DAEFVVSEMEKAGVKPDEQTYSLLIDVYAHAGRWESARIVLKEMEASNVQPNSYVFSRIL  197

Query  407  SAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETK  586
            + Y    E +   +  +D K +G + DR    +M+  F K N +D  +   + + ++   
Sbjct  198  ANYRDKGEWQKSFQVLKDMKSSGVQPDRHFYNVMIDTFGKYNCLDHAMATFERMLSEGIP  257

Query  587  LD  592
             D
Sbjct  258  PD  259


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 74/151 (49%), Gaps = 0/151 (0%)
 Frame = +2

Query  38   KLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTG  217
            K+ SQG +P  +TY +++++Y + G +S A      ++  GF      Y++++N Y + G
Sbjct  320  KMQSQGLQPNSITYTTLVDVYGKSGRFSDAIECLEVLKSTGFKPTSTMYNALINAYAQRG  379

Query  218  RHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYT  397
              + A      M   G  P++   N+L++  G      +   V + MK   + PD V+YT
Sbjct  380  LSELAVNAFRLMTTEGLTPSLLALNSLINAFGEDRRDAEAFAVLQYMKENNIEPDVVTYT  439

Query  398  SVISAYSKAKELESCVKYYQDFKLNGGKTDR  490
            +++ A  + ++ +     Y++   +G   DR
Sbjct  440  TLMKALIRVEKFQKVPAVYEEMVASGCTPDR  470


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/184 (24%), Positives = 84/184 (46%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E++   G EP    Y ++L  Y R G    AE   SEME+ G       YS +++
Sbjct  104  AEALFEEIRENGLEPRTRAYNALLKGYVRTGSLKDAEFVVSEMEKAGVKPDEQTYSLLID  163

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +Y   GR + A  ++ +M+    +PN ++++ +L  +      ++  +V K+MK   V P
Sbjct  164  VYAHAGRWESARIVLKEMEASNVQPNSYVFSRILANYRDKGEWQKSFQVLKDMKSSGVQP  223

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR  Y  +I  + K   L+  +  ++     G   D      ++    K  + D   +L 
Sbjct  224  DRHFYNVMIDTFGKYNCLDHAMATFERMLSEGIPPDIVTWNTLIDCHCKSGRHDMAEELF  283

Query  560  QDLK  571
             +++
Sbjct  284  SEMQ  287


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 92/207 (44%), Gaps = 0/207 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V +++ +   +P    ++ IL  Y   G + K+     +M+  G       Y+ M++
Sbjct  174  ARIVLKEMEASNVQPNSYVFSRILANYRDKGEWQKSFQVLKDMKSSGVQPDRHFYNVMID  233

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             +GK      A     +M   G  P++  +NTL+D H ++      E+++ EM++R   P
Sbjct  234  TFGKYNCLDHAMATFERMLSEGIPPDIVTWNTLIDCHCKSGRHDMAEELFSEMQQRGYSP  293

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
               +Y  +I++  + +  E    +    +  G + +      +V V+ K  +  + ++ L
Sbjct  294  CITTYNIMINSMGEQQRWEQVTAFLSKMQSQGLQPNSITYTTLVDVYGKSGRFSDAIECL  353

Query  560  QDLKTDETKLDERLYRSALNALRDAGL  640
            + LK+   K    +Y + +NA    GL
Sbjct  354  EVLKSTGFKPTSTMYNALINAYAQRGL  380


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 59/117 (50%), Gaps = 0/117 (0%)
 Frame = +2

Query  35   EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKT  214
            E L S G +P    Y +++N Y + G+   A   F  M  +G    ++A +S++N +G+ 
Sbjct  354  EVLKSTGFKPTSTMYNALINAYAQRGLSELAVNAFRLMTTEGLTPSLLALNSLINAFGED  413

Query  215  GRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             R  EA  ++  MKE   EP+V  Y TL+    R    ++V  V++EM      PDR
Sbjct  414  RRDAEAFAVLQYMKENNIEPDVVTYTTLMKALIRVEKFQKVPAVYEEMVASGCTPDR  470


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/206 (17%), Positives = 91/206 (44%), Gaps = 0/206 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V  ++   G +P + TY+ ++++Y   G +  A +   EME          +S ++ 
Sbjct  139  AEFVVSEMEKAGVKPDEQTYSLLIDVYAHAGRWESARIVLKEMEASNVQPNSYVFSRILA  198

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y   G  +++ +++  MK  G +P+   YN ++D  G+ + +      ++ M    + P
Sbjct  199  NYRDKGEWQKSFQVLKDMKSSGVQPDRHFYNVMIDTFGKYNCLDHAMATFERMLSEGIPP  258

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++ ++I  + K+   +   + + + +  G         IM+    +  + +++   L
Sbjct  259  DIVTWNTLIDCHCKSGRHDMAEELFSEMQQRGYSPCITTYNIMINSMGEQQRWEQVTAFL  318

Query  560  QDLKTDETKLDERLYRSALNALRDAG  637
              +++   + +   Y + ++    +G
Sbjct  319  SKMQSQGLQPNSITYTTLVDVYGKSG  344



>ref|XP_007154040.1| hypothetical protein PHAVU_003G086100g [Phaseolus vulgaris]
 gb|ESW26034.1| hypothetical protein PHAVU_003G086100g [Phaseolus vulgaris]
Length=704

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 105/202 (52%), Gaps = 0/202 (0%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
            P  A   +EK+ S GCEP +VTY+ +++ Y R G    A   +     + +    V +S+
Sbjct  232  PHKAVEWFEKMSSFGCEPDEVTYSVMIDAYGRAGNIDMALRLYDRARTESWRLDTVTFST  291

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            ++ MYG  G +     +  +MK  G +PN+ IYNTLLD  GRA    Q + ++ EM    
Sbjct  292  LIKMYGLAGNYDGCLNVYQEMKVLGVKPNMVIYNTLLDAMGRAKRPWQAKSIFMEMMNNG  351

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
            + P+ V+Y S++ AY + +  E  +  Y++ +  G + +  +   ++ + + +   D+  
Sbjct  352  LSPNWVTYASLLRAYGRGRYSEDALFVYKEMREKGMEMNTHLYNTLLAMCADLGLADDAF  411

Query  551  KLLQDLKTDETKLDERLYRSAL  616
            K+ +D+K+  T L +    S+L
Sbjct  412  KIFEDMKSSATCLCDSWTFSSL  433


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 63/133 (47%), Gaps = 0/133 (0%)
 Frame = +2

Query  128  EMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDI  307
            E  F EM Q+G     V +S++++         +A     KM   GCEP+   Y+ ++D 
Sbjct  201  EKIFDEMLQRGVRPDNVTFSTIISCARICLLPHKAVEWFEKMSSFGCEPDEVTYSVMIDA  260

Query  308  HGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTD  487
            +GRA N+    +++   +      D V+++++I  Y  A   + C+  YQ+ K+ G K +
Sbjct  261  YGRAGNIDMALRLYDRARTESWRLDTVTFSTLIKMYGLAGNYDGCLNVYQEMKVLGVKPN  320

Query  488  RAMAGIMVGVFSK  526
              +   ++    +
Sbjct  321  MVIYNTLLDAMGR  333


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 72/161 (45%), Gaps = 38/161 (24%)
 Frame = +2

Query  11   PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSK-AEMTFSEMEQKGFD-------  166
            P  A +++ ++++ G  P  VTYAS+L  Y R G YS+ A   + EM +KG +       
Sbjct  337  PWQAKSIFMEMMNNGLSPNWVTYASLLRAYGR-GRYSEDALFVYKEMREKGMEMNTHLYN  395

Query  167  --------------------------KCIV---AYSSMVNMYGKTGRHKEATRLVAKMKE  259
                                       C+     +SS++ +Y  +G   +A R++ +M E
Sbjct  396  TLLAMCADLGLADDAFKIFEDMKSSATCLCDSWTFSSLITIYSCSGNVSDAERMLNEMIE  455

Query  260  RGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPD  382
             G EP +++  +L+  +G+A     V K + ++    + PD
Sbjct  456  SGFEPTIFVLTSLVQCYGKAGRTDDVVKTFDQLLDLGISPD  496


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 48/97 (49%), Gaps = 1/97 (1%)
 Frame = +2

Query  20   AATVYEKLVSQG-CEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            A  ++E + S   C     T++S++ IY   G  S AE   +EM + GF+  I   +S+V
Sbjct  410  AFKIFEDMKSSATCLCDSWTFSSLITIYSCSGNVSDAERMLNEMIESGFEPTIFVLTSLV  469

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDI  307
              YGK GR  +  +   ++ + G  P+      LL++
Sbjct  470  QCYGKAGRTDDVVKTFDQLLDLGISPDDRFCGCLLNV  506


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 57/118 (48%), Gaps = 0/118 (0%)
 Frame = +2

Query  284  IYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDF  463
            +YN  L +  +  ++  +EK++ EM +R V PD V+++++IS           V++++  
Sbjct  183  LYNVTLKVFRKGRDLDAMEKIFDEMLQRGVRPDNVTFSTIISCARICLLPHKAVEWFEKM  242

Query  464  KLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAG  637
               G + D     +M+  + +   +D  ++L    +T+  +LD   + + +     AG
Sbjct  243  SSFGCEPDEVTYSVMIDAYGRAGNIDMALRLYDRARTESWRLDTVTFSTLIKMYGLAG  300



>gb|AFV61110.1| pentatricopeptide repeat-containing protein 123, partial [Acantholippia 
seriphioides]
Length=416

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 116/219 (53%), Gaps = 6/219 (3%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS-  190
            R A ++  ++   G  P   +Y+++L +Y     + +A   FSEM +    KC++  ++ 
Sbjct  98   REARSLISEMKXSGVMPNTASYSTLLTMYVENKKFLEALSVFSEMREV---KCLLDLTTC  154

Query  191  --MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKR  364
              M+++YG+ G  KEA +L   M++ G EPNV  YNTLL ++G A    +   +++ M+R
Sbjct  155  NIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLRVYGDAELFGEAIHLFRLMQR  214

Query  365  RKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
            + +  + V+Y S+I  Y K  E E      Q+ +  G + +      ++ ++ K+ K+D 
Sbjct  215  KNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDR  274

Query  545  LVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
               L Q L++   ++D+ L+++ + A   AGL   AK L
Sbjct  275  AAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRL  313


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 98/184 (53%), Gaps = 0/184 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+ ++    C     T   ++++Y ++G+  +A+  F  M + G +  +V+Y++++ 
Sbjct  135  ALSVFSEMREVKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEPNVVSYNTLLR  194

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG      EA  L   M+ +  E NV  YN+++ I+G+    ++   + +EM+ R + P
Sbjct  195  VYGDAELFGEAIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEP  254

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            + ++Y+++IS + K  +L+     +Q  + +G + D+ +   M+  + +   V    +LL
Sbjct  255  NSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLL  314

Query  560  QDLK  571
             +LK
Sbjct  315  HELK  318


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/197 (21%), Positives = 95/197 (48%), Gaps = 0/197 (0%)
 Frame = +2

Query  50   QGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            +   P + TY++++  + + G++  A     +MEQ      +V YS+++ +  K   + +
Sbjct  5    RALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLCDYSK  64

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
            A  + +++K  G  P++  YN ++++ G+A   ++   +  EMK   V+P+  SY+++++
Sbjct  65   AISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMKXSGVMPNTASYSTLLT  124

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
             Y + K+    +  + + +      D     IM+ V+ ++    E  KL   ++    + 
Sbjct  125  MYVENKKFLEALSVFSEMREVKCLLDLTTCNIMIDVYGQLGMAKEADKLFWGMRKMGIEP  184

Query  590  DERLYRSALNALRDAGL  640
            +   Y + L    DA L
Sbjct  185  NVVSYNTLLRVYGDAEL  201


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 87/184 (47%), Gaps = 4/184 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  +  +  E   VTY S++ IY +   + KA     EM+ +G +   + YS++++
Sbjct  205  AIHLFRLMQRKNIEQNVVTYNSMIMIYGKTLEHEKANNLIQEMQSRGIEPNSITYSTIIS  264

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            ++GK G+   A  L  K++  G E +  ++ T++  + RA  +   +++  E+KR    P
Sbjct  265  IWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIVAYERAGLVAHAKRLLHELKR----P  320

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D +   + I   + A  +E     ++     G   D  +   M+ + SK  K   +V++ 
Sbjct  321  DNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITVFERMIHLLSKYKKYANVVEVF  380

Query  560  QDLK  571
              ++
Sbjct  381  DKMR  384


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/150 (20%), Positives = 70/150 (47%), Gaps = 0/150 (0%)
 Frame = +2

Query  143  EMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRAS  322
            EM Q+        YS+++  +GK G    A   + KM++     ++ +Y+ L+++  +  
Sbjct  1    EMRQRALSPDRYTYSTLITHFGKEGLFDAALSWLQKMEQDRVPGDLVLYSNLIELSRKLC  60

Query  323  NMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAG  502
            +  +   ++  +KR    PD V+Y ++I+ + KAK          + K +G   + A   
Sbjct  61   DYSKAISIFSRLKRSGFTPDLVAYNAMINVFGKAKLFREARSLISEMKXSGVMPNTASYS  120

Query  503  IMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
             ++ ++ +  K  E + +  +++  +  LD
Sbjct  121  TLLTMYVENKKFLEALSVFSEMREVKCLLD  150


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 76/176 (43%), Gaps = 31/176 (18%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFS-------EMEQKGFDKCIV  178
            A  + +++ S+G EP  +TY++I++I+ ++G   +A M F        E++Q  F   IV
Sbjct  240  ANNLIQEMQSRGIEPNSITYSTIISIWGKVGKLDRAAMLFQKLRSSGVEIDQILFQTMIV  299

Query  179  AY------------------------SSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWI  286
            AY                         + +++    GR +EAT +  +  + G   ++ +
Sbjct  300  AYERAGLVAHAKRLLHELKRPDNIPRDTAIHILAGAGRIEEATYVFRQAIDAGEVKDITV  359

Query  287  YNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
            +  ++ +  +      V +V+ +M+     PD      V++AY K  E +     Y
Sbjct  360  FERMIHLLSKYKKYANVVEVFDKMRGLGYFPDSDVIALVLNAYGKLHEFDKANDVY  415



>gb|KJB61767.1| hypothetical protein B456_009G379200 [Gossypium raimondii]
Length=614

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 121/257 (47%), Gaps = 38/257 (15%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A    + ++ QG EP  VTY ++++ +C+ G+ S+AE     M ++G +  IV Y+++V+
Sbjct  264  AVETVDMMIMQGIEPDVVTYNTLVDAHCKEGMVSEAEDIIDAMIKRGIEPDIVTYNTLVD  323

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G   EA  +V  M +RG EPNV  Y+ L++ H   + M +  +V+  M  +   P
Sbjct  324  AHCKEGMVSEAEDIVDAMMKRGIEPNVVTYSALINGHCLQNEMHKARRVFNLMIEKGCAP  383

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNG------------------GKT-------  484
            D V+Y+++I+ Y K K L+  ++ + +  L G                  GK        
Sbjct  384  DIVTYSTMINGYCKGKRLDKAMELFHEISLKGPIPDTVTCSTLMQSMFQLGKVSTACELF  443

Query  485  ----------DRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDA  634
                      DR    I++    K   ++E +KL Q ++    +LD   Y   ++ L  A
Sbjct  444  RKMLASGQVPDRVTCLILLDGLCKTGHIEEALKLFQAMRNSGLELDTVPYTILIDGLCKA  503

Query  635  GLEIRAKWLQESFAVAT  685
            G   R ++ +E F + +
Sbjct  504  G---RIEFAKELFCLLS  517


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/199 (24%), Positives = 95/199 (48%), Gaps = 0/199 (0%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMY  205
            +V  K++  G EP  V +++++N  C     S+A   F EM +KG+   ++ Y++++   
Sbjct  91   SVLGKMLKLGVEPDVVIFSTLINGLCNQSKISEAVFMFDEMTEKGYQPNLIVYNTVLKGL  150

Query  206  GKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             KTG    A R +  M+ RG EPN+  YNT+LD   +   +K+   ++ E+K + + P+ 
Sbjct  151  CKTGNTDRAVRFLRLMESRGFEPNIVAYNTILDCLCKNRLLKEALDLFSEVKVKGIRPNI  210

Query  386  VSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQD  565
            ++YT +I       + E   +   +   N    +     I++    K   + + V+ +  
Sbjct  211  ITYTCLIHGMCNLGQQEEATRLLNEMVDNNISINIDTYNILIAALCKEGTISKAVETVDM  270

Query  566  LKTDETKLDERLYRSALNA  622
            +     + D   Y + ++A
Sbjct  271  MIMQGIEPDVVTYNTLVDA  289


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 84/165 (51%), Gaps = 0/165 (0%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKM  253
            TY  ++   C+ G  SKA  T   M  +G +  +V Y+++V+ + K G   EA  ++  M
Sbjct  247  TYNILIAALCKEGTISKAVETVDMMIMQGIEPDVVTYNTLVDAHCKEGMVSEAEDIIDAM  306

Query  254  KERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKEL  433
             +RG EP++  YNTL+D H +   + + E +   M +R + P+ V+Y+++I+ +    E+
Sbjct  307  IKRGIEPDIVTYNTLVDAHCKEGMVSEAEDIVDAMMKRGIEPNVVTYSALINGHCLQNEM  366

Query  434  ESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
                + +      G   D      M+  + K  ++D+ ++L  ++
Sbjct  367  HKARRVFNLMIEKGCAPDIVTYSTMINGYCKGKRLDKAMELFHEI  411


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/214 (26%), Positives = 100/214 (47%), Gaps = 0/214 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  + + ++ +G EP  VTY++++N +C      KA   F+ M +KG    IV YS+M+N
Sbjct  334  AEDIVDAMMKRGIEPNVVTYSALINGHCLQNEMHKARRVFNLMIEKGCAPDIVTYSTMIN  393

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             Y K  R  +A  L  ++  +G  P+    +TL+    +   +    +++++M     VP
Sbjct  394  GYCKGKRLDKAMELFHEISLKGPIPDTVTCSTLMQSMFQLGKVSTACELFRKMLASGQVP  453

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DRV+   ++    K   +E  +K +Q  + +G + D     I++    K  +++   +L 
Sbjct  454  DRVTCLILLDGLCKTGHIEEALKLFQAMRNSGLELDTVPYTILIDGLCKAGRIEFAKELF  513

Query  560  QDLKTDETKLDERLYRSALNALRDAGLEIRAKWL  661
              L  +  K D   Y   +N L   GL   A  L
Sbjct  514  CLLSDNGLKPDVYTYCIMINGLCKEGLPDEAYRL  547


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 75/160 (47%), Gaps = 35/160 (22%)
 Frame = +2

Query  47   SQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHK  226
            S+G EP  V Y +IL+  C+  +  +A   FSE++ KG    I+ Y+ +++     G+ +
Sbjct  168  SRGFEPNIVAYNTILDCLCKNRLLKEALDLFSEVKVKGIRPNIITYTCLIHGMCNLGQQE  227

Query  227  EATRLVAKMKE-----------------------------------RGCEPNVWIYNTLL  301
            EATRL+ +M +                                   +G EP+V  YNTL+
Sbjct  228  EATRLLNEMVDNNISINIDTYNILIAALCKEGTISKAVETVDMMIMQGIEPDVVTYNTLV  287

Query  302  DIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
            D H +   + + E +   M +R + PD V+Y +++ A+ K
Sbjct  288  DAHCKEGMVSEAEDIIDAMIKRGIEPDIVTYNTLVDAHCK  327


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/184 (20%), Positives = 87/184 (47%), Gaps = 0/184 (0%)
 Frame = +2

Query  86   ILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
            ++N +C++G          +M + G +  +V +S+++N      +  EA  +  +M E+G
Sbjct  76   LINCFCQLGRIDFGFSVLGKMLKLGVEPDVVIFSTLINGLCNQSKISEAVFMFDEMTEKG  135

Query  266  CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
             +PN+ +YNT+L    +  N  +  +  + M+ R   P+ V+Y +++    K + L+  +
Sbjct  136  YQPNLIVYNTVLKGLCKTGNTDRAVRFLRLMESRGFEPNIVAYNTILDCLCKNRLLKEAL  195

Query  446  KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
              + + K+ G + +      ++     + + +E  +LL ++  +   ++   Y   + AL
Sbjct  196  DLFSEVKVKGIRPNIITYTCLIHGMCNLGQQEEATRLLNEMVDNNISINIDTYNILIAAL  255

Query  626  RDAG  637
               G
Sbjct  256  CKEG  259


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 83/177 (47%), Gaps = 4/177 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +++++  +G +P  + Y ++L   C+ G   +A      ME +GF+  IVAY+++++
Sbjct  124  AVFMFDEMTEKGYQPNLIVYNTVLKGLCKTGNTDRAVRFLRLMESRGFEPNIVAYNTILD  183

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE--KVWKEMKRRKV  373
               K    KEA  L +++K +G  PN+  Y  L  IHG  +  +Q E  ++  EM    +
Sbjct  184  CLCKNRLLKEALDLFSEVKVKGIRPNIITYTCL--IHGMCNLGQQEEATRLLNEMVDNNI  241

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDE  544
              +  +Y  +I+A  K   +   V+      + G + D      +V    K   V E
Sbjct  242  SINIDTYNILIAALCKEGTISKAVETVDMMIMQGIEPDVVTYNTLVDAHCKEGMVSE  298



>gb|KJB69895.1| hypothetical protein B456_011G048600, partial [Gossypium raimondii]
Length=595

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 115/219 (53%), Gaps = 0/219 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  +++++ SQ C+P   TY +++N + R G+  KAE  F ++++ G +  + AY++++
Sbjct  297  MALKLFDEMRSQKCKPNICTYTALVNAFAREGLCEKAEEIFEQLQEAGHEPDVYAYNALM  356

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   +N ++D +GRA   +  E V++EMK+  + 
Sbjct  357  EAYSRAGYPYGAAEVFSLMQHMGCEPDRASFNIMVDAYGRAGLYEDAESVFEEMKKLGIK  416

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYS+   +  C       + +G + D  +   M+ ++ K+ + + + K+
Sbjct  417  PTMKSHMLLLSAYSRVGNIAKCENIVNQIQESGLQPDTFVLNSMLNLYGKLGQFENMEKV  476

Query  557  LQDLKTDETKLDERLYRSALNALRDAGLEIRAKWLQESF  673
            L  ++    + D   Y   +N    AG   R + L +S 
Sbjct  477  LVAMEKGPYEADISTYNILINVYGRAGYFNRMEELFQSL  515


 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 107/186 (58%), Gaps = 0/186 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V+E++   G +P   ++  +L+ Y R+G  +K E   +++++ G        +SM+N
Sbjct  403  AESVFEEMKKLGIKPTMKSHMLLLSAYSRVGNIAKCENIVNQIQESGLQPDTFVLNSMLN  462

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YGK G+ +   +++  M++   E ++  YN L++++GRA    ++E++++ +  + + P
Sbjct  463  LYGKLGQFENMEKVLVAMEKGPYEADISTYNILINVYGRAGYFNRMEELFQSLPAKNLTP  522

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++TS + AYS+ K  + C++ +++    G   D   A +++   S  ++++++  ++
Sbjct  523  DVVTWTSRLGAYSRKKLYQRCLEIFEEMIDAGCYPDGGTAKVLLSACSSEDQIEQVTTVI  582

Query  560  QDLKTD  577
            + +  D
Sbjct  583  RTMHKD  588


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 101/204 (50%), Gaps = 10/204 (5%)
 Frame = +2

Query  32   YEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGK  211
            Y +L+   C P + TYA ++  YC  G+  KAE  F+EM + G       Y++ ++   K
Sbjct  197  YLELLEARCVPTEDTYALLVKAYCTAGLKQKAEAVFAEMRKHGLSPSATVYNAYIDGLMK  256

Query  212  TGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVS  391
             G  ++A  +  +MK  GC+ N   Y  +++++G+AS      K++ EM+ +K  P+  +
Sbjct  257  GGNSQKAIEVFQRMKRDGCQLNTETYTLMINLYGKASKSYMALKLFDEMRSQKCKPNICT  316

Query  392  YTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN---KVDELVKLLQ  562
            YT++++A+++    E   + ++  +  G + D      ++  +S+        E+  L+Q
Sbjct  317  YTALVNAFAREGLCEKAEEIFEQLQEAGHEPDVYAYNALMEAYSRAGYPYGAAEVFSLMQ  376

Query  563  DLKTDETKLDERLYRSALNALRDA  634
             +  +         R++ N + DA
Sbjct  377  HMGCEPD-------RASFNIMVDA  393


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 96/200 (48%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++++   GC+    TY  ++N+Y +      A   F EM  +     I  Y+++VN
Sbjct  263  AIEVFQRMKRDGCQLNTETYTLMINLYGKASKSYMALKLFDEMRSQKCKPNICTYTALVN  322

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +++E G EP+V+ YN L++ + RA       +V+  M+     P
Sbjct  323  AFAREGLCEKAEEIFEQLQEAGHEPDVYAYNALMEAYSRAGYPYGAAEVFSLMQHMGCEP  382

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR S+  ++ AY +A   E     +++ K  G K       +++  +S++  + +   ++
Sbjct  383  DRASFNIMVDAYGRAGLYEDAESVFEEMKKLGIKPTMKSHMLLLSAYSRVGNIAKCENIV  442

Query  560  QDLKTDETKLDERLYRSALN  619
              ++    + D  +  S LN
Sbjct  443  NQIQESGLQPDTFVLNSMLN  462


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 93/201 (46%), Gaps = 0/201 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++E+L   G EP    Y +++  Y R G    A   FS M+  G +    +++ MV+
Sbjct  333  AEEIFEQLQEAGHEPDVYAYNALMEAYSRAGYPYGAAEVFSLMQHMGCEPDRASFNIMVD  392

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             YG+ G +++A  +  +MK+ G +P +  +  LL  + R  N+ + E +  +++   + P
Sbjct  393  AYGRAGLYEDAESVFEEMKKLGIKPTMKSHMLLLSAYSRVGNIAKCENIVNQIQESGLQP  452

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D     S+++ Y K  + E+  K     +    + D +   I++ V+ +    + + +L 
Sbjct  453  DTFVLNSMLNLYGKLGQFENMEKVLVAMEKGPYEADISTYNILINVYGRAGYFNRMEELF  512

Query  560  QDLKTDETKLDERLYRSALNA  622
            Q L       D   + S L A
Sbjct  513  QSLPAKNLTPDVVTWTSRLGA  533


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/197 (19%), Positives = 91/197 (46%), Gaps = 4/197 (2%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAE--MTFSE--MEQKGFDKCIVAYSSMVNMYGKTGRHKE  229
            P   T+  ++N+  ++ +  K +  +   E  +++  F   ++ ++ +++ YG+   +K+
Sbjct  133  PSHSTWDDLINVAVQLRLNKKWDPIVLLCEWILQRSSFQLDVMCFNLLIDAYGQKSLYKK  192

Query  230  ATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVIS  409
                  ++ E  C P    Y  L+  +  A   ++ E V+ EM++  + P    Y + I 
Sbjct  193  VESKYLELLEARCVPTEDTYALLVKAYCTAGLKQKAEAVFAEMRKHGLSPSATVYNAYID  252

Query  410  AYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKL  589
               K    +  ++ +Q  K +G + +     +M+ ++ K +K    +KL  ++++ + K 
Sbjct  253  GLMKGGNSQKAIEVFQRMKRDGCQLNTETYTLMINLYGKASKSYMALKLFDEMRSQKCKP  312

Query  590  DERLYRSALNALRDAGL  640
            +   Y + +NA    GL
Sbjct  313  NICTYTALVNAFAREGL  329


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/187 (21%), Positives = 88/187 (47%), Gaps = 6/187 (3%)
 Frame = +2

Query  86   ILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVA---YSSMVNMYGKTGRHKEATRLVAKMK  256
            +++ Y +  +Y K E  + E+ +    +C+     Y+ +V  Y   G  ++A  + A+M+
Sbjct  180  LIDAYGQKSLYKKVESKYLELLEA---RCVPTEDTYALLVKAYCTAGLKQKAEAVFAEMR  236

Query  257  ERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELE  436
            + G  P+  +YN  +D   +  N ++  +V++ MKR     +  +YT +I+ Y KA +  
Sbjct  237  KHGLSPSATVYNAYIDGLMKGGNSQKAIEVFQRMKRDGCQLNTETYTLMINLYGKASKSY  296

Query  437  SCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSAL  616
              +K + + +    K +      +V  F++    ++  ++ + L+    + D   Y + +
Sbjct  297  MALKLFDEMRSQKCKPNICTYTALVNAFAREGLCEKAEEIFEQLQEAGHEPDVYAYNALM  356

Query  617  NALRDAG  637
             A   AG
Sbjct  357  EAYSRAG  363



>gb|AHX42061.1| pentatricopeptide repeat-containing protein 11, partial [Campanula 
lactiflora]
Length=265

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 112/226 (50%), Gaps = 5/226 (2%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            VA   Y +++  G  P    +  ++N +C+ G    A + F EM + G    +V+Y++++
Sbjct  34   VAWDFYLEILGCGYPPNLYNFNILMNKFCKEGKVKDAHLVFDEMSRSGLRPTVVSYNTLI  93

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            N Y K G   E  RL   M++    P+V+ Y++L++   +   M    KV+ EM  + +V
Sbjct  94   NGYCKWGNLDEGFRLKKVMEKSRLVPDVFTYSSLINGLCKGGRMDDANKVFDEMCSKGLV  153

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P+ V YT++I+ + K  ++   ++ Y    + G K D  M   ++ V  K   ++E  KL
Sbjct  154  PNDVIYTTLINGFCKDGKVSLAMELYGRMLMKGVKPDLIMYNTLINVICKSGNINEARKL  213

Query  557  LQDLKTDETKLDERLYRSALNAL-----RDAGLEIRAKWLQESFAV  679
            + ++     K D+  Y + ++        DA LEIR + ++E   +
Sbjct  214  IDEMSLKGLKADKVTYTTLIDGCCKEGNLDAALEIRKRMIREGIEL  259


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 91/196 (46%), Gaps = 0/196 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++++   G  P  V+Y +++N YC+ G   +       ME+      +  YSS++N
Sbjct  70   AHLVFDEMSRSGLRPTVVSYNTLINGYCKWGNLDEGFRLKKVMEKSRLVPDVFTYSSLIN  129

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
               K GR  +A ++  +M  +G  PN  IY TL++   +   +    +++  M  + V P
Sbjct  130  GLCKGGRMDDANKVFDEMCSKGLVPNDVIYTTLINGFCKDGKVSLAMELYGRMLMKGVKP  189

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D + Y ++I+   K+  +    K   +  L G K D+     ++    K   +D  +++ 
Sbjct  190  DLIMYNTLINVICKSGNINEARKLIDEMSLKGLKADKVTYTTLIDGCCKEGNLDAALEIR  249

Query  560  QDLKTDETKLDERLYR  607
            + +  +  +LD   YR
Sbjct  250  KRMIREGIELDNVAYR  265



>ref|XP_006838107.1| hypothetical protein AMTR_s00106p00044940 [Amborella trichopoda]
 gb|ERN00676.1| hypothetical protein AMTR_s00106p00044940 [Amborella trichopoda]
Length=1042

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 120/241 (50%), Gaps = 35/241 (15%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +Y++++  G  P    Y ++++ +C+ G  +KA   F EM +KG    +++++++++
Sbjct  743  ALRLYDEMIQHGIVPDSFAYNALIDAHCKEGNMTKALDLFKEMVEKGHSVAVLSFNTLID  802

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G+ +EA RL+  M +    PN   Y T++D H +A N+KQ  +++ EM+ R+V P
Sbjct  803  GFCKMGKLQEADRLMKGMVDNHVMPNHVTYTTMIDGHCKAGNIKQAHRLFGEMQEREVFP  862

Query  380  DRVSYTSVISAYSKAKELESCVKYYQD-----------------------------FKLN  472
            + ++YTS+I+ + +  ++   ++ +++                             FKL 
Sbjct  863  NAITYTSLINGHCQEGDMGEALRLFEEMVARAIKPDEVTYGVLIHSLCKEGNLIEAFKLG  922

Query  473  GGKTDR------AMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDA  634
             G  D       AM   ++G   K   + E +KLL +++   TK D   Y + +++  + 
Sbjct  923  NGALDNGVSISLAMYNELIGALCKKGDLGEALKLLDEMRRQGTKADNATYSTLIHSSCEI  982

Query  635  G  637
            G
Sbjct  983  G  983


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 99/214 (46%), Gaps = 0/214 (0%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
             +   + + +   G  P    Y ++++  CR G   KA+  + +M  +G +     Y S 
Sbjct  496  ELGCEILDGMAGTGVPPDVFCYNTLISGLCRAGKIDKAKSYYQKMIGEGLEPTAFTYGSF  555

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKV  373
            ++ + K G+  +A     +M ++G  PN  IY T+++ H  A N ++    ++ M  R V
Sbjct  556  IHGHCKAGQMGDALVFFNEMLDQGLLPNDVIYTTVINGHCEAGNTEEAFSTFRAMLGRGV  615

Query  374  VPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVK  553
            +PD  +YT +++  +KA ++E  +    +        D      ++  F KM ++ + + 
Sbjct  616  IPDVRAYTVLVNGLAKAGKMEEALGVLFEMHSKDLTADVFTYTALISGFCKMGEIAKALL  675

Query  554  LLQDLKTDETKLDERLYRSALNALRDAGLEIRAK  655
             L+++   + + +   Y   LN L  +G   RAK
Sbjct  676  YLEEMLEKKIEPNISTYNVVLNGLWKSGDIERAK  709


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 88/174 (51%), Gaps = 0/174 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A +V +K+V+ G +P  +TY  ++   C+ G+  +A+    EM + G+    +AY+S++ 
Sbjct  358  AFSVKDKMVASGIQPSAITYNMLIRGVCKKGMVKEADKLLDEMVRMGYTPDSMAYTSVIE  417

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K      A  L+AKMK+R  +P+V  Y+ L++   R+ ++++   V +EM +  V P
Sbjct  418  GHCKNQNLAGAFDLLAKMKQRRVKPSVVTYSILINGLCRSGDLQRCNGVLEEMSKENVKP  477

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVD  541
            + V   ++I+A+ K   +E   +        G   D      ++    +  K+D
Sbjct  478  NAVICATLITAHCKEGNVELGCEILDGMAGTGVPPDVFCYNTLISGLCRAGKID  531


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 103/217 (47%), Gaps = 12/217 (6%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++  + ++G  P  VTY  ++  +C  G   +A   + EM Q G      AY+++++
Sbjct  708  AKDMFRIIFAKGLTPTAVTYTIMIVGHCDSGDAKEALRLYDEMIQHGIVPDSFAYNALID  767

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + K G   +A  L  +M E+G    V  +NTL+D   +   +++ +++ K M    V+P
Sbjct  768  AHCKEGNMTKALDLFKEMVEKGHSVAVLSFNTLIDGFCKMGKLQEADRLMKGMVDNHVMP  827

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMN------KVD  541
            + V+YT++I  + KA  ++      Q  +L G   +R +    +   S +N       + 
Sbjct  828  NHVTYTTMIDGHCKAGNIK------QAHRLFGEMQEREVFPNAITYTSLINGHCQEGDMG  881

Query  542  ELVKLLQDLKTDETKLDERLYRSALNALRDAGLEIRA  652
            E ++L +++     K DE  Y   +++L   G  I A
Sbjct  882  EALRLFEEMVARAIKPDEVTYGVLIHSLCKEGNLIEA  918


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 93/208 (45%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    KRGPRVAATVY-EKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIV  178
            K G    A +Y E+++ +  EP   TY  +LN   + G   +A+  F  +  KG     V
Sbjct  666  KMGEIAKALLYLEEMLEKKIEPNISTYNVVLNGLWKSGDIERAKDMFRIIFAKGLTPTAV  725

Query  179  AYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEM  358
             Y+ M+  +  +G  KEA RL  +M + G  P+ + YN L+D H +  NM +   ++KEM
Sbjct  726  TYTIMIVGHCDSGDAKEALRLYDEMIQHGIVPDSFAYNALIDAHCKEGNMTKALDLFKEM  785

Query  359  KRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKV  538
              +      +S+ ++I  + K  +L+   +  +    N    +      M+    K   +
Sbjct  786  VEKGHSVAVLSFNTLIDGFCKMGKLQEADRLMKGMVDNHVMPNHVTYTTMIDGHCKAGNI  845

Query  539  DELVKLLQDLKTDETKLDERLYRSALNA  622
             +  +L  +++  E   +   Y S +N 
Sbjct  846  KQAHRLFGEMQEREVFPNAITYTSLING  873


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 0/179 (0%)
 Frame = +2

Query  41   LVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGR  220
            +V     P  VTY ++++ +C+ G   +A   F EM+++      + Y+S++N + + G 
Sbjct  820  MVDNHVMPNHVTYTTMIDGHCKAGNIKQAHRLFGEMQEREVFPNAITYTSLINGHCQEGD  879

Query  221  HKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTS  400
              EA RL  +M  R  +P+   Y  L+    +  N+ +  K+        V      Y  
Sbjct  880  MGEALRLFEEMVARAIKPDEVTYGVLIHSLCKEGNLIEAFKLGNGALDNGVSISLAMYNE  939

Query  401  VISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTD  577
            +I A  K  +L   +K   + +  G K D A    ++    ++  +D    LLQ++  D
Sbjct  940  LIGALCKKGDLGEALKLLDEMRRQGTKADNATYSTLIHSSCEIGNLDGATTLLQNMMDD  998


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/188 (21%), Positives = 89/188 (47%), Gaps = 0/188 (0%)
 Frame = +2

Query  74   TYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKM  253
            TY ++++ +C++G  +KA +   EM +K  +  I  Y+ ++N   K+G  + A  +   +
Sbjct  656  TYTALISGFCKMGEIAKALLYLEEMLEKKIEPNISTYNVVLNGLWKSGDIERAKDMFRII  715

Query  254  KERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKEL  433
              +G  P    Y  ++  H  + + K+  +++ EM +  +VPD  +Y ++I A+ K   +
Sbjct  716  FAKGLTPTAVTYTIMIVGHCDSGDAKEALRLYDEMIQHGIVPDSFAYNALIDAHCKEGNM  775

Query  434  ESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSA  613
               +  +++    G          ++  F KM K+ E  +L++ +  +    +   Y + 
Sbjct  776  TKALDLFKEMVEKGHSVAVLSFNTLIDGFCKMGKLQEADRLMKGMVDNHVMPNHVTYTTM  835

Query  614  LNALRDAG  637
            ++    AG
Sbjct  836  IDGHCKAG  843


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 78/173 (45%), Gaps = 35/173 (20%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  +  ++  +GC P  +TY +++   C+ G  S+A     +M QKG       Y ++V+
Sbjct  253  AKEILSEMEKKGCAPNAITYNTLIMGLCKAGSLSEAFELKKKMAQKGLIADGFTYGALVH  312

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLD-------------------------  304
               K  R +EA R++ +M E G +P+ +IY++L+D                         
Sbjct  313  GLCKEKRTEEAKRVITEMLENGLKPDCYIYSSLIDGLVRVEEIEEAFSVKDKMVASGIQP  372

Query  305  --------IHG--RASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKEL  433
                    I G  +   +K+ +K+  EM R    PD ++YTSVI  + K + L
Sbjct  373  SAITYNMLIRGVCKKGMVKEADKLLDEMVRMGYTPDSMAYTSVIEGHCKNQNL  425


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/209 (20%), Positives = 98/209 (47%), Gaps = 6/209 (3%)
 Frame = +2

Query  53   GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
            G +   V +  ++++Y ++G+  +A      M+  GF   +   +S++N   K  +    
Sbjct  159  GSDSNPVVFDVLIDVYVKMGMLEEASNALFSMKNMGFRPNLRRTNSILNALLKKDKMGLF  218

Query  233  TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
             ++   +      P+V+ Y+TLL  H  +  +++ +++  EM+++   P+ ++Y ++I  
Sbjct  219  WKVYNGLFPGEFSPDVYTYSTLLRAHLNSREIEKAKEILSEMEKKGCAPNAITYNTLIMG  278

Query  413  YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
              KA  L    +  +     G   D    G +V    K  + +E  +++ ++  +  K D
Sbjct  279  LCKAGSLSEAFELKKKMAQKGLIADGFTYGALVHGLCKEKRTEEAKRVITEMLENGLKPD  338

Query  593  ERLYRSALNALRDAGLEIRAKWLQESFAV  679
              +Y S ++ L      +R + ++E+F+V
Sbjct  339  CYIYSSLIDGL------VRVEEIEEAFSV  361


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 80/192 (42%), Gaps = 0/192 (0%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P  VTY+ ++N  CR G   +      EM ++      V  ++++  + K G  +    +
Sbjct  442  PSVVTYSILINGLCRSGDLQRCNGVLEEMSKENVKPNAVICATLITAHCKEGNVELGCEI  501

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
            +  M   G  P+V+ YNTL+    RA  + + +  +++M    + P   +Y S I  + K
Sbjct  502  LDGMAGTGVPPDVFCYNTLISGLCRAGKIDKAKSYYQKMIGEGLEPTAFTYGSFIHGHCK  561

Query  422  AKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERL  601
            A ++   + ++ +    G   +  +   ++    +    +E     + +       D R 
Sbjct  562  AGQMGDALVFFNEMLDQGLLPNDVIYTTVINGHCEAGNTEEAFSTFRAMLGRGVIPDVRA  621

Query  602  YRSALNALRDAG  637
            Y   +N L  AG
Sbjct  622  YTVLVNGLAKAG  633


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 64/138 (46%), Gaps = 0/138 (0%)
 Frame = +2

Query  62   PGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRL  241
            P  +TY S++N +C+ G   +A   F EM  +      V Y  +++   K G   EA +L
Sbjct  862  PNAITYTSLINGHCQEGDMGEALRLFEEMVARAIKPDEVTYGVLIHSLCKEGNLIEAFKL  921

Query  242  VAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSK  421
                 + G   ++ +YN L+    +  ++ +  K+  EM+R+    D  +Y+++I +  +
Sbjct  922  GNGALDNGVSISLAMYNELIGALCKKGDLGEALKLLDEMRRQGTKADNATYSTLIHSSCE  981

Query  422  AKELESCVKYYQDFKLNG  475
               L+      Q+   +G
Sbjct  982  IGNLDGATTLLQNMMDDG  999


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/182 (25%), Positives = 79/182 (43%), Gaps = 4/182 (2%)
 Frame = +2

Query  29   VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
            VY  L      P   TY+++L  +       KA+   SEME+KG     + Y++++    
Sbjct  221  VYNGLFPGEFSPDVYTYSTLLRAHLNSREIEKAKEILSEMEKKGCAPNAITYNTLIMGLC  280

Query  209  KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHG--RASNMKQVEKVWKEMKRRKVVPD  382
            K G   EA  L  KM ++G   + + Y  L  +HG  +    ++ ++V  EM    + PD
Sbjct  281  KAGSLSEAFELKKKMAQKGLIADGFTYGAL--VHGLCKEKRTEEAKRVITEMLENGLKPD  338

Query  383  RVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQ  562
               Y+S+I    + +E+E           +G +       +++    K   V E  KLL 
Sbjct  339  CYIYSSLIDGLVRVEEIEEAFSVKDKMVASGIQPSAITYNMLIRGVCKKGMVKEADKLLD  398

Query  563  DL  568
            ++
Sbjct  399  EM  400



>ref|XP_004497161.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like 
[Cicer arietinum]
Length=578

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 110/208 (53%), Gaps = 0/208 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  ++++++SQ C+P   TY +++N + R G+  KAE  F +M++ G +  + AY++++
Sbjct  279  MALKLFDEMISQKCKPNICTYTALVNAFAREGLCEKAEEIFEQMQEAGLEPDVYAYNALM  338

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + M+  GCEP+   YN L+D +G+A      E V+++MKR  + 
Sbjct  339  EAYSRAGFPYGAAEIFSLMQHMGCEPDRASYNILVDAYGKAGFQDDAEAVFEDMKRVGIT  398

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  ++SAYSK   +  C         +G K D  +   M+ ++ ++ + +++ ++
Sbjct  399  PTMKSHMVLLSAYSKMGNVNKCEDILNQMCKSGLKLDTFVLNSMLNLYGRLGQFEKMEEV  458

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L  ++     +D   +   ++    AG 
Sbjct  459  LTVMEKGSYVVDISTFNILIHRYGQAGF  486


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 97/200 (49%), Gaps = 0/200 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++++   GC+    TY  ++N+Y + G    A   F EM  +     I  Y+++VN
Sbjct  245  AEEVFQRMKRDGCKLSTETYTMLINLYGKAGKSFMALKLFDEMISQKCKPNICTYTALVN  304

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
             + + G  ++A  +  +M+E G EP+V+ YN L++ + RA       +++  M+     P
Sbjct  305  AFAREGLCEKAEEIFEQMQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIFSLMQHMGCEP  364

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            DR SY  ++ AY KA   +     ++D K  G         +++  +SKM  V++   +L
Sbjct  365  DRASYNILVDAYGKAGFQDDAEAVFEDMKRVGITPTMKSHMVLLSAYSKMGNVNKCEDIL  424

Query  560  QDLKTDETKLDERLYRSALN  619
              +     KLD  +  S LN
Sbjct  425  NQMCKSGLKLDTFVLNSMLN  444


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 99/219 (45%), Gaps = 35/219 (16%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKG-------------  160
            A + Y +L    C P + TYA ++  YC  G    AE  F+EM   G             
Sbjct  175  AESTYLQLHEARCIPNEDTYALLIKAYCLSGKLQNAEAVFAEMRNYGLPSSSVVYNAYMN  234

Query  161  -------FDK------------CIVA---YSSMVNMYGKTGRHKEATRLVAKMKERGCEP  274
                   FDK            C ++   Y+ ++N+YGK G+   A +L  +M  + C+P
Sbjct  235  GLMKGRNFDKAEEVFQRMKRDGCKLSTETYTMLINLYGKAGKSFMALKLFDEMISQKCKP  294

Query  275  NVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYY  454
            N+  Y  L++   R    ++ E+++++M+   + PD  +Y +++ AYS+A       + +
Sbjct  295  NICTYTALVNAFAREGLCEKAEEIFEQMQEAGLEPDVYAYNALMEAYSRAGFPYGAAEIF  354

Query  455  QDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLK  571
               +  G + DRA   I+V  + K    D+   + +D+K
Sbjct  355  SLMQHMGCEPDRASYNILVDAYGKAGFQDDAEAVFEDMK  393


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/186 (23%), Positives = 102/186 (55%), Gaps = 0/186 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V+E +   G  P   ++  +L+ Y ++G  +K E   ++M + G        +SM+N
Sbjct  385  AEAVFEDMKRVGITPTMKSHMVLLSAYSKMGNVNKCEDILNQMCKSGLKLDTFVLNSMLN  444

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            +YG+ G+ ++   ++  M++     ++  +N L+  +G+A  ++++E +++ + R+ + P
Sbjct  445  LYGRLGQFEKMEEVLTVMEKGSYVVDISTFNILIHRYGQAGFIEKMEDLFQLLLRKGLKP  504

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
            D V++TS I AYSK K    C++ +++   +G   D   A +++   S  ++++++  ++
Sbjct  505  DVVTWTSRIGAYSKKKLYLKCLEIFEEMIDDGCYPDGGTAKVLLAACSNEDQIEQVTSVI  564

Query  560  QDLKTD  577
            + +  D
Sbjct  565  RTMHKD  570


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/160 (21%), Positives = 73/160 (46%), Gaps = 0/160 (0%)
 Frame = +2

Query  161  FDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVE  340
            F   ++ Y+ +++ +G+   +KEA     ++ E  C PN   Y  L+  +  +  ++  E
Sbjct  152  FKPDVICYNLLIDAFGQKFLYKEAESTYLQLHEARCIPNEDTYALLIKAYCLSGKLQNAE  211

Query  341  KVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVF  520
             V+ EM+   +    V Y + ++   K +  +   + +Q  K +G K       +++ ++
Sbjct  212  AVFAEMRNYGLPSSSVVYNAYMNGLMKGRNFDKAEEVFQRMKRDGCKLSTETYTMLINLY  271

Query  521  SKMNKVDELVKLLQDLKTDETKLDERLYRSALNALRDAGL  640
             K  K    +KL  ++ + + K +   Y + +NA    GL
Sbjct  272  GKAGKSFMALKLFDEMISQKCKPNICTYTALVNAFAREGL  311



>ref|XP_002438011.1| hypothetical protein SORBIDRAFT_10g006490 [Sorghum bicolor]
 gb|EER89378.1| hypothetical protein SORBIDRAFT_10g006490 [Sorghum bicolor]
Length=1443

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 108/202 (53%), Gaps = 0/202 (0%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  ++ +LV +G  P  VTY S+L  + + G   K E T  E+ + GF K  + Y++M++
Sbjct  347  AERLFGELVEKGFMPDAVTYNSLLYAFAKEGNVDKVEHTCEELVKAGFKKNEITYNTMIH  406

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVP  379
            MYGK GR   A  L  +M+  GC P+   Y  ++D  G+   + +  KV ++M    + P
Sbjct  407  MYGKMGRLDLAVGLYDEMRAVGCTPDAVTYTVMIDSLGKMDKIAEAGKVLEDMADAGLKP  466

Query  380  DRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLL  559
              V+++++I AY+K        K +     +G K DR    +M+ VF++  + +++++L 
Sbjct  467  TLVAFSALICAYAKGGRRADAEKTFDCMIASGVKPDRLAYLVMLDVFARSGETEKMLRLY  526

Query  560  QDLKTDETKLDERLYRSALNAL  625
            + +  D  + D+ +Y+  L AL
Sbjct  527  RTMMNDNYRPDDDMYQVLLVAL  548


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 91/184 (49%), Gaps = 0/184 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            VA  +  ++   G  P  +TY ++++   +      A   F EM        +  Y++MV
Sbjct  276  VALDLLFEVRQSGLRPDVITYNTLISACSQSSNLEDAVTVFEEMIASECRPDLWTYNAMV  335

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
            +++G+ G+ +EA RL  ++ E+G  P+   YN+LL    +  N+ +VE   +E+ +    
Sbjct  336  SVHGRCGKAEEAERLFGELVEKGFMPDAVTYNSLLYAFAKEGNVDKVEHTCEELVKAGFK  395

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
             + ++Y ++I  Y K   L+  V  Y + +  G   D     +M+    KM+K+ E  K+
Sbjct  396  KNEITYNTMIHMYGKMGRLDLAVGLYDEMRAVGCTPDAVTYTVMIDSLGKMDKIAEAGKV  455

Query  557  LQDL  568
            L+D+
Sbjct  456  LEDM  459


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 103/205 (50%), Gaps = 4/205 (2%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKA---EMTFSEMEQKGFDKCIVAYSS  190
            A  + + +  +G +P  V++ +++N   + G  +     ++ F E+ Q G    ++ Y++
Sbjct  240  ARQLLDTMHDRGIDPDLVSFNTLINARSKSGCLAAGVALDLLF-EVRQSGLRPDVITYNT  298

Query  191  MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
            +++   ++   ++A  +  +M    C P++W YN ++ +HGR    ++ E+++ E+  + 
Sbjct  299  LISACSQSSNLEDAVTVFEEMIASECRPDLWTYNAMVSVHGRCGKAEEAERLFGELVEKG  358

Query  371  VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
             +PD V+Y S++ A++K   ++      ++    G K +      M+ ++ KM ++D  V
Sbjct  359  FMPDAVTYNSLLYAFAKEGNVDKVEHTCEELVKAGFKKNEITYNTMIHMYGKMGRLDLAV  418

Query  551  KLLQDLKTDETKLDERLYRSALNAL  625
             L  +++      D   Y   +++L
Sbjct  419  GLYDEMRAVGCTPDAVTYTVMIDSL  443


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 91/183 (50%), Gaps = 0/183 (0%)
 Frame = +2

Query  29    VYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYG  208
             +Y  + + G  P    Y S+ ++ C    +   E+  +EME  GF   +  ++S++NMY 
Sbjct  872   IYNGMKAAGYLPNMHLYRSMTSLLCHHNRFRDVELMIAEMEGAGFKPDLSIFNSLLNMYT  931

Query  209   KTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRV  388
               G     T++   + E G EP+   YNTL+ ++ R+   ++   +  EM +R + P   
Sbjct  932   AAGNFDRTTQVYQSILEAGLEPDEDTYNTLIVMYCRSLRPEEGFTLLNEMGKRGLTPKLQ  991

Query  389   SYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDL  568
             SY S+++A +KA+  E   + +++ +    + +R++  +M+ ++       +   LL  +
Sbjct  992   SYKSLLAASAKAELREQADQLFEEMRSKSYQLNRSIYHMMMKIYRNAGNHSKAENLLAVM  1051

Query  569   KTD  577
             K D
Sbjct  1052  KED  1054


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 86/197 (44%), Gaps = 0/197 (0%)
 Frame = +2

Query  11    PRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSS  190
             P    T+  ++  +G  P   +Y S+L    +  +  +A+  F EM  K +      Y  
Sbjct  971   PEEGFTLLNEMGKRGLTPKLQSYKSLLAASAKAELREQADQLFEEMRSKSYQLNRSIYHM  1030

Query  191   MVNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRK  370
             M+ +Y   G H +A  L+A MKE G EP +   + L+  +G A    + E V   +K   
Sbjct  1031  MMKIYRNAGNHSKAENLLAVMKEDGIEPTIATMHILMTSYGTAGQPHEAENVLNSLKSSS  1090

Query  371   VVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELV  550
             +    + Y++V  AY K  + +  +K   + K +G + D  +    +   S   +  + +
Sbjct  1091  LEVSTLPYSTVFDAYLKNGDYDLGIKKLLEMKRDGVEPDHQVWTCFIRAASLCEQTADAI  1150

Query  551   KLLQDLKTDETKLDERL  601
              LL+ L+     L  RL
Sbjct  1151  LLLKSLQDCGFDLPIRL  1167


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 98/210 (47%), Gaps = 5/210 (2%)
 Frame = +2

Query  14   RVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSM  193
            R A   +E L ++   P     A +L +  R    S AE  F     +G    +  +++M
Sbjct  171  RRALDAFEWL-ARSTAPASRAVAVVLGVLGRARQDSIAEEVFLRFAGEG--ATVQVFNAM  227

Query  194  VNMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQ--VEKVWKEMKRR  367
            + +Y ++GR  +A +L+  M +RG +P++  +NTL++   ++  +       +  E+++ 
Sbjct  228  MGVYARSGRFDDARQLLDTMHDRGIDPDLVSFNTLINARSKSGCLAAGVALDLLFEVRQS  287

Query  368  KVVPDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDEL  547
             + PD ++Y ++ISA S++  LE  V  +++   +  + D      MV V  +  K +E 
Sbjct  288  GLRPDVITYNTLISACSQSSNLEDAVTVFEEMIASECRPDLWTYNAMVSVHGRCGKAEEA  347

Query  548  VKLLQDLKTDETKLDERLYRSALNALRDAG  637
             +L  +L       D   Y S L A    G
Sbjct  348  ERLFGELVEKGFMPDAVTYNSLLYAFAKEG  377


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/151 (24%), Positives = 75/151 (50%), Gaps = 0/151 (0%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  +Y+++ + GC P  VTY  +++   ++   ++A     +M   G    +VA+S+++
Sbjct  416  LAVGLYDEMRAVGCTPDAVTYTVMIDSLGKMDKIAEAGKVLEDMADAGLKPTLVAFSALI  475

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y K GR  +A +    M   G +P+   Y  +LD+  R+   +++ ++++ M      
Sbjct  476  CAYAKGGRRADAEKTFDCMIASGVKPDRLAYLVMLDVFARSGETEKMLRLYRTMMNDNYR  535

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKL  469
            PD   Y  ++ A +K  + E   +  QD +L
Sbjct  536  PDDDMYQVLLVALAKEDKCEEIEEIIQDMEL  566


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/190 (21%), Positives = 85/190 (45%), Gaps = 0/190 (0%)
 Frame = +2

Query  53    GCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEA  232
             G +P    + S+LN+Y   G + +    +  + + G +     Y++++ MY ++ R +E 
Sbjct  915   GFKPDLSIFNSLLNMYTAAGNFDRTTQVYQSILEAGLEPDEDTYNTLIVMYCRSLRPEEG  974

Query  233   TRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISA  412
               L+ +M +RG  P +  Y +LL    +A   +Q +++++EM+ +    +R  Y  ++  
Sbjct  975   FTLLNEMGKRGLTPKLQSYKSLLAASAKAELREQADQLFEEMRSKSYQLNRSIYHMMMKI  1034

Query  413   YSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLD  592
             Y  A             K +G +   A   I++  +    +  E   +L  LK+   ++ 
Sbjct  1035  YRNAGNHSKAENLLAVMKEDGIEPTIATMHILMTSYGTAGQPHEAENVLNSLKSSSLEVS  1094

Query  593   ERLYRSALNA  622
                Y +  +A
Sbjct  1095  TLPYSTVFDA  1104


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/192 (18%), Positives = 91/192 (47%), Gaps = 0/192 (0%)
 Frame = +2

Query  86    ILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMYGKTGRHKEATRLVAKMKERG  265
             +L+ + + G   +    ++ M+  G+   +  Y SM ++     R ++   ++A+M+  G
Sbjct  856   MLDAFAKAGDVFEVMKIYNGMKAAGYLPNMHLYRSMTSLLCHHNRFRDVELMIAEMEGAG  915

Query  266   CEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDRVSYTSVISAYSKAKELESCV  445
              +P++ I+N+LL+++  A N  +  +V++ +    + PD  +Y ++I  Y ++   E   
Sbjct  916   FKPDLSIFNSLLNMYTAAGNFDRTTQVYQSILEAGLEPDEDTYNTLIVMYCRSLRPEEGF  975

Query  446   KYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQDLKTDETKLDERLYRSALNAL  625
                 +    G          ++   +K    ++  +L +++++   +L+  +Y   +   
Sbjct  976   TLLNEMGKRGLTPKLQSYKSLLAASAKAELREQADQLFEEMRSKSYQLNRSIYHMMMKIY  1035

Query  626   RDAGLEIRAKWL  661
             R+AG   +A+ L
Sbjct  1036  RNAGNHSKAENL  1047



>gb|EYU43675.1| hypothetical protein MIMGU_mgv1a006780mg [Erythranthe guttata]
Length=432

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 109/208 (52%), Gaps = 4/208 (2%)
 Frame = +2

Query  17   VAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMV  196
            +A  V+ ++ ++ C+P   TY +++N + R G+  KAE  F E+++ G +  + AY++++
Sbjct  138  MALDVFREMKNRKCKPNICTYTALMNAFARDGLCEKAEEIFEEIQEAGHEPDVYAYNALM  197

Query  197  NMYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVV  376
              Y + G    A  + + MK+  CEP+   YN LLD +GRA   +  + V+ EMKR  + 
Sbjct  198  EAYSRAGFPYAAAEIFSLMKQMVCEPDTASYNILLDAYGRAGLHQGAQAVFDEMKRLGIE  257

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            P   S+  +ISAYS+   +  C +     K +  K D  +   M+ ++ ++ + +E+ ++
Sbjct  258  PTMKSHMLLISAYSRIGNVLKCEEIVDQMKSSNLKPDTFVHNAMLNLYGRLGRFEEMEQV  317

Query  557  LQDLKTDETKLDERLYRSALNALRDAGL  640
            L  ++    K D   Y   +N    +G 
Sbjct  318  LAAIE----KPDISTYNILINVYGRSGF  341


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 113/193 (59%), Gaps = 6/193 (3%)
 Frame = +2

Query  20   AATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVN  199
            A  V++++   G EP   ++  +++ Y RIG   K E    +M+          +++M+N
Sbjct  244  AQAVFDEMKRLGIEPTMKSHMLLISAYSRIGNVLKCEEIVDQMKSSNLKPDTFVHNAMLN  303

Query  200  MYGKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKE-MKRRKVV  376
            +YG+ GR +E  +++A +++    P++  YN L++++GR+  + ++E+V++  + ++ + 
Sbjct  304  LYGRLGRFEEMEQVLAAIEK----PDISTYNILINVYGRSGFVDKMEEVFESIISKKNLR  359

Query  377  PDRVSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKL  556
            PD +++TS I AYS+ K+ + C + ++D   +G   D   A +++   S  ++++++  +
Sbjct  360  PDVMTWTSRIGAYSRKKQFKRCTEIFEDMIDSGCYPDGGTAKVLLSACSNEDQIEQVTHI  419

Query  557  LQDL-KTDETKLD  592
            ++ + ++D+T  D
Sbjct  420  VRTMHRSDDTSED  432


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 101/206 (49%), Gaps = 0/206 (0%)
 Frame = +2

Query  26   TVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFDKCIVAYSSMVNMY  205
            + Y +L+   C P Q TYA ++  YC+ G+ ++AE  F++M   GF      Y++ ++  
Sbjct  36   STYLELIEAQCIPTQDTYALLVKAYCKCGLVNRAESVFTKMRANGFSPNTTVYNAYIDGL  95

Query  206  GKTGRHKEATRLVAKMKERGCEPNVWIYNTLLDIHGRASNMKQVEKVWKEMKRRKVVPDR  385
             K    ++A  +  +MK   CEP    Y  +++I+G+ +       V++EMK RK  P+ 
Sbjct  96   YKGRESQQALAIFERMKRENCEPTAETYTMVINIYGKENKSYMALDVFREMKNRKCKPNI  155

Query  386  VSYTSVISAYSKAKELESCVKYYQDFKLNGGKTDRAMAGIMVGVFSKMNKVDELVKLLQD  565
             +YT++++A+++    E   + +++ +  G + D      ++  +S+        ++   
Sbjct  156  CTYTALMNAFARDGLCEKAEEIFEEIQEAGHEPDVYAYNALMEAYSRAGFPYAAAEIFSL  215

Query  566  LKTDETKLDERLYRSALNALRDAGLE  643
            +K    + D   Y   L+A   AGL 
Sbjct  216  MKQMVCEPDTASYNILLDAYGRAGLH  241


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 102/205 (50%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    RGPRVAATVYEKLVSQGCEPGQVTYASILNIYCRIGVYSKAEMTFSEMEQKGFD