BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040L11

Length=675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596448.1|  PREDICTED: mitochondrial chaperone BCS1-like       285   7e-90   Nicotiana tomentosiformis
ref|XP_009794987.1|  PREDICTED: mitochondrial chaperone BCS1-like       284   1e-89   Nicotiana sylvestris
ref|XP_006339806.1|  PREDICTED: mitochondrial chaperone BCS1-like       283   2e-89   
ref|XP_004230008.1|  PREDICTED: probable mitochondrial chaperone ...    283   4e-89   Solanum lycopersicum
ref|XP_006444778.1|  hypothetical protein CICLE_v10019936mg             275   5e-86   Citrus clementina [clementine]
ref|XP_010559141.1|  PREDICTED: probable mitochondrial chaperone ...    273   2e-85   Tarenaya hassleriana [spider flower]
ref|XP_010544865.1|  PREDICTED: probable mitochondrial chaperone ...    265   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_010507993.1|  PREDICTED: 26S protease regulatory subunit 8...    261   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010518339.1|  PREDICTED: probable mitochondrial chaperone ...    258   8e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010506675.1|  PREDICTED: probable mitochondrial chaperone ...    258   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_008362649.1|  PREDICTED: mitochondrial chaperone BCS1-like       257   4e-79   
ref|XP_009375440.1|  PREDICTED: mitochondrial chaperone BCS1-like       256   6e-79   Pyrus x bretschneideri [bai li]
ref|XP_004306636.1|  PREDICTED: uncharacterized protein LOC101302781    256   7e-79   Fragaria vesca subsp. vesca
ref|XP_006397194.1|  hypothetical protein EUTSA_v10028615mg             256   7e-79   Eutrema salsugineum [saltwater cress]
ref|XP_009334380.1|  PREDICTED: 26S protease regulatory subunit 8...    256   8e-79   Pyrus x bretschneideri [bai li]
ref|XP_009116854.1|  PREDICTED: probable mitochondrial chaperone ...    254   5e-78   Brassica rapa
ref|NP_182185.2|  P-loop containing nucleoside triphosphate hydro...    254   6e-78   Arabidopsis thaliana [mouse-ear cress]
emb|CDX71701.1|  BnaC08g31730D                                          253   9e-78   
ref|XP_010267472.1|  PREDICTED: mitochondrial chaperone BCS1-like       253   1e-77   Nelumbo nucifera [Indian lotus]
ref|XP_002533329.1|  ATP binding protein, putative                      252   2e-77   Ricinus communis
ref|XP_008376180.1|  PREDICTED: mitochondrial chaperone BCS1            252   3e-77   Malus domestica [apple tree]
ref|XP_006294099.1|  hypothetical protein CARUB_v10023091mg             251   6e-77   Capsella rubella
ref|XP_008233091.1|  PREDICTED: mitochondrial chaperone BCS1            250   1e-76   Prunus mume [ume]
ref|XP_007217940.1|  hypothetical protein PRUPE_ppa005000mg             249   3e-76   Prunus persica
emb|CDY57874.1|  BnaA09g55560D                                          254   7e-76   Brassica napus [oilseed rape]
gb|KJB09610.1|  hypothetical protein B456_001G152500                    247   1e-75   Gossypium raimondii
gb|EYU38871.1|  hypothetical protein MIMGU_mgv1a005433mg                247   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_007051474.1|  P-loop containing nucleoside triphosphate hy...    247   3e-75   
ref|XP_010100693.1|  putative mitochondrial chaperone bcs1              246   3e-75   Morus notabilis
ref|XP_002262724.1|  PREDICTED: probable mitochondrial chaperone ...    246   4e-75   Vitis vinifera
ref|XP_009761416.1|  PREDICTED: mitochondrial chaperone BCS1-like       246   5e-75   Nicotiana sylvestris
ref|XP_009588603.1|  PREDICTED: mitochondrial chaperone BCS1-like       245   1e-74   Nicotiana tomentosiformis
ref|XP_006350498.1|  PREDICTED: mitochondrial chaperone BCS1-like       245   1e-74   Solanum tuberosum [potatoes]
ref|XP_004234999.1|  PREDICTED: mitochondrial chaperone BCS1-like       244   2e-74   Solanum lycopersicum
ref|XP_010252452.1|  PREDICTED: probable mitochondrial chaperone ...    245   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_009142622.1|  PREDICTED: mitochondrial chaperone BCS1            244   3e-74   Brassica rapa
ref|XP_002320886.1|  AAA-type ATPase family protein                     244   5e-74   Populus trichocarpa [western balsam poplar]
emb|CDY41542.1|  BnaC04g00800D                                          242   1e-73   Brassica napus [oilseed rape]
ref|XP_011038785.1|  PREDICTED: probable mitochondrial chaperone ...    241   4e-73   Populus euphratica
gb|AAD20172.1|  hypothetical protein                                    240   7e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023131.1|  PREDICTED: putative cell division cycle ATPase     239   5e-72   Populus euphratica
ref|XP_011094241.1|  PREDICTED: probable mitochondrial chaperone ...    238   6e-72   Sesamum indicum [beniseed]
emb|CDX80032.1|  BnaA05g01240D                                          243   1e-71   
ref|XP_004133798.1|  PREDICTED: ATP-dependent zinc metalloproteas...    238   1e-71   Cucumis sativus [cucumbers]
gb|KJB24545.1|  hypothetical protein B456_004G150200                    236   2e-71   Gossypium raimondii
ref|XP_008437854.1|  PREDICTED: ATP-dependent zinc metalloproteas...    237   2e-71   Cucumis melo [Oriental melon]
gb|KJB41595.1|  hypothetical protein B456_007G110900                    236   4e-71   Gossypium raimondii
ref|XP_011075926.1|  PREDICTED: uncharacterized protein LOC105160305    236   5e-71   Sesamum indicum [beniseed]
ref|XP_010322229.1|  PREDICTED: uncharacterized protein LOC101262523    236   7e-71   Solanum lycopersicum
ref|XP_002515676.1|  ATP binding protein, putative                      235   8e-71   Ricinus communis
gb|KJB19872.1|  hypothetical protein B456_003G122600                    234   1e-70   Gossypium raimondii
ref|XP_011093096.1|  PREDICTED: probable mitochondrial chaperone ...    234   1e-70   Sesamum indicum [beniseed]
ref|XP_010054126.1|  PREDICTED: probable mitochondrial chaperone ...    234   1e-70   Eucalyptus grandis [rose gum]
ref|XP_006367360.1|  PREDICTED: uncharacterized protein LOC102582634    235   2e-70   Solanum tuberosum [potatoes]
ref|XP_004155177.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    234   2e-70   
ref|XP_004307905.1|  PREDICTED: cell division control protein 48-...    234   3e-70   Fragaria vesca subsp. vesca
gb|KDP30317.1|  hypothetical protein JCGZ_18154                         234   3e-70   Jatropha curcas
gb|KFK37429.1|  hypothetical protein AALP_AA4G255900                    233   3e-70   Arabis alpina [alpine rockcress]
gb|AFP55581.1|  ATP binding protein                                     231   3e-69   Rosa rugosa [Japanese rose]
gb|KHN35399.1|  Putative mitochondrial chaperone bcs1                   228   4e-69   Glycine soja [wild soybean]
ref|XP_011043686.1|  PREDICTED: ATP-dependent zinc metalloproteas...    230   8e-69   Populus euphratica
ref|XP_011084544.1|  PREDICTED: mitochondrial chaperone BCS1-like       230   1e-68   Sesamum indicum [beniseed]
ref|XP_003553796.1|  PREDICTED: mitochondrial chaperone BCS1-like       228   2e-68   Glycine max [soybeans]
ref|XP_002301424.2|  AAA-type ATPase family protein                     228   4e-68   
ref|XP_002318453.2|  hypothetical protein POPTR_0012s02770g             227   2e-67   
ref|XP_008234685.1|  PREDICTED: probable mitochondrial chaperone ...    226   3e-67   Prunus mume [ume]
ref|XP_002321380.2|  hypothetical protein POPTR_0015s01020g             224   1e-66   
ref|XP_007221060.1|  hypothetical protein PRUPE_ppa016223mg             222   1e-66   
ref|XP_003520880.1|  PREDICTED: uncharacterized protein LOC100776680    224   1e-66   Glycine max [soybeans]
ref|XP_008376774.1|  PREDICTED: probable mitochondrial chaperone ...    224   2e-66   Malus domestica [apple tree]
ref|XP_010933795.1|  PREDICTED: probable mitochondrial chaperone ...    223   4e-66   Elaeis guineensis
ref|XP_011044701.1|  PREDICTED: uncharacterized protein LOC105139793    221   2e-65   Populus euphratica
ref|XP_007135287.1|  hypothetical protein PHAVU_010G116600g             221   3e-65   Phaseolus vulgaris [French bean]
ref|XP_010109213.1|  putative mitochondrial chaperone bcs1              221   3e-65   Morus notabilis
ref|XP_008381389.1|  PREDICTED: mitochondrial chaperone BCS1-like       219   8e-65   
ref|XP_009351948.1|  PREDICTED: probable mitochondrial chaperone ...    219   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_009775982.1|  PREDICTED: uncharacterized protein LOC104225813    219   1e-64   Nicotiana sylvestris
ref|XP_009361315.1|  PREDICTED: probable mitochondrial chaperone ...    219   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_010919325.1|  PREDICTED: uncharacterized protein LOC105043468    219   2e-64   Elaeis guineensis
ref|XP_009351947.1|  PREDICTED: probable mitochondrial chaperone ...    219   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_008803962.1|  PREDICTED: uncharacterized protein LOC103717381    219   2e-64   
ref|XP_004502706.1|  PREDICTED: mitochondrial chaperone BCS1-like       217   1e-63   Cicer arietinum [garbanzo]
ref|XP_010035300.1|  PREDICTED: uncharacterized protein LOC104424536    216   2e-63   Eucalyptus grandis [rose gum]
ref|XP_007039156.1|  P-loop containing nucleoside triphosphate hy...    216   2e-63   
ref|XP_004510634.1|  PREDICTED: uncharacterized protein LOC101511087    216   2e-63   Cicer arietinum [garbanzo]
ref|XP_010693170.1|  PREDICTED: probable mitochondrial chaperone ...    215   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009599055.1|  PREDICTED: uncharacterized protein LOC104094765    216   4e-63   Nicotiana tomentosiformis
ref|XP_008790554.1|  PREDICTED: nuclear valosin-containing protei...    215   6e-63   Phoenix dactylifera
gb|EYU19673.1|  hypothetical protein MIMGU_mgv1a027053mg                214   6e-63   Erythranthe guttata [common monkey flower]
ref|XP_004145938.1|  PREDICTED: uncharacterized protein LOC101204309    213   8e-62   
gb|KGN49849.1|  hypothetical protein Csa_5G139270                       213   1e-61   Cucumis sativus [cucumbers]
ref|XP_010662911.1|  PREDICTED: 26S protease regulatory subunit 6...    211   2e-61   Vitis vinifera
ref|XP_007147339.1|  hypothetical protein PHAVU_006G115600g             209   8e-61   Phaseolus vulgaris [French bean]
gb|AES72562.2|  P-loop nucleoside triphosphate hydrolase superfam...    209   1e-60   Medicago truncatula
ref|XP_003602311.1|  Mitochondrial chaperone BCS1                       209   1e-60   
emb|CDP05017.1|  unnamed protein product                                207   1e-60   Coffea canephora [robusta coffee]
ref|XP_004160408.1|  PREDICTED: mitochondrial chaperone BCS1-like       209   1e-60   
ref|XP_006599768.1|  PREDICTED: uncharacterized protein LOC100792584    202   2e-60   Glycine max [soybeans]
ref|XP_007136478.1|  hypothetical protein PHAVU_009G048600g             207   3e-60   Phaseolus vulgaris [French bean]
gb|KHN23332.1|  Putative mitochondrial chaperone bcs1                   206   1e-59   Glycine soja [wild soybean]
ref|XP_003529879.1|  PREDICTED: cell division cycle protein 48 ho...    206   1e-59   Glycine max [soybeans]
ref|XP_008437620.1|  PREDICTED: mitochondrial chaperone BCS1-like       204   3e-59   Cucumis melo [Oriental melon]
ref|XP_003626582.1|  Mitochondrial chaperone BCS1                       204   6e-59   Medicago truncatula
ref|XP_003523343.1|  PREDICTED: mitochondrial chaperone BCS1-like...    202   3e-58   Glycine max [soybeans]
gb|EPS72484.1|  hypothetical protein M569_02272                         200   2e-57   Genlisea aurea
dbj|BAJ87142.1|  predicted protein                                      200   4e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008664748.1|  PREDICTED: transitional endoplasmic reticulu...    199   8e-57   Zea mays [maize]
ref|XP_010671395.1|  PREDICTED: uncharacterized protein LOC104888200    197   2e-56   
ref|XP_004982590.1|  PREDICTED: uncharacterized protein LOC101755261    198   3e-56   Setaria italica
ref|XP_008644692.1|  PREDICTED: ATP-dependent zinc metalloproteas...    196   9e-56   Zea mays [maize]
ref|XP_003527995.2|  PREDICTED: mitochondrial chaperone BCS1-like       195   1e-55   Glycine max [soybeans]
ref|XP_002464362.1|  hypothetical protein SORBIDRAFT_01g016970          193   2e-54   Sorghum bicolor [broomcorn]
ref|XP_004986004.1|  PREDICTED: uncharacterized protein LOC101775542    192   3e-54   Setaria italica
ref|XP_002465991.1|  hypothetical protein SORBIDRAFT_01g049680          192   5e-54   Sorghum bicolor [broomcorn]
ref|XP_009382317.1|  PREDICTED: uncharacterized protein LOC103970312    191   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150338.1|  ATP binding protein                                191   2e-53   Zea mays [maize]
ref|XP_003574206.1|  PREDICTED: uncharacterized protein LOC100834121    187   3e-52   Brachypodium distachyon [annual false brome]
ref|XP_009411477.1|  PREDICTED: uncharacterized protein LOC103993224    186   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006441187.1|  hypothetical protein CICLE_v10023517mg             186   4e-52   Citrus clementina [clementine]
gb|EAZ25345.1|  hypothetical protein OsJ_09159                          186   8e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88267.1|  hypothetical protein OsI_09720                          186   8e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_001048744.1|  Os03g0114400                                       186   9e-52   
ref|XP_006491957.1|  PREDICTED: mitochondrial chaperone BCS1-like       185   1e-51   Citrus sinensis [apfelsine]
ref|XP_006649262.1|  PREDICTED: uncharacterized protein LOC102709999    186   1e-51   
gb|KDO59683.1|  hypothetical protein CISIN_1g044297mg                   181   1e-50   Citrus sinensis [apfelsine]
gb|EPS71797.1|  hypothetical protein M569_02959                         181   2e-50   Genlisea aurea
gb|KDP28443.1|  hypothetical protein JCGZ_14214                         177   4e-49   Jatropha curcas
ref|NP_001065078.2|  Os10g0519300                                       178   1e-48   
gb|EAY79221.1|  hypothetical protein OsI_34338                          178   1e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_002882079.1|  hypothetical protein ARALYDRAFT_346472             162   5e-44   
gb|ABR16249.1|  unknown                                                 163   3e-43   Picea sitchensis
ref|XP_009391570.1|  PREDICTED: mitochondrial chaperone BCS1-like       162   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006849190.1|  hypothetical protein AMTR_s00027p00211720          155   1e-40   
gb|AET02010.2|  P-loop nucleoside triphosphate hydrolase superfam...    153   7e-40   Medicago truncatula
emb|CDY27312.1|  BnaC04g50930D                                          147   3e-39   Brassica napus [oilseed rape]
ref|XP_003627534.1|  Cell division cycle protein-like protein           142   5e-36   
ref|XP_003562201.1|  PREDICTED: uncharacterized protein LOC100825790    142   5e-36   Brachypodium distachyon [annual false brome]
gb|EEE51276.1|  hypothetical protein OsJ_32176                          138   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003546854.2|  PREDICTED: uncharacterized protein LOC100820437    126   6e-30   Glycine max [soybeans]
ref|XP_003531459.1|  PREDICTED: uncharacterized protein LOC100783574    125   8e-30   Glycine max [soybeans]
gb|KHN06336.1|  Putative mitochondrial chaperone bcs1                   122   2e-29   Glycine soja [wild soybean]
ref|XP_007149116.1|  hypothetical protein PHAVU_005G042400g             123   3e-29   Phaseolus vulgaris [French bean]
ref|XP_004488574.1|  PREDICTED: uncharacterized protein LOC101489676    123   4e-29   
ref|XP_006359141.1|  PREDICTED: putative cell division cycle ATPa...    123   4e-29   Solanum tuberosum [potatoes]
ref|XP_004229339.1|  PREDICTED: putative cell division cycle ATPase     123   5e-29   Solanum lycopersicum
ref|XP_006369479.1|  hypothetical protein POPTR_0001s23830g             122   2e-28   
ref|XP_011041988.1|  PREDICTED: uncharacterized protein LOC105137805    121   2e-28   Populus euphratica
ref|XP_011093400.1|  PREDICTED: mitochondrial chaperone BCS1-like       120   3e-28   Sesamum indicum [beniseed]
ref|XP_009617194.1|  PREDICTED: ATPase family gene 2 protein-like       120   3e-28   Nicotiana tomentosiformis
emb|CDY61723.1|  BnaA04g27130D                                          114   4e-28   Brassica napus [oilseed rape]
ref|XP_002313465.2|  hypothetical protein POPTR_0009s02930g             120   4e-28   
ref|XP_009791983.1|  PREDICTED: ATPase family gene 2 protein-like       120   6e-28   Nicotiana sylvestris
gb|KEH38185.1|  chaperone BCS1-A-like protein, putative                 119   9e-28   Medicago truncatula
gb|KDP20377.1|  hypothetical protein JCGZ_05260                         119   1e-27   Jatropha curcas
ref|XP_011009649.1|  PREDICTED: uncharacterized protein LOC105114707    119   2e-27   Populus euphratica
ref|XP_006482802.1|  PREDICTED: uncharacterized protein LOC102622284    117   8e-27   
gb|KDO46037.1|  hypothetical protein CISIN_1g009640mg                   117   8e-27   Citrus sinensis [apfelsine]
ref|XP_006439008.1|  hypothetical protein CICLE_v10031208mg             117   8e-27   Citrus clementina [clementine]
emb|CDP07666.1|  unnamed protein product                                115   3e-26   Coffea canephora [robusta coffee]
ref|XP_007014067.1|  ATP binding protein, putative                      115   4e-26   Theobroma cacao [chocolate]
ref|XP_008363332.1|  PREDICTED: uncharacterized protein LOC103427036    114   4e-26   
ref|XP_002512196.1|  ATP binding protein, putative                      115   4e-26   Ricinus communis
ref|XP_010243399.1|  PREDICTED: ATPase family gene 2 protein-like       114   8e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008647225.1|  PREDICTED: probable mitochondrial chaperone ...    109   1e-25   
ref|XP_010257525.1|  PREDICTED: uncharacterized protein LOC104597594    113   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008354934.1|  PREDICTED: uncharacterized protein LOC103418605    113   3e-25   
emb|CBI23057.3|  unnamed protein product                                114   4e-25   Vitis vinifera
ref|XP_002267624.1|  PREDICTED: uncharacterized protein LOC100263212    112   5e-25   Vitis vinifera
ref|XP_009365053.1|  PREDICTED: uncharacterized protein LOC103954926    112   8e-25   Pyrus x bretschneideri [bai li]
ref|XP_010098650.1|  putative mitochondrial chaperone bcs1              110   1e-24   Morus notabilis
gb|AFW73657.1|  hypothetical protein ZEAMMB73_137926                    108   2e-24   
emb|CBI38680.3|  unnamed protein product                                107   1e-23   Vitis vinifera
ref|XP_004151742.1|  PREDICTED: probable mitochondrial chaperone ...    107   2e-23   Cucumis sativus [cucumbers]
ref|XP_008346741.1|  PREDICTED: probable mitochondrial chaperone ...    103   5e-23   
ref|XP_006290651.1|  hypothetical protein CARUB_v10016743mg             106   2e-22   
ref|XP_008461752.1|  PREDICTED: mitochondrial chaperone BCS1-like       104   2e-22   Cucumis melo [Oriental melon]
ref|XP_006849577.1|  hypothetical protein AMTR_s00024p00191310          103   4e-22   
ref|XP_008363437.1|  PREDICTED: probable mitochondrial chaperone ...  99.8    1e-21   
emb|CDY61725.1|  BnaA04g27140D                                        96.3    1e-21   Brassica napus [oilseed rape]
ref|XP_008231398.1|  PREDICTED: uncharacterized protein LOC103330578    102   2e-21   Prunus mume [ume]
ref|XP_009785900.1|  PREDICTED: probable mitochondrial chaperone ...    101   2e-21   Nicotiana sylvestris
ref|XP_007218964.1|  hypothetical protein PRUPE_ppa003630mg             101   5e-21   Prunus persica
gb|KFK33168.1|  hypothetical protein AALP_AA6G339300                    101   6e-21   Arabis alpina [alpine rockcress]
gb|KCW46602.1|  hypothetical protein EUGRSUZ_K00412                   98.6    7e-21   Eucalyptus grandis [rose gum]
ref|XP_008811298.1|  PREDICTED: probable mitochondrial chaperone ...  99.8    2e-20   
ref|XP_009594242.1|  PREDICTED: probable mitochondrial chaperone ...  99.4    2e-20   Nicotiana tomentosiformis
ref|NP_001030789.1|  AAA-type ATPase family protein                   99.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403322.1|  PREDICTED: cell division cycle protein 48-like   99.4    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_189495.1|  AAA-type ATPase family protein                      99.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048616.1|  PREDICTED: probable mitochondrial chaperone ...  99.0    3e-20   Eucalyptus grandis [rose gum]
emb|CDY00129.1|  BnaC09g01720D                                        97.4    3e-20   
ref|XP_010914133.1|  PREDICTED: probable mitochondrial chaperone ...  98.6    3e-20   
ref|XP_010430825.1|  PREDICTED: katanin p60 ATPase-containing sub...  96.7    3e-20   
ref|XP_006662517.1|  PREDICTED: probable mitochondrial chaperone ...  95.9    4e-20   
ref|XP_009614445.1|  PREDICTED: probable mitochondrial chaperone ...  98.2    4e-20   Nicotiana tomentosiformis
ref|NP_189499.1|  AAA-type ATPase family protein                      98.2    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014284.1|  P-loop containing nucleoside triphosphate hy...  98.2    5e-20   
emb|CDX82999.1|  BnaA01g19990D                                        97.1    5e-20   
ref|XP_006290273.1|  hypothetical protein CARUB_v10017055mg           97.4    7e-20   Capsella rubella
gb|EMT28622.1|  Putative mitochondrial chaperone bcs1                 94.0    7e-20   
ref|XP_010265413.1|  PREDICTED: probable mitochondrial chaperone ...  97.4    8e-20   Nelumbo nucifera [Indian lotus]
gb|KFK33745.1|  hypothetical protein AALP_AA5G054400                  97.4    8e-20   Arabis alpina [alpine rockcress]
emb|CDY63216.1|  BnaAnng18700D                                        96.7    8e-20   Brassica napus [oilseed rape]
ref|XP_002534483.1|  ATP binding protein, putative                    97.1    1e-19   Ricinus communis
ref|XP_010425634.1|  PREDICTED: probable mitochondrial chaperone ...  96.7    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009111599.1|  PREDICTED: probable mitochondrial chaperone ...  97.1    1e-19   Brassica rapa
ref|XP_008437741.1|  PREDICTED: probable mitochondrial chaperone ...  96.7    1e-19   Cucumis melo [Oriental melon]
gb|KJB23471.1|  hypothetical protein B456_004G100300                  96.7    1e-19   Gossypium raimondii
ref|XP_006401201.1|  hypothetical protein EUTSA_v10013277mg           96.7    2e-19   Eutrema salsugineum [saltwater cress]
ref|NP_200556.1|  AAA-type ATPase family protein                      96.3    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548314.1|  PREDICTED: uncharacterized protein LOC104819774  97.4    2e-19   Tarenaya hassleriana [spider flower]
gb|KFK29244.1|  hypothetical protein AALP_AA7G108000                  95.5    2e-19   Arabis alpina [alpine rockcress]
ref|XP_010483268.1|  PREDICTED: probable mitochondrial chaperone ...  96.3    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010452147.1|  PREDICTED: probable mitochondrial chaperone ...  95.9    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006292204.1|  hypothetical protein CARUB_v10018409mg           95.5    3e-19   
gb|EPS73892.1|  hypothetical protein M569_00859                       95.5    3e-19   Genlisea aurea
ref|XP_006845620.1|  hypothetical protein AMTR_s00019p00215810        95.5    4e-19   Amborella trichopoda
ref|XP_009150457.1|  PREDICTED: probable mitochondrial chaperone ...  95.5    4e-19   Brassica rapa
ref|XP_004296428.1|  PREDICTED: probable mitochondrial chaperone ...  95.5    4e-19   Fragaria vesca subsp. vesca
ref|XP_011009528.1|  PREDICTED: probable mitochondrial chaperone ...  95.5    5e-19   Populus euphratica
gb|KJB53790.1|  hypothetical protein B456_009G005100                  95.5    6e-19   Gossypium raimondii
ref|XP_006281485.1|  hypothetical protein CARUB_v10027577mg           95.1    6e-19   Capsella rubella
ref|XP_003610132.1|  Mitochondrial chaperone BCS1                     95.1    6e-19   Medicago truncatula
ref|XP_009419133.1|  PREDICTED: uncharacterized protein LOC103999190  95.1    6e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY04025.1|  BnaC02g37400D                                        94.7    7e-19   
ref|XP_009129368.1|  PREDICTED: probable mitochondrial chaperone ...  94.7    7e-19   Brassica rapa
ref|XP_006381812.1|  AAA-type ATPase family protein                   94.7    7e-19   
ref|XP_007154771.1|  hypothetical protein PHAVU_003G146400g           94.7    7e-19   Phaseolus vulgaris [French bean]
ref|XP_003549478.1|  PREDICTED: probable mitochondrial chaperone ...  94.7    7e-19   Glycine max [soybeans]
ref|XP_009129367.1|  PREDICTED: probable mitochondrial chaperone ...  94.7    8e-19   Brassica rapa
ref|XP_006290910.1|  hypothetical protein CARUB_v10017023mg           94.7    8e-19   
gb|KFK29246.1|  hypothetical protein AALP_AA7G108200                  94.7    8e-19   Arabis alpina [alpine rockcress]
ref|XP_008362379.1|  PREDICTED: probable mitochondrial chaperone ...  94.7    8e-19   Malus domestica [apple tree]
ref|XP_010528302.1|  PREDICTED: mitochondrial chaperone BCS1-like     94.7    9e-19   
ref|XP_006292928.1|  hypothetical protein CARUB_v10019198mg           94.4    1e-18   Capsella rubella
ref|XP_009795973.1|  PREDICTED: probable mitochondrial chaperone ...  94.4    1e-18   Nicotiana sylvestris
ref|XP_004152449.1|  PREDICTED: uncharacterized protein LOC101216763  94.4    1e-18   Cucumis sativus [cucumbers]
ref|XP_004173444.1|  PREDICTED: uncharacterized protein LOC101232752  92.4    1e-18   
emb|CDX85203.1|  BnaC07g25140D                                        94.4    1e-18   
ref|NP_198817.1|  AAA-ATPase 1                                        94.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443434.1|  PREDICTED: probable mitochondrial chaperone ...  94.4    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006290856.1|  hypothetical protein CARUB_v10016966mg           94.4    1e-18   Capsella rubella
emb|CDY68365.1|  BnaCnng58650D                                        94.0    1e-18   Brassica napus [oilseed rape]
ref|XP_007222808.1|  hypothetical protein PRUPE_ppa004191mg           94.0    1e-18   
ref|XP_010435957.1|  PREDICTED: 26S protease regulatory subunit 6...  94.0    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010514563.1|  PREDICTED: mitochondrial chaperone BCS1-like     94.0    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010536912.1|  PREDICTED: probable mitochondrial chaperone ...  94.0    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010425637.1|  PREDICTED: mitochondrial chaperone BCS1-like     94.0    2e-18   Camelina sativa [gold-of-pleasure]
gb|KJB40801.1|  hypothetical protein B456_007G078300                  93.2    2e-18   Gossypium raimondii
ref|XP_010048623.1|  PREDICTED: probable mitochondrial chaperone ...  93.6    2e-18   Eucalyptus grandis [rose gum]
gb|KFK27298.1|  hypothetical protein AALP_AA8G364200                  93.6    2e-18   Arabis alpina [alpine rockcress]
ref|XP_004233688.1|  PREDICTED: putative cell division cycle ATPase   93.2    2e-18   Solanum lycopersicum
ref|XP_004152542.1|  PREDICTED: probable mitochondrial chaperone ...  93.2    3e-18   Cucumis sativus [cucumbers]
ref|XP_009132125.1|  PREDICTED: probable mitochondrial chaperone ...  93.2    3e-18   Brassica rapa
gb|ACJ85627.1|  unknown                                               92.8    3e-18   Medicago truncatula
ref|XP_010502855.1|  PREDICTED: putative cell division cycle ATPase   92.8    3e-18   
ref|XP_002325059.2|  hypothetical protein POPTR_0018s10140g           92.8    4e-18   
gb|KFK29245.1|  hypothetical protein AALP_AA7G108100                  92.4    4e-18   Arabis alpina [alpine rockcress]
emb|CDX68403.1|  BnaC01g24810D                                        90.9    4e-18   
ref|XP_002269013.2|  PREDICTED: probable mitochondrial chaperone ...  92.4    4e-18   Vitis vinifera
ref|XP_011043981.1|  PREDICTED: probable mitochondrial chaperone ...  92.4    5e-18   Populus euphratica
ref|XP_004146314.1|  PREDICTED: probable mitochondrial chaperone ...  92.4    6e-18   
emb|CDX86427.1|  BnaA06g31440D                                        92.0    6e-18   
ref|XP_006845622.1|  hypothetical protein AMTR_s00019p00216540        87.8    6e-18   
emb|CDX88624.1|  BnaA03g10250D                                        92.0    6e-18   
ref|XP_010450740.1|  PREDICTED: 26S protease regulatory subunit 6...  92.0    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004171202.1|  PREDICTED: uncharacterized protein LOC101232757  90.1    6e-18   
ref|XP_003541777.1|  PREDICTED: probable mitochondrial chaperone ...  92.0    6e-18   Glycine max [soybeans]
ref|XP_004163719.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...  92.0    6e-18   
ref|XP_010316971.1|  PREDICTED: probable mitochondrial chaperone ...  92.0    6e-18   Solanum lycopersicum
gb|KCW80930.1|  hypothetical protein EUGRSUZ_C02289                   90.9    6e-18   Eucalyptus grandis [rose gum]
ref|XP_006395357.1|  hypothetical protein EUTSA_v10003936mg           92.0    7e-18   
ref|XP_006405564.1|  hypothetical protein EUTSA_v10028293mg           91.7    7e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009151865.1|  PREDICTED: uncharacterized protein LOC103875...  92.0    7e-18   Brassica rapa
ref|XP_004507847.1|  PREDICTED: probable mitochondrial chaperone ...  92.0    7e-18   Cicer arietinum [garbanzo]
emb|CDY11867.1|  BnaC03g12930D                                        91.7    8e-18   Brassica napus [oilseed rape]
ref|XP_011079303.1|  PREDICTED: probable mitochondrial chaperone ...  91.7    8e-18   Sesamum indicum [beniseed]
ref|XP_010425638.1|  PREDICTED: probable mitochondrial chaperone ...  91.3    9e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009120266.1|  PREDICTED: probable mitochondrial chaperone ...  91.7    9e-18   Brassica rapa
emb|CDY38300.1|  BnaA10g11480D                                        91.7    9e-18   
ref|XP_010467631.1|  PREDICTED: cell division control protein 48 ...  91.3    1e-17   
ref|XP_008777056.1|  PREDICTED: mitochondrial chaperone BCS1-like     91.3    1e-17   
ref|XP_008465640.1|  PREDICTED: probable mitochondrial chaperone ...  91.7    1e-17   
ref|XP_008791926.1|  PREDICTED: probable mitochondrial chaperone ...  91.7    1e-17   
ref|XP_004233177.2|  PREDICTED: uncharacterized protein LOC101264...  91.7    1e-17   
ref|XP_010414050.1|  PREDICTED: cell division control protein 48 ...  91.3    1e-17   
dbj|BAB18781.1|  mitochondrial protein-like protein                   88.6    1e-17   
gb|KFK33743.1|  hypothetical protein AALP_AA5G054200                  89.4    1e-17   
ref|XP_010441115.1|  PREDICTED: 26S protease regulatory subunit 6...  90.9    2e-17   
ref|XP_006845728.1|  hypothetical protein AMTR_s00019p00244640        88.6    2e-17   
ref|XP_009401574.1|  PREDICTED: mitochondrial chaperone BCS1-like     90.9    2e-17   
gb|KGN59603.1|  hypothetical protein Csa_3G828430                     90.9    2e-17   
ref|XP_006338493.1|  PREDICTED: probable mitochondrial chaperone ...  90.9    2e-17   
ref|XP_006283565.1|  hypothetical protein CARUB_v10004616mg           90.9    2e-17   
ref|XP_010514564.1|  PREDICTED: probable mitochondrial chaperone ...  90.5    2e-17   
ref|XP_008223701.1|  PREDICTED: probable mitochondrial chaperone ...  90.9    2e-17   
ref|XP_009391104.1|  PREDICTED: 26S protease regulatory subunit 6...  90.5    2e-17   
ref|XP_010245232.1|  PREDICTED: uncharacterized protein LOC104588825  90.5    2e-17   
ref|XP_004233689.1|  PREDICTED: mitochondrial chaperone BCS1-like     90.5    2e-17   
ref|XP_007046849.1|  Cytochrome BC1 synthesis, putative               90.5    2e-17   
ref|XP_010438828.1|  PREDICTED: probable mitochondrial chaperone ...  90.1    2e-17   
ref|XP_010433585.1|  PREDICTED: mitochondrial chaperone BCS1-like     90.1    2e-17   
gb|KFK33165.1|  hypothetical protein AALP_AA6G338900                  90.1    3e-17   
ref|XP_002319660.2|  hypothetical protein POPTR_0013s04520g           90.1    3e-17   
emb|CDP20643.1|  unnamed protein product                              90.1    3e-17   
ref|NP_001145385.1|  hypothetical protein precursor                   90.1    3e-17   
emb|CDY00125.1|  BnaC09g01760D                                        89.7    3e-17   
ref|XP_010545417.1|  PREDICTED: probable mitochondrial chaperone ...  90.1    3e-17   
ref|XP_010425631.1|  PREDICTED: probable mitochondrial chaperone ...  90.1    3e-17   
gb|KCW80933.1|  hypothetical protein EUGRSUZ_C02292                   90.1    3e-17   
ref|XP_010514555.1|  PREDICTED: putative cell division cycle ATPase   90.1    4e-17   
ref|XP_008437744.1|  PREDICTED: probable mitochondrial chaperone ...  89.7    4e-17   
emb|CDY47248.1|  BnaA02g29340D                                        89.0    4e-17   
ref|XP_002460292.1|  hypothetical protein SORBIDRAFT_02g026090        89.7    4e-17   
ref|XP_008443443.1|  PREDICTED: uncharacterized protein LOC103487033  87.8    4e-17   
gb|KFK33171.1|  hypothetical protein AALP_AA6G339600                  89.7    4e-17   
gb|KFK29242.1|  hypothetical protein AALP_AA7G107900                  88.6    4e-17   
ref|XP_010425635.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    5e-17   
ref|XP_011038489.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    5e-17   
ref|NP_189492.1|  AAA-type ATPase family protein                      89.7    5e-17   
ref|XP_011038492.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    5e-17   
ref|XP_006338782.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    5e-17   
ref|XP_011038592.1|  PREDICTED: probable 26S protease regulatory ...  89.4    6e-17   
emb|CDX92734.1|  BnaC07g39920D                                        89.0    6e-17   
gb|KCW81094.1|  hypothetical protein EUGRSUZ_C02466                   87.4    8e-17   
ref|XP_007046843.1|  P-loop containing nucleoside triphosphate hy...  88.2    9e-17   
ref|XP_010502854.1|  PREDICTED: probable mitochondrial chaperone ...  88.6    9e-17   
gb|KJB47517.1|  hypothetical protein B456_008G030000                  88.6    9e-17   
gb|KJB47516.1|  hypothetical protein B456_008G030000                  88.6    1e-16   
ref|XP_010093843.1|  putative mitochondrial chaperone BCS1-B          88.6    1e-16   
ref|XP_010448362.1|  PREDICTED: probable mitochondrial chaperone ...  88.2    1e-16   
ref|XP_010917250.1|  PREDICTED: uncharacterized protein LOC105041886  88.6    1e-16   
ref|NP_189502.2|  P-loop containing nucleoside triphosphate hydro...  88.2    1e-16   
ref|XP_004163178.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...  87.8    1e-16   
ref|XP_006375857.1|  hypothetical protein POPTR_0013s04510g           88.6    1e-16   
gb|KJB33681.1|  hypothetical protein B456_006G026100                  88.6    1e-16   
ref|XP_010259830.1|  PREDICTED: probable mitochondrial chaperone ...  88.2    1e-16   
ref|XP_006297415.1|  hypothetical protein CARUB_v10013439mg           88.6    1e-16   
ref|XP_004149097.1|  PREDICTED: probable mitochondrial chaperone ...  87.8    1e-16   
gb|KGN61090.1|  hypothetical protein Csa_2G047830                     87.8    1e-16   
ref|XP_011468356.1|  PREDICTED: uncharacterized protein LOC105352568  86.3    1e-16   
ref|XP_006845725.1|  hypothetical protein AMTR_s00019p00244450        87.8    1e-16   
gb|EMT02204.1|  Putative mitochondrial chaperone BCS1-B               87.4    1e-16   
gb|KCW56152.1|  hypothetical protein EUGRSUZ_I01906                   87.8    1e-16   
gb|KCW44542.1|  hypothetical protein EUGRSUZ_L01951                   87.8    1e-16   
ref|XP_004489486.1|  PREDICTED: probable mitochondrial chaperone ...  87.8    1e-16   
ref|XP_006413265.1|  hypothetical protein EUTSA_v10024942mg           88.2    1e-16   
ref|XP_010029269.1|  PREDICTED: probable mitochondrial chaperone ...  87.8    1e-16   
ref|XP_010041206.1|  PREDICTED: probable mitochondrial chaperone ...  87.8    2e-16   
ref|XP_009335808.1|  PREDICTED: probable mitochondrial chaperone ...  87.8    2e-16   
gb|KFK33744.1|  hypothetical protein AALP_AA5G054300                  86.7    2e-16   
ref|XP_007046842.1|  P-loop containing nucleoside triphosphate hy...  87.8    2e-16   
emb|CDX74412.1|  BnaA04g09770D                                        86.7    2e-16   
ref|XP_010091916.1|  hypothetical protein L484_010480                 87.0    2e-16   
ref|XP_009111601.1|  PREDICTED: probable mitochondrial chaperone ...  87.4    2e-16   
ref|XP_002517442.1|  ATP binding protein, putative                    86.7    2e-16   
ref|NP_189493.1|  AAA-type ATPase family protein                      87.4    2e-16   
gb|KCW56149.1|  hypothetical protein EUGRSUZ_I01903                   87.0    3e-16   
ref|XP_006409417.1|  hypothetical protein EUTSA_v10023056mg           87.0    3e-16   
dbj|BAB01954.1|  unnamed protein product                              87.0    3e-16   
ref|XP_010042488.1|  PREDICTED: uncharacterized protein LOC104431576  85.1    3e-16   
dbj|BAJ87784.1|  predicted protein                                    87.0    3e-16   
ref|XP_006360731.1|  PREDICTED: probable mitochondrial chaperone ...  87.0    3e-16   
ref|XP_010030768.1|  PREDICTED: probable mitochondrial chaperone ...  87.0    3e-16   
ref|XP_004252618.1|  PREDICTED: probable mitochondrial chaperone ...  87.0    3e-16   
gb|EMT00774.1|  Mitochondrial chaperone BCS1                          85.5    3e-16   
ref|XP_009401058.1|  PREDICTED: 26S protease regulatory subunit 6...  86.7    4e-16   
emb|CAN79616.1|  hypothetical protein VITISV_004977                   87.0    4e-16   
ref|NP_849972.1|  P-loop containing nucleoside triphosphate hydro...  86.7    4e-16   
ref|XP_004147457.1|  PREDICTED: uncharacterized protein LOC101222103  87.0    4e-16   
gb|AES74657.2|  P-loop nucleoside triphosphate hydrolase superfam...  86.7    4e-16   
ref|XP_003618439.1|  Mitochondrial chaperone BCS1                     87.0    4e-16   
ref|XP_011078941.1|  PREDICTED: uncharacterized protein LOC105162...  85.9    5e-16   
ref|XP_010502856.1|  PREDICTED: probable mitochondrial chaperone ...  86.3    5e-16   
dbj|BAD42879.1|  AAA-type ATPase like protein                         86.3    5e-16   
gb|KHN21333.1|  Putative mitochondrial chaperone bcs1                 85.1    5e-16   
ref|XP_011036330.1|  PREDICTED: probable mitochondrial chaperone ...  86.7    5e-16   
ref|XP_008652752.1|  PREDICTED: uncharacterized protein LOC103632797  86.7    5e-16   
ref|XP_006292778.1|  hypothetical protein CARUB_v10019028mg           86.3    5e-16   
ref|XP_010658050.1|  PREDICTED: probable mitochondrial chaperone ...  86.3    6e-16   
ref|XP_003633423.2|  PREDICTED: probable mitochondrial chaperone ...  86.3    6e-16   
ref|XP_007201958.1|  hypothetical protein PRUPE_ppa004657mg           86.3    6e-16   
ref|XP_003560146.1|  PREDICTED: probable mitochondrial chaperone ...  86.3    6e-16   
gb|KDP36404.1|  hypothetical protein JCGZ_08673                       86.3    6e-16   
ref|XP_007151181.1|  hypothetical protein PHAVU_004G024800g           85.9    6e-16   
ref|XP_004302369.2|  PREDICTED: probable mitochondrial chaperone ...  86.3    6e-16   
ref|XP_009139945.1|  PREDICTED: probable mitochondrial chaperone ...  85.9    6e-16   
ref|XP_009593296.1|  PREDICTED: probable mitochondrial chaperone ...  86.3    7e-16   
ref|XP_004489485.1|  PREDICTED: probable mitochondrial chaperone ...  85.5    7e-16   
ref|XP_004171624.1|  PREDICTED: probable mitochondrial chaperone ...  85.9    7e-16   
ref|NP_567730.1|  AAA-type ATPase family protein                      85.9    8e-16   
ref|XP_004955726.1|  PREDICTED: probable 26S protease regulatory ...  85.9    8e-16   
ref|XP_008379811.1|  PREDICTED: probable mitochondrial chaperone ...  85.5    9e-16   
dbj|BAD94360.1|  BCS1 like mitochondrial protein                      85.5    9e-16   
ref|XP_011078940.1|  PREDICTED: probable mitochondrial chaperone ...  85.5    9e-16   
ref|XP_006845724.1|  hypothetical protein AMTR_s00019p00244260        85.9    9e-16   
ref|XP_003560147.1|  PREDICTED: mitochondrial chaperone BCS1-like     85.5    9e-16   
gb|EEC82151.1|  hypothetical protein OsI_26209                        85.5    1e-15   
ref|XP_010263593.1|  PREDICTED: mitochondrial chaperone BCS1-like     85.5    1e-15   
ref|XP_010679779.1|  PREDICTED: probable mitochondrial chaperone ...  85.5    1e-15   
ref|XP_010441108.1|  PREDICTED: probable mitochondrial chaperone ...  85.5    1e-15   
ref|XP_008241721.1|  PREDICTED: probable mitochondrial chaperone ...  85.5    1e-15   
emb|CAB39604.1|  putative mitochondrial protein                       85.9    1e-15   
ref|XP_004956922.1|  PREDICTED: uncharacterized protein LOC101755746  85.5    1e-15   
gb|EMS64027.1|  putative mitochondrial chaperone bcs1                 85.1    1e-15   
ref|XP_003578151.1|  PREDICTED: probable mitochondrial chaperone ...  85.5    1e-15   
ref|XP_006409187.1|  hypothetical protein EUTSA_v10022958mg           85.1    1e-15   
gb|KCW49361.1|  hypothetical protein EUGRSUZ_K02905                   85.1    1e-15   
ref|XP_010658054.1|  PREDICTED: probable mitochondrial chaperone ...  85.1    1e-15   
ref|XP_010658051.1|  PREDICTED: probable mitochondrial chaperone ...  85.1    1e-15   
ref|XP_010658053.1|  PREDICTED: probable mitochondrial chaperone ...  85.1    1e-15   
gb|EMT29435.1|  Putative mitochondrial chaperone bcs1                 85.1    1e-15   
ref|XP_009771793.1|  PREDICTED: probable mitochondrial chaperone ...  85.1    1e-15   
ref|XP_009785318.1|  PREDICTED: probable mitochondrial chaperone ...  85.1    1e-15   
emb|CDM83105.1|  unnamed protein product                              84.3    2e-15   
emb|CDY28172.1|  BnaA01g06770D                                        85.1    2e-15   
ref|XP_006425624.1|  hypothetical protein CICLE_v10025354mg           85.1    2e-15   
ref|XP_010091915.1|  putative mitochondrial chaperone BCS1-B          85.1    2e-15   
ref|XP_006425623.1|  hypothetical protein CICLE_v10025354mg           84.7    2e-15   
ref|XP_008230709.1|  PREDICTED: probable mitochondrial chaperone ...  84.7    2e-15   
gb|AAD31347.1|  putative AAA-type ATPase                              85.9    2e-15   
ref|XP_009335826.1|  PREDICTED: probable mitochondrial chaperone ...  84.7    2e-15   
ref|XP_006352079.1|  PREDICTED: probable mitochondrial chaperone ...  84.7    2e-15   
ref|XP_008353416.1|  PREDICTED: probable mitochondrial chaperone ...  84.7    2e-15   
ref|XP_006371099.1|  hypothetical protein POPTR_0019s03740g           85.1    2e-15   
ref|XP_010450752.1|  PREDICTED: probable mitochondrial chaperone ...  84.7    2e-15   
ref|XP_010033438.1|  PREDICTED: probable mitochondrial chaperone ...  84.3    2e-15   
emb|CDX68638.1|  BnaC01g08150D                                        84.7    2e-15   
ref|XP_010549720.1|  PREDICTED: mitochondrial chaperone BCS1          84.7    2e-15   
ref|XP_010430850.1|  PREDICTED: probable mitochondrial chaperone ...  84.3    2e-15   
ref|XP_002268083.3|  PREDICTED: probable mitochondrial chaperone ...  84.3    2e-15   
ref|XP_002462425.1|  hypothetical protein SORBIDRAFT_02g025400        84.7    2e-15   
ref|XP_010037622.1|  PREDICTED: uncharacterized protein LOC104426320  84.7    2e-15   
gb|KDO71006.1|  hypothetical protein CISIN_1g009791mg                 84.7    2e-15   
gb|KDP44568.1|  hypothetical protein JCGZ_22150                       84.3    2e-15   
ref|XP_008341515.1|  PREDICTED: probable mitochondrial chaperone ...  84.3    3e-15   
ref|XP_009127960.1|  PREDICTED: uncharacterized protein LOC103852809  84.7    3e-15   
ref|XP_008645004.1|  PREDICTED: mitochondrial chaperone BCS1-like     84.3    3e-15   
ref|XP_009122028.1|  PREDICTED: probable mitochondrial chaperone ...  84.3    3e-15   
gb|ACG28844.1|  ATPase 3                                              84.3    3e-15   
gb|KJB39867.1|  hypothetical protein B456_007G034600                  84.3    3e-15   
emb|CAN61985.1|  hypothetical protein VITISV_018747                   84.0    3e-15   
ref|XP_006423339.1|  hypothetical protein CICLE_v10028331mg           84.0    3e-15   
emb|CDY30283.1|  BnaC04g31940D                                        83.2    3e-15   
ref|XP_010507103.1|  PREDICTED: probable mitochondrial chaperone ...  82.4    3e-15   
ref|XP_006487228.1|  PREDICTED: probable mitochondrial chaperone ...  84.0    3e-15   
gb|KEH40137.1|  P-loop nucleoside triphosphate hydrolase superfam...  84.3    3e-15   
gb|ACF83668.1|  unknown                                               84.3    3e-15   
ref|XP_004489365.1|  PREDICTED: probable mitochondrial chaperone ...  84.0    3e-15   
ref|XP_009344864.1|  PREDICTED: probable mitochondrial chaperone ...  84.0    3e-15   
ref|XP_007046839.1|  P-loop containing nucleoside triphosphate hy...  84.3    3e-15   
ref|XP_007046840.1|  P-loop containing nucleoside triphosphate hy...  84.3    3e-15   
ref|XP_010435966.1|  PREDICTED: probable mitochondrial chaperone ...  84.0    3e-15   
dbj|BAK02275.1|  predicted protein                                    84.0    3e-15   
gb|ABO93010.1|  putative AAA ATPase                                   84.3    3e-15   
emb|CDY20912.1|  BnaC06g01320D                                        84.0    3e-15   
ref|XP_002325775.2|  hypothetical protein POPTR_0019s03730g           84.3    3e-15   
dbj|BAJ90254.1|  predicted protein                                    84.0    3e-15   
dbj|BAB02175.1|  mitochondrial protein-like                           84.0    3e-15   
ref|XP_003618437.1|  Mitochondrial chaperone BCS1                     84.0    4e-15   
gb|AAT39939.2|  ATPase protein, putative                              84.0    4e-15   
dbj|BAJ96296.1|  predicted protein                                    84.0    4e-15   
ref|NP_189501.2|  AAA-type ATPase family protein                      84.0    4e-15   
ref|XP_009774172.1|  PREDICTED: probable mitochondrial chaperone ...  84.0    4e-15   
ref|XP_011471009.1|  PREDICTED: uncharacterized protein LOC101307934  84.7    4e-15   
gb|KCW53073.1|  hypothetical protein EUGRSUZ_J02373                   83.6    4e-15   
ref|XP_008440759.1|  PREDICTED: peroxisome biogenesis factor 1-like   84.0    4e-15   
gb|KDP37459.1|  hypothetical protein JCGZ_08300                       84.0    4e-15   
ref|XP_006285394.1|  hypothetical protein CARUB_v10006799mg           83.6    4e-15   
emb|CAN77016.1|  hypothetical protein VITISV_010516                   83.6    4e-15   
ref|XP_002267418.2|  PREDICTED: probable mitochondrial chaperone ...  83.6    4e-15   
ref|XP_010033434.1|  PREDICTED: probable mitochondrial chaperone ...  83.6    4e-15   
emb|CDY66465.1|  BnaCnng51020D                                        83.2    4e-15   
ref|XP_009369380.1|  PREDICTED: probable mitochondrial chaperone ...  83.6    5e-15   
ref|XP_007037161.1|  AAA-ATPase 1                                     83.6    5e-15   
dbj|BAB10224.1|  unnamed protein product                              83.2    5e-15   
gb|ABR16643.1|  unknown                                               83.2    5e-15   
ref|XP_010248609.1|  PREDICTED: probable mitochondrial chaperone ...  83.6    5e-15   
ref|XP_009137558.1|  PREDICTED: uncharacterized protein LOC103861592  84.0    5e-15   
ref|XP_008230972.1|  PREDICTED: probable mitochondrial chaperone ...  83.2    5e-15   
ref|XP_010528303.1|  PREDICTED: probable mitochondrial chaperone ...  83.6    5e-15   
gb|AAT38764.1|  Putative ATPase protein, identical                    83.2    5e-15   
emb|CAN79700.1|  hypothetical protein VITISV_040494                   83.2    6e-15   
ref|XP_007215296.1|  hypothetical protein PRUPE_ppa005005mg           83.2    6e-15   
ref|XP_004955725.1|  PREDICTED: probable 26S protease regulatory ...  83.6    6e-15   
ref|NP_198816.1|  AAA-type ATPase family protein                      83.2    6e-15   
gb|ABO92982.1|  putative AAA ATPase                                   83.6    6e-15   
ref|XP_007217771.1|  hypothetical protein PRUPE_ppa018576mg           83.2    6e-15   
gb|EMS57301.1|  Mitochondrial chaperone BCS1                          83.2    6e-15   
emb|CDP02973.1|  unnamed protein product                              83.2    6e-15   
ref|XP_006283555.1|  hypothetical protein CARUB_v10004609mg           83.2    6e-15   
ref|XP_006299202.1|  hypothetical protein CARUB_v10015348mg           83.2    6e-15   
ref|XP_003561320.2|  PREDICTED: cell division cycle protein 48 ho...  84.0    6e-15   
gb|KHN34191.1|  Putative mitochondrial chaperone BCS1-B               83.2    6e-15   
gb|KDP20621.1|  hypothetical protein JCGZ_04128                       82.4    7e-15   
ref|XP_003554259.2|  PREDICTED: ATP-dependent zinc metalloproteas...  83.2    7e-15   
ref|XP_002461625.1|  hypothetical protein SORBIDRAFT_02g005660        83.2    7e-15   
ref|XP_006602893.1|  PREDICTED: probable mitochondrial chaperone ...  82.8    7e-15   
emb|CDY71731.1|  BnaAnng38610D                                        82.8    7e-15   
emb|CDM83505.1|  unnamed protein product                              82.8    8e-15   



>ref|XP_009596448.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana tomentosiformis]
Length=492

 Score =   285 bits (729),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 183/222 (82%), Gaps = 7/222 (3%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            VR  LYR+AL+F LRKW++W+DD++HVHQ+ KV +LN+N Q+NQ YR+V +YVNSL S+E
Sbjct  20   VRFILYRTALIFVLRKWANWVDDRIHVHQYLKVAELNENGQDNQFYRRVSLYVNSLPSVE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH--DGG--GRSLVlrik  367
            DS+FTNL   +  KS DIVL LDDNQV+QD+FLGAR+SW+NKV   + G   RS +LRIK
Sbjct  80   DSNFTNLF--SGKKSTDIVLSLDDNQVIQDEFLGARISWVNKVERFNNGVCNRSFLLRIK  137

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFET  547
            KKDKRRIL PY QHIHTVSD+IEQRRRELKLF+N    S++   GRWRSVPFTHP+T +T
Sbjct  138  KKDKRRILPPYFQHIHTVSDDIEQRRRELKLFINNG-PSENPIKGRWRSVPFTHPATLDT  196

Query  548  VVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            + M++DLK +VKSDLETF KSQ YYHK+GR W+R++LLYGPS
Sbjct  197  IAMDTDLKIKVKSDLETFTKSQNYYHKMGRAWKRNYLLYGPS  238



>ref|XP_009794987.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana sylvestris]
Length=492

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 183/222 (82%), Gaps = 7/222 (3%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
             R  LYR+AL+F LRKW++W+DD++HVHQ+ KV +LN+N Q+NQ YR+V +YVNSL S+E
Sbjct  20   ARFILYRTALIFVLRKWANWVDDRIHVHQYLKVAELNENGQDNQFYRRVSLYVNSLPSVE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH--DGG--GRSLVlrik  367
            DS+FTNL   +  KS DI+L LDDNQV++D+FLGAR+SW+NKV   + G   RS +LRIK
Sbjct  80   DSNFTNLF--SGKKSTDIILSLDDNQVIEDEFLGARISWVNKVERFNNGVCNRSFLLRIK  137

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFET  547
            KKDKRRIL PY QHIHTVSD+IEQRRRELKLF+N    S++   GRWRSVPFTHP+T +T
Sbjct  138  KKDKRRILPPYFQHIHTVSDDIEQRRRELKLFLNNG-PSENPIKGRWRSVPFTHPATLDT  196

Query  548  VVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            + M++DLKN+VKSDL+TF KSQ YYHK+GR W+R++LLYGPS
Sbjct  197  IAMDTDLKNKVKSDLDTFTKSQNYYHKMGRAWKRNYLLYGPS  238



>ref|XP_006339806.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum tuberosum]
Length=449

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 181/223 (81%), Gaps = 8/223 (4%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            VR  LYR+AL+  LRKW +W+DD++HVHQ+ KV +LN+N Q N+ YR+VF+Y+NSL S+E
Sbjct  20   VRFILYRTALILVLRKWMNWVDDRIHVHQYLKVAELNENGQNNEFYRRVFLYINSLPSIE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH--DGGG---RSLVlri  364
            DS+FTNL   +  KS DI+L LDDNQV+QD+FLGARV W+NKV   D GG   RS +LRI
Sbjct  80   DSNFTNLF--SGKKSTDIILSLDDNQVIQDEFLGARVDWVNKVERFDHGGVCNRSFLLRI  137

Query  365  kkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFE  544
            KKKDKRR LRPYLQHIHTVSD+IEQRR ELKLF+N    S++   GRWRSVPFTH ST +
Sbjct  138  KKKDKRRTLRPYLQHIHTVSDDIEQRRSELKLFINNG-PSENPVNGRWRSVPFTHHSTLD  196

Query  545  TVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            T+ M++DLKN+VKSDLE F+KSQ YYHK+GR W+R++LLYGPS
Sbjct  197  TIAMDADLKNKVKSDLENFIKSQNYYHKMGRAWKRNYLLYGPS  239



>ref|XP_004230008.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Solanum lycopersicum]
Length=491

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 183/223 (82%), Gaps = 8/223 (4%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            VR  LYR+AL+  LRKW++W+DD++HVHQ+ KV +LN+N Q+N+ YR+VF+Y+NSL S+E
Sbjct  20   VRFILYRTALILVLRKWANWMDDRIHVHQYLKVAELNENGQDNEFYRRVFLYINSLPSIE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH--DGGG---RSLVlri  364
            DS+FTNL   +  KS DI+L LDDNQV+QD+FLGARV W+NKV   D GG   RS +LRI
Sbjct  80   DSNFTNLF--SGKKSTDIILSLDDNQVIQDEFLGARVDWVNKVERFDHGGVCNRSFLLRI  137

Query  365  kkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFE  544
            KKKDKRR LRPYLQHIH VSD+IEQRR ELKLF+N    S++  +GRWRSVPFTH ST +
Sbjct  138  KKKDKRRTLRPYLQHIHAVSDDIEQRRSELKLFINNG-PSENPISGRWRSVPFTHHSTLD  196

Query  545  TVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            T+ M++DLKN+VKSDLE F+KSQ YYHK+GR W+R++LLYGPS
Sbjct  197  TIAMDADLKNKVKSDLENFVKSQNYYHKMGRAWKRNYLLYGPS  239



>ref|XP_006444778.1| hypothetical protein CICLE_v10019936mg [Citrus clementina]
 ref|XP_006491333.1| PREDICTED: ATP-dependent zinc metalloprotease YME1 homolog [Citrus 
sinensis]
 gb|ESR58018.1| hypothetical protein CICLE_v10019936mg [Citrus clementina]
 gb|KDO86558.1| hypothetical protein CISIN_1g011664mg [Citrus sinensis]
Length=480

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 179/220 (81%), Gaps = 6/220 (3%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R+ L+++ L+F  +KW  +I+D LHVHQFFKVP+ N+  QENQLYRKV+ Y+NSL+S+E
Sbjct  18   IRVLLFKTGLIFVAKKWWRFIEDCLHVHQFFKVPEFNEGMQENQLYRKVYAYLNSLTSIE  77

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            DSDFTNL      KSNDIVL LD NQ++QD FLGA +SW N+      R+LVL+++K D+
Sbjct  78   DSDFTNLFTGK--KSNDIVLGLDPNQLIQDNFLGAPLSWANQDDSATARTLVLKLRKADR  135

Query  380  rrilrPYLQHIHTVSDNIEQRR-RELKLFMNRSLASD-DSAAGRWRSVPFTHPSTFETVV  553
            RRILRPYLQHIH VSD +EQ++ R+L+LF+N  L +D D   GRWRSVPFTHPSTF+T+ 
Sbjct  136  RRILRPYLQHIHAVSDELEQKKKRDLRLFVN--LRNDRDGCCGRWRSVPFTHPSTFDTIS  193

Query  554  MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ME+DLKNRVKSDLE+FLK++ YYH+LGRVW+RS+LLYGPS
Sbjct  194  METDLKNRVKSDLESFLKAKHYYHRLGRVWKRSYLLYGPS  233



>ref|XP_010559141.1| PREDICTED: probable mitochondrial chaperone bcs1 [Tarenaya hassleriana]
Length=483

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 174/225 (77%), Gaps = 6/225 (3%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V  AVR+ L++S L+F ++KW   I D  HV+Q +KVP+ N++ QENQLYRKV+ Y+NS 
Sbjct  17   VLFAVRIVLFKSGLIFMVKKWRRRIVDLFHVYQLYKVPEFNESMQENQLYRKVYAYLNSF  76

Query  188  SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrik  367
            SS+EDSDFTNL      KSN+IVL LD NQ++ D+FLGARV W+N+  + G RSLVL ++
Sbjct  77   SSIEDSDFTNLFTGK--KSNEIVLRLDRNQIIDDEFLGARVCWINREDEDGARSLVLTVR  134

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASD----DSAAGRWRSVPFTHPS  535
            K DKRRILRPYLQHIHT SD +EQR+RELKLFMN     D        GRWRSVPFTHP 
Sbjct  135  KADKRRILRPYLQHIHTASDELEQRKRELKLFMNVGTTGDYDRTTQKNGRWRSVPFTHPC  194

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TF+ + +E+DLKN+VKSDLE+FLK++QYY++LGRVW+R +LLYGP
Sbjct  195  TFDNIAIEADLKNKVKSDLESFLKAKQYYNRLGRVWKRCYLLYGP  239



>ref|XP_010544865.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Tarenaya 
hassleriana]
Length=486

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 168/217 (77%), Gaps = 6/217 (3%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  214
            +++ L+F ++KW   I D  HV QF+KVP+ N+N QENQ YRKV  Y+NSL S+EDSDFT
Sbjct  26   FKTGLIFMVKKWRRRIVDLFHVSQFYKVPEFNENMQENQFYRKVCAYLNSLVSMEDSDFT  85

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilr  394
            NL      KSN+IVL  D NQ++ D+FLGARV W+N   D G R+ VL+I++ DKRRILR
Sbjct  86   NLFTGK--KSNEIVLRFDRNQIIDDEFLGARVCWINGEDDDGTRNFVLKIRRADKRRILR  143

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAA----GRWRSVPFTHPSTFETVVMES  562
            PYLQHIHTVSD +EQR RELKLFMN   A +D A     GRW+S PFTHP TF+ + ME+
Sbjct  144  PYLQHIHTVSDELEQRNRELKLFMNVGTAGNDDATTKKNGRWKSAPFTHPCTFDNIAMEA  203

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            DLKN+VKSDLE+FLK++QYY++LGRVW+RS+LLYGPS
Sbjct  204  DLKNKVKSDLESFLKAKQYYNRLGRVWKRSYLLYGPS  240



>ref|XP_010507993.1| PREDICTED: 26S protease regulatory subunit 8 homolog [Camelina 
sativa]
Length=487

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 171/218 (78%), Gaps = 4/218 (2%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            VR+ L+++ L++ ++ W   + D  HV+QF+KVP+ N+N QENQLY KV+ Y+NSLSS+E
Sbjct  21   VRVVLFKTGLIYMVKLWRRKLIDTFHVYQFYKVPEFNENVQENQLYSKVYAYLNSLSSIE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            +SDFTNL      K+N+I+L LD NQVV D+FLGARVSW+N  +D G R+ VL+I+K DK
Sbjct  81   NSDFTNLFTGK--KTNEIILRLDRNQVVSDEFLGARVSWINGQNDDGVRNFVLKIRKADK  138

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            RRIL  YLQHIHTVSD +EQR  ELKLFMN  +   +   GRWRS+PF HP TFE + ME
Sbjct  139  RRILSSYLQHIHTVSDELEQRNTELKLFMN--VDDQNKKNGRWRSIPFDHPCTFENIAME  196

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +DLKN+VKSDLE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  197  TDLKNKVKSDLESFLKGKQYYNRLGRVWKRSYLLYGPS  234



>ref|XP_010518339.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=483

 Score =   258 bits (660),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 168/217 (77%), Gaps = 5/217 (2%)
 Frame = +2

Query  23   RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  202
            R+ L+++ L++ ++ W   + D  HV+QF+KVP+ N N QENQLY KV+ Y+NSLSS+E+
Sbjct  22   RVVLFKTGLIYMVKLWRRKMIDTFHVYQFYKVPEFNDNVQENQLYLKVYAYLNSLSSIEN  81

Query  203  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkr  382
            SDFTNL      K+N+I+L LD NQVV D+FLGARVSW+N   + G R+ VL+I+K DKR
Sbjct  82   SDFTNLFTGK--KTNEIILRLDRNQVVGDEFLGARVSWINGQDEDGVRNFVLKIRKADKR  139

Query  383  rilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMES  562
            RIL  YLQHIHTVSD +EQR  ELKLFMN     DD   GRWRS+PF HP TFE + ME+
Sbjct  140  RILGSYLQHIHTVSDELEQRNTELKLFMN---VDDDHQNGRWRSIPFDHPCTFENIAMET  196

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            DLKN+VKSDLE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  197  DLKNKVKSDLESFLKGKQYYNRLGRVWKRSYLLYGPS  233



>ref|XP_010506675.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=486

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 167/217 (77%), Gaps = 5/217 (2%)
 Frame = +2

Query  23   RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  202
            R+ L+++ L++ ++ W   + D  HV+QF+KVP+ N N QENQLYRKV+ Y+NSLSS+E+
Sbjct  22   RVVLFKTGLIYMVKLWRRKMIDTFHVYQFYKVPEFNDNVQENQLYRKVYAYLNSLSSIEN  81

Query  203  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkr  382
            SDFTNL      K+N+I+L LD  QVV D+FLGARVSW+N   + G R+ VL+I+K DKR
Sbjct  82   SDFTNLFTGK--KTNEIILRLDRKQVVGDEFLGARVSWINGQDEDGVRNFVLKIRKADKR  139

Query  383  rilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMES  562
            RIL  YL HIHTVSD +EQR  ELKLFMN     DD   GRWRS+PF HP TFE + ME+
Sbjct  140  RILGSYLHHIHTVSDELEQRNTELKLFMN---VDDDHQNGRWRSIPFDHPCTFENIAMET  196

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            DLKN+VKSDLE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  197  DLKNKVKSDLESFLKGKQYYNRLGRVWKRSYLLYGPS  233



>ref|XP_008362649.1| PREDICTED: mitochondrial chaperone BCS1-like [Malus domestica]
Length=480

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 177/226 (78%), Gaps = 12/226 (5%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + +F A+R+ LYR+ LV+ ++KW    +D  HV+Q FKVP+ N++ QENQLY +V  Y+N
Sbjct  14   ICIFVAIRVALYRTGLVYIVKKWWRRFEDCFHVYQSFKVPEYNESMQENQLYGRVTDYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG--RSLV  355
            SL+S+EDSDFTNLV     K N+IVL LD NQ+++D FLGA+V W     +GGG  R+LV
Sbjct  74   SLTSVEDSDFTNLVTGK--KPNEIVLQLDPNQIIEDNFLGAKVIWQA---EGGGXSRNLV  128

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            L+++K DKRRILRPYLQHIH V+D +EQ++RELKL+MN      D+    W+ VPFTHPS
Sbjct  129  LKVRKADKRRILRPYLQHIHVVADELEQKKRELKLYMNV-----DAPDRAWKPVPFTHPS  183

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            TFET+ MESDLK++VKSDLE+FLK++QYYH+LGRVW+RSFLLYGPS
Sbjct  184  TFETISMESDLKSKVKSDLESFLKAKQYYHRLGRVWKRSFLLYGPS  229



>ref|XP_009375440.1| PREDICTED: mitochondrial chaperone BCS1-like [Pyrus x bretschneideri]
Length=481

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 174/224 (78%), Gaps = 7/224 (3%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + +  A+R+ LYR+ LV+ ++KW    +D  HV+Q FKVP+ N++ QENQLY +V  Y+N
Sbjct  14   ICISVAIRVALYRTGLVYIVKKWWRRFEDCFHVYQSFKVPEYNESMQENQLYGRVTDYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlr  361
            SL+S+EDSDFTNLV     K N+IVL LD NQ+++D FLGA+V W  +   GG R+LVL+
Sbjct  74   SLTSVEDSDFTNLVTGK--KPNEIVLQLDPNQIIEDNFLGAKVIWQAEGGGGGSRNLVLK  131

Query  362  ikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
            ++K DKRRILRPYLQHIH V+D +EQ++R LKL+MN      D+    W+ VPFTHPSTF
Sbjct  132  VRKADKRRILRPYLQHIHVVADELEQKKRGLKLYMNV-----DAPDRAWKPVPFTHPSTF  186

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ET+ MESDLK++VKSDLE+FLK++QYYH+LGRVW+RSFLLYGPS
Sbjct  187  ETISMESDLKSKVKSDLESFLKAKQYYHRLGRVWKRSFLLYGPS  230



>ref|XP_004306636.1| PREDICTED: uncharacterized protein LOC101302781 [Fragaria vesca 
subsp. vesca]
Length=491

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 178/230 (77%), Gaps = 8/230 (3%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + +F A+R+ LY++ LVF ++KW   ++D  HV+Q+FKVP+ N++ QENQLY KV  Y+N
Sbjct  14   ICIFVAIRVLLYKTGLVFIVKKWWRAVEDCFHVYQYFKVPEFNESMQENQLYCKVTHYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG---RSL  352
            SL+S+EDSDFTNLV     K N+IVL LD NQ ++D FLGA+V W ++    G    R+L
Sbjct  74   SLTSIEDSDFTNLVTGK--KPNEIVLQLDPNQTIEDDFLGAKVMWRSEASSQGSNSCRNL  131

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAA---GRWRSVPF  523
            VL+++K DKRRILRPYLQHIH V+D +EQR+R+L+L+MN   +S +       RWR VPF
Sbjct  132  VLKVRKADKRRILRPYLQHIHVVADELEQRKRDLRLYMNVDGSSGEDDGFRNARWRPVPF  191

Query  524  THPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            THPST ET+ ME+DLK+++KSDLE+FLK++QYY++LGRVW+RSFLLYGPS
Sbjct  192  THPSTLETISMEADLKSKIKSDLESFLKARQYYNRLGRVWKRSFLLYGPS  241



>ref|XP_006397194.1| hypothetical protein EUTSA_v10028615mg [Eutrema salsugineum]
 gb|ESQ38647.1| hypothetical protein EUTSA_v10028615mg [Eutrema salsugineum]
Length=488

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 170/225 (76%), Gaps = 5/225 (2%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V   VR+ L+++ L++ ++KW   I D  HV+QF+KVP+ N+N QENQLY KV+ Y+NSL
Sbjct  17   VLFLVRIVLFKTGLIYMVKKWKRTIFDLFHVYQFYKVPEFNENVQENQLYGKVYAYLNSL  76

Query  188  SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrik  367
            SS+E+SDFTNL      K N+I+L LD NQVV D+FLGARV W+N   + G R+ VL+I+
Sbjct  77   SSIENSDFTNLFTGK--KPNEILLRLDRNQVVGDEFLGARVCWINGEDEDGQRNFVLKIR  134

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAA---GRWRSVPFTHPST  538
            K DKRRIL PYLQHIHTVSD ++QR  ELKLFMN  +  D       GRWRS+ F HP T
Sbjct  135  KADKRRILGPYLQHIHTVSDELQQRNTELKLFMNVGIDGDGKRKMKHGRWRSISFNHPCT  194

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             +++ ME+DLKN+VKSDLE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  195  LDSIAMEADLKNKVKSDLESFLKGKQYYNRLGRVWKRSYLLYGPS  239



>ref|XP_009334380.1| PREDICTED: 26S protease regulatory subunit 8 homolog [Pyrus x 
bretschneideri]
Length=482

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 175/225 (78%), Gaps = 8/225 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + +F A+R+ LYR+ LV+ ++KW  W +D  HV+Q FKVP+ N++ QENQLY +V  Y+N
Sbjct  14   ICIFVAIRVALYRTGLVYIVKKWWWWFEDCFHVYQSFKVPKFNESMQENQLYGRVTDYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW-MNKVHDGGGRSLVl  358
            SL+S+E+SDFTNLV     K N+IVL LD NQ ++D FLGA+V W +     GG R+LVL
Sbjct  74   SLTSIEESDFTNLVTGK--KPNEIVLQLDPNQTIEDDFLGAKVIWQIEGSGAGGSRNLVL  131

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            +++K DKRRILRPYLQHIH V+D +EQ++REL+L+MN      D+    W+ VPFTHPST
Sbjct  132  KVRKADKRRILRPYLQHIHVVADELEQKKRELRLYMNV-----DAPDRAWKPVPFTHPST  186

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             ET+ MESDLK++VKSDLE+FLK++QYYH+LGRVW+RSFLLYGPS
Sbjct  187  LETISMESDLKSKVKSDLESFLKAKQYYHRLGRVWKRSFLLYGPS  231



>ref|XP_009116854.1| PREDICTED: probable mitochondrial chaperone bcs1 [Brassica rapa]
Length=483

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 172/218 (79%), Gaps = 4/218 (2%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            VR+ L+++ L++ +++W   I D  HV+QF++VP+ N N QENQLYR+V  Y+NSLSS+E
Sbjct  21   VRVVLFKTGLIYTVKQWRMKIVDWFHVYQFYRVPEFNDNLQENQLYRRVHAYLNSLSSIE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            +SD+TNL   A  KSN+I+L LD NQV+ D+FLGARV W+N   + G RS VL+I+K DK
Sbjct  81   NSDYTNLF--AGRKSNEIILRLDRNQVIGDEFLGARVCWINGEDEDGSRSFVLKIRKADK  138

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            RRIL  YL HIHTVS+ +EQR +E KLFMN  +A ++   GRWRS+PFTHP TF+ + ME
Sbjct  139  RRILGSYLNHIHTVSEELEQRNKEPKLFMN--VAGNEEKIGRWRSIPFTHPCTFDNIAME  196

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +DLK++VKSDLE+FLK +Q+Y++LGRVW+RS+LLYGPS
Sbjct  197  ADLKDKVKSDLESFLKGKQFYNRLGRVWKRSYLLYGPS  234



>ref|NP_182185.2| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEC10730.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=491

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 172/230 (75%), Gaps = 8/230 (3%)
 Frame = +2

Query  2    VSVFAA--VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVY  175
            VS FA   VR+ L+++ L++ ++ W   I D  HV+QF+KVP+ N N QEN LY+KV++Y
Sbjct  13   VSTFALFLVRILLFKTGLIYMVKLWRRKIIDWFHVYQFYKVPEFNDNVQENHLYQKVYMY  72

Query  176  VNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLV  355
            +NSLSS+E+SDFTNL      KSN+I+L LD NQVV D+FLGARV W+N   + G R+ V
Sbjct  73   LNSLSSIENSDFTNLFTGK--KSNEIILRLDRNQVVGDEFLGARVCWINGEDEDGARNFV  130

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRS----LASDDSAAGRWRSVPF  523
            L+I+K DKRRIL  YLQHIHTVSD +EQR  ELKLF+N      L       GRWRS+PF
Sbjct  131  LKIRKADKRRILGSYLQHIHTVSDELEQRNTELKLFINVGIDDHLNKKKKKNGRWRSIPF  190

Query  524  THPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             HP TF+ + ME+DLKN+VKSDLE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  191  DHPCTFDNIAMETDLKNKVKSDLESFLKGKQYYNRLGRVWKRSYLLYGPS  240



>emb|CDX71701.1| BnaC08g31730D [Brassica napus]
Length=483

 Score =   253 bits (647),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 168/212 (79%), Gaps = 4/212 (2%)
 Frame = +2

Query  38   RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  217
            ++ L++ +++W   I D  HV+QF++VP+ N N QENQLYR+V+ Y+NSLSS+E+SD+TN
Sbjct  27   KTGLIYTVKQWRRKIFDWFHVYQFYRVPEFNDNLQENQLYRRVYAYLNSLSSIENSDYTN  86

Query  218  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilrP  397
            L   A  KSN+I+L LD NQV+ D+FLGARV W+N   + G RS VL+I+K DKRRIL  
Sbjct  87   LF--AGRKSNEIILRLDRNQVIGDEFLGARVCWINGEDEDGSRSFVLKIRKADKRRILGS  144

Query  398  YLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNR  577
            YL HIHTVS+ +EQR +ELKLFMN  +A +D   GRWRS+PFTHP TF+ + ME+DLK +
Sbjct  145  YLNHIHTVSEELEQRNKELKLFMN--VAGNDEKIGRWRSIPFTHPCTFDNIAMEADLKEK  202

Query  578  VKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            VKSDLE+FLK +Q+Y++LGRVW+RS+LLYGPS
Sbjct  203  VKSDLESFLKGKQFYNRLGRVWKRSYLLYGPS  234



>ref|XP_010267472.1| PREDICTED: mitochondrial chaperone BCS1-like [Nelumbo nucifera]
Length=485

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 173/228 (76%), Gaps = 9/228 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
              VF  +RL L  +AL+F L+K    I+D+ HV+QF+KVP+ NQ+ QENQLYRKV  Y++
Sbjct  14   AGVFFVLRLVLSGTALLFLLKKLCQSIEDRCHVYQFYKVPEFNQSYQENQLYRKVSTYLS  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG----RS  349
            SL+S+EDS F NL +    KSN+I L LD NQ VQD FLGARVSW ++    G     R+
Sbjct  74   SLASIEDSHFANLFSGK--KSNEIALQLDSNQTVQDIFLGARVSWRSEEKREGNNTICRT  131

Query  350  LVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTH  529
             VL+I+K+DKRRILRPYLQHIH+VSD IEQRR+E+KL+ N      +   GRW  VPFTH
Sbjct  132  FVLKIRKEDKRRILRPYLQHIHSVSDEIEQRRKEVKLYTN---TETEHRHGRWSCVPFTH  188

Query  530  PSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            PST +TV M+SD+KN+VKSDLE+FLKS+QYYH+LGRVW+RS+LLYGPS
Sbjct  189  PSTLDTVAMDSDIKNKVKSDLESFLKSKQYYHRLGRVWKRSYLLYGPS  236



>ref|XP_002533329.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF29050.1| ATP binding protein, putative [Ricinus communis]
Length=480

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 170/212 (80%), Gaps = 8/212 (4%)
 Frame = +2

Query  38   RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  217
            ++ L+F  +K     ++  HV+QFFKVP+ N++ Q+NQL+RKV VY+NSLSS+EDSDFTN
Sbjct  27   KTGLIFLTKKLWRICEEWFHVYQFFKVPEFNESMQDNQLHRKVSVYLNSLSSIEDSDFTN  86

Query  218  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilrP  397
            L      KSN+I+L LD NQV+ D FLG R+SW+N+V+ G  R+LVL+I+K DKRRILRP
Sbjct  87   LFTGK--KSNEIILRLDPNQVIDDYFLGTRISWINEVNSGATRTLVLKIRKSDKRRILRP  144

Query  398  YLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNR  577
            YLQHIHTVSD +EQ+R ELKL+MN     +    GRWR VPFTHPSTFET+ MESDLK +
Sbjct  145  YLQHIHTVSDELEQKR-ELKLYMN-----NHHQNGRWRFVPFTHPSTFETIAMESDLKTK  198

Query  578  VKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +KSDLE+FLK++QYYH+LGRVW+RS+LLYGPS
Sbjct  199  LKSDLESFLKAKQYYHRLGRVWKRSYLLYGPS  230



>ref|XP_008376180.1| PREDICTED: mitochondrial chaperone BCS1 [Malus domestica]
Length=482

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 173/225 (77%), Gaps = 8/225 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + +F A+R+ LYR+ LV+ ++KW    +D  HV+Q FKVP+ N++ QENQLY +V  Y+N
Sbjct  14   ICIFVAIRVALYRTGLVYIVKKWWLRFEDCFHVYQSFKVPKFNESMQENQLYGRVTDYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSLVl  358
            SL+S+E+SDFTNLV       N+IVL LD NQ ++D FLGA+V W  +    GG R+LVL
Sbjct  74   SLTSIEESDFTNLVTGK--NPNEIVLQLDPNQTIEDDFLGAKVIWQTEGSGAGGSRNLVL  131

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            +++K DKRRILRPYLQHIH V+D +EQ++RELKL+MN      D+    W+ VPFTHPST
Sbjct  132  KVRKADKRRILRPYLQHIHVVADELEQKKRELKLYMNV-----DAPDRAWKPVPFTHPST  186

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             ET+ MESDLK++VKSDLE+FLK++QYYH+LGRVW+RSFLLYGPS
Sbjct  187  LETISMESDLKSKVKSDLESFLKAKQYYHRLGRVWKRSFLLYGPS  231



>ref|XP_006294099.1| hypothetical protein CARUB_v10023091mg [Capsella rubella]
 gb|EOA26997.1| hypothetical protein CARUB_v10023091mg [Capsella rubella]
Length=489

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 168/219 (77%), Gaps = 3/219 (1%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R+ L+++  ++ ++ W   + D  HV+QF+KVP+ N N QEN LYRKV+ Y+NSLSS+E
Sbjct  21   IRIALFKTGFIYMVKLWRRNLIDMFHVYQFYKVPEFNDNLQENHLYRKVYAYLNSLSSIE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            +SDFTNL      KSN+I+L LD NQVV D+FLGARV W+N   + G R  VL+I+K DK
Sbjct  81   NSDFTNLFTGK--KSNEIILRLDRNQVVGDEFLGARVCWINGHDEDGVRHFVLKIRKADK  138

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAA-GRWRSVPFTHPSTFETVVM  556
            RRIL  YLQHIHTVSD +EQR  +LKLFMN  + S++    GRWRS+PF HP TF+ + M
Sbjct  139  RRILGSYLQHIHTVSDELEQRNTDLKLFMNVDVLSNNKKKNGRWRSIPFDHPCTFDNIAM  198

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            E+DLKN+VKSDLE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  199  ETDLKNKVKSDLESFLKGKQYYNRLGRVWKRSYLLYGPS  237



>ref|XP_008233091.1| PREDICTED: mitochondrial chaperone BCS1 [Prunus mume]
Length=482

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 175/225 (78%), Gaps = 8/225 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V +F A+R+ LY++ LVF ++KW    +D  HV+Q FKVP+LN++ QEN LY KV  Y+N
Sbjct  14   VCIFVAIRVALYKTGLVFLVKKWWRRFEDCFHVYQSFKVPELNESMQENHLYGKVTDYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH-DGGGRSLVl  358
            SL+S+E+SDFTNLV     K N+IVL LD NQ ++D FLGA+V W      D   RSLVL
Sbjct  74   SLTSIEESDFTNLVTGK--KPNEIVLKLDRNQTIEDDFLGAKVLWETGASTDSTSRSLVL  131

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            +I+K DKRRILRPYLQHIH V+D +EQ++R+L+LFMN  + + + A   WR+VPFTHPST
Sbjct  132  KIRKADKRRILRPYLQHIHVVADELEQKKRDLRLFMN--VEAPNRA---WRAVPFTHPST  186

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             ET+ ME+DLK++VKSDLE+FLK++QYYH+LGRVW+RSFLLYGPS
Sbjct  187  LETITMEADLKSKVKSDLESFLKARQYYHRLGRVWKRSFLLYGPS  231



>ref|XP_007217940.1| hypothetical protein PRUPE_ppa005000mg [Prunus persica]
 gb|EMJ19139.1| hypothetical protein PRUPE_ppa005000mg [Prunus persica]
Length=482

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 172/225 (76%), Gaps = 8/225 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V +F A+R+ LY++ LVF ++KW    +D  HV+Q FKVP+ N++ QEN LY +V  Y+N
Sbjct  14   VCIFVAIRVALYKTGLVFLVKKWWRRFEDCFHVYQSFKVPEFNESMQENHLYGRVTDYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH-DGGGRSLVl  358
            SL+S+E+SDFTNLV     K N+IVL LD NQ ++D FLGA+V W      D   RSLVL
Sbjct  74   SLTSIEESDFTNLVTGK--KPNEIVLKLDRNQTIEDDFLGAKVLWETGASTDSTSRSLVL  131

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            +I+K DKRRILRPYLQHIH V+D +EQ++R+L+LFMN      D+    WR+VPFTHPST
Sbjct  132  KIRKADKRRILRPYLQHIHVVADELEQKKRDLRLFMNV-----DAPNRAWRAVPFTHPST  186

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             ET+ ME+DLK++VKSDLE+FLK++QYYH+LGRVW+RSFLLYGPS
Sbjct  187  LETITMEADLKSKVKSDLESFLKARQYYHRLGRVWKRSFLLYGPS  231



>emb|CDY57874.1| BnaA09g55560D [Brassica napus]
Length=708

 Score =   254 bits (648),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 172/218 (79%), Gaps = 4/218 (2%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            VR+ L+++ L++ +++W   I D  HV+QF++VP+ N N QENQLYR+V  Y+NSLSS+E
Sbjct  21   VRVVLFKTGLIYTVKQWRMKIVDWFHVYQFYRVPEFNDNLQENQLYRRVHAYLNSLSSIE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            +SD+TNL   A  KSN+I+L LD NQV+ D+FLGARV W+N   + G RS VL+I+K DK
Sbjct  81   NSDYTNLF--AGRKSNEIILRLDRNQVIGDEFLGARVCWINGEDEDGSRSFVLKIRKADK  138

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            RRIL  YL HIHTVS+ +EQR +E KLFMN  +A ++   GRWRS+PFTHP TF+ + ME
Sbjct  139  RRILGSYLNHIHTVSEELEQRNKEPKLFMN--VAGNEEKIGRWRSIPFTHPCTFDNIAME  196

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +DLK++VKSDLE+FLK +Q+Y++LGRVW+RS+LLYGPS
Sbjct  197  ADLKDKVKSDLESFLKGKQFYNRLGRVWKRSYLLYGPS  234



>gb|KJB09610.1| hypothetical protein B456_001G152500 [Gossypium raimondii]
Length=453

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 173/217 (80%), Gaps = 8/217 (4%)
 Frame = +2

Query  23   RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  202
            R+ L ++ L+F ++K     +D  HV+Q FKVP+ N++ Q NQLY KVFVY+NSL+S+ED
Sbjct  22   RVVLIKTGLIFTVKKKWRLFEDCFHVYQLFKVPKFNESMQRNQLYHKVFVYLNSLTSVED  81

Query  203  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkr  382
            SDFTNL      K N+I+L LD NQ+++D FLGA++ W+N+ ++     LVL+I+K DKR
Sbjct  82   SDFTNLFTGK--KPNEILLRLDPNQIIEDDFLGAKILWINEDNN-----LVLKIRKADKR  134

Query  383  rilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMES  562
            R+LRPYLQHIH++SD++++++R+LKL++N  +   D   GRWR VPFTHPSTFET+ MES
Sbjct  135  RVLRPYLQHIHSISDDLDEKKRDLKLYVN-VVGHGDDHKGRWRCVPFTHPSTFETIAMES  193

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            DLKN+VKSDLE+FLK++QYYH+LGRVW+RS+LLYGPS
Sbjct  194  DLKNKVKSDLESFLKAKQYYHRLGRVWKRSYLLYGPS  230



>gb|EYU38871.1| hypothetical protein MIMGU_mgv1a005433mg [Erythranthe guttata]
Length=484

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 180/230 (78%), Gaps = 15/230 (7%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQL-YRKVFVYV  178
            V +   VRLFL+R+AL++ +RKW +W++D++HVHQ F+VP+LN + Q+  L YR+V +YV
Sbjct  16   VCLMFIVRLFLHRTALIYVVRKWGEWVEDRVHVHQHFRVPELNDSTQQQNLFYRRVSLYV  75

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGG-----G  343
            NSL+SLEDSDFTNL   +  K NDI+L LDDNQ +Q+ FLGAR+SW+N++          
Sbjct  76   NSLASLEDSDFTNLF--SGRKPNDILLSLDDNQSIQEVFLGARISWVNQIERDARNQVVS  133

Query  344  RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPF  523
            R+ V+RIKK+DKRR+L+PYLQHIHTVSD+IEQR +EL+++ N S        GRW+SV F
Sbjct  134  RNFVMRIKKRDKRRVLKPYLQHIHTVSDDIEQRGKELRIYNNGS-------NGRWKSVLF  186

Query  524  THPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             HP++F+++V++ D+K ++++DLE F KS+QYYHKLGRVW+RS+LLYGPS
Sbjct  187  NHPASFDSLVIDPDVKAKIRNDLEMFQKSKQYYHKLGRVWKRSYLLYGPS  236



>ref|XP_007051474.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOX95631.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=479

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 176/227 (78%), Gaps = 13/227 (6%)
 Frame = +2

Query  8    VFAAVRLFLYR-----SALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFV  172
            + A + LFL+R     + L++ ++K   +I D  HV+QFFKV + N++ Q NQLY KV V
Sbjct  12   LIAFISLFLFRVVLIKTGLIYIVKKKWCFIQDCFHVYQFFKVSEFNESMQRNQLYHKVLV  71

Query  173  YVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSL  352
            Y+NSL+S+EDSDFTNL      K N+IVL LD NQV++D FLGA++ W+N+      ++L
Sbjct  72   YLNSLTSIEDSDFTNLFTGK--KPNEIVLRLDRNQVIEDDFLGAKIFWINE-----DKTL  124

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            VL+I+K DKRR+LRPYLQHIHTV D +++++R+LKL+MN     DD   GRWRSVPFTHP
Sbjct  125  VLKIRKADKRRVLRPYLQHIHTVFDELDEKKRDLKLYMNVRHHHDDQN-GRWRSVPFTHP  183

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            STFET+ MESDLKN+VKSDL++FLK++QYYH+LGRVW+RS+LLYGPS
Sbjct  184  STFETIAMESDLKNKVKSDLDSFLKAKQYYHRLGRVWKRSYLLYGPS  230



>ref|XP_010100693.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXB83855.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=485

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 169/227 (74%), Gaps = 5/227 (2%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V     VR+ LYR+ LV+ ++KW    +D  HV+Q FKVP+ N   QENQLYR+V  Y+N
Sbjct  15   VCGLVLVRILLYRTGLVYIVKKWWRAFEDCFHVYQTFKVPEFNDAMQENQLYRRVGDYLN  74

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN--KVHDGGGRSLV  355
            SL S+EDSDFTNLV  A+ +  +IVL LD NQ ++D FLGA++ W+N  +      RS V
Sbjct  75   SLQSVEDSDFTNLV--ASKRPGEIVLKLDRNQRIEDFFLGAKLVWLNEERGERNASRSFV  132

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHP  532
            L+I+K DKRRILRPYL HIH V+D +EQR+R+LKL+MN    +  D   GRWRS PF HP
Sbjct  133  LKIRKADKRRILRPYLNHIHAVADEVEQRKRDLKLYMNLGGGNLCDRGGGRWRSAPFAHP  192

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            STFET+ ME+DLK++VKSDLE F+K++QYYH+LGRVW+RS+LLYGPS
Sbjct  193  STFETITMEADLKSKVKSDLENFVKAKQYYHRLGRVWKRSYLLYGPS  239



>ref|XP_002262724.1| PREDICTED: probable mitochondrial chaperone bcs1 [Vitis vinifera]
Length=462

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 163/216 (75%), Gaps = 11/216 (5%)
 Frame = +2

Query  26   LFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  205
            L L    +  AL+KWS  + D    +Q FKVP+ N+N Q+N LYRKV VY+NSL +LEDS
Sbjct  10   LALVLGLVAVALKKWSR-VGDWFQAYQLFKVPEFNENMQDNYLYRKVSVYINSLVALEDS  68

Query  206  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrr  385
            DFTNL +    K+N+IVL LD NQ V D FLGARVSW N  H    R+ VL+I+KKDKRR
Sbjct  69   DFTNLFSGK--KANEIVLALDPNQTVHDTFLGARVSWTN-AHANSCRTFVLKIRKKDKRR  125

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            ILRPYLQHIH+V D  EQR+RE+ L+MN        A GRWRSVPF+HPST ET+ M+SD
Sbjct  126  ILRPYLQHIHSVFDEFEQRKREVSLYMN-------GADGRWRSVPFSHPSTLETIAMDSD  178

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LKNRVKSDLE+FLKS+QYYH+LGRVW+RSFLLYGPS
Sbjct  179  LKNRVKSDLESFLKSKQYYHRLGRVWKRSFLLYGPS  214



>ref|XP_009761416.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana sylvestris]
Length=476

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 177/227 (78%), Gaps = 7/227 (3%)
 Frame = +2

Query  2    VSVFAAVRL--FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVY  175
            +++ A+  L  F+ +++LV  L+KW    +D  +V+QF++VPQ N N QENQLYRKV  Y
Sbjct  6    IAIIASCFLLKFVLKTSLVQILKKWWRLFEDGCYVYQFYRVPQFNHNMQENQLYRKVCTY  65

Query  176  VNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSL  352
            +NSL  +EDSDFTNL   +  KSN+I L LD NQ+V D FL ARV W+N+  +  G +SL
Sbjct  66   LNSLPCVEDSDFTNLF--SGDKSNEINLVLDSNQIVVDNFLCARVCWINEQDENTGLKSL  123

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            V++I+K DKRRIL+PYLQHIH+V D IEQR++E++LF+N  + ++    GRWRSVPFTHP
Sbjct  124  VMKIRKNDKRRILQPYLQHIHSVFDEIEQRKKEVRLFVN--VDNEPLRNGRWRSVPFTHP  181

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +TF+T+VM++DLKN+VKSDLE F KS+QYYH+LG+VW+RS+LLYGPS
Sbjct  182  ATFDTIVMDADLKNKVKSDLENFQKSKQYYHRLGKVWKRSYLLYGPS  228



>ref|XP_009588603.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana tomentosiformis]
Length=476

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 176/227 (78%), Gaps = 7/227 (3%)
 Frame = +2

Query  2    VSVFAAVRLF--LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVY  175
            +++ A+  L   + +++LV  ++KW    +D  +V+QF++VPQ N N QENQLY+KV  Y
Sbjct  6    IAIIASCFLLKLILKTSLVQIMKKWWQLFEDGCYVYQFYRVPQFNHNMQENQLYKKVCTY  65

Query  176  VNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSL  352
            +NSL   EDSDFTNL   +  KSN+I L LD NQ+V D FLGARV W+N+  +  G +SL
Sbjct  66   LNSLPCAEDSDFTNLF--SGDKSNEINLVLDSNQIVVDNFLGARVCWINEQDENTGLKSL  123

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            V++I+K DKRRIL+PYLQHIH+V D IEQR++E+ LF+N  + ++    GRWRSVPFTHP
Sbjct  124  VMKIRKNDKRRILQPYLQHIHSVFDEIEQRKKEVTLFVN--VDNEPQRNGRWRSVPFTHP  181

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +TFET+VM++DLKN+VKSDL+ FLKS+QYY++LG++W+RS+LLYGPS
Sbjct  182  ATFETIVMDTDLKNKVKSDLDNFLKSKQYYNRLGKIWKRSYLLYGPS  228



>ref|XP_006350498.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum tuberosum]
Length=476

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 177/216 (82%), Gaps = 5/216 (2%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
             L +++L+  ++KW  +++D  +V+QF++VPQ N N QENQLYRKV  Y+NSL  +EDSD
Sbjct  17   ILLKTSLLQIVKKWWRFLEDGCYVYQFYRVPQFNHNMQENQLYRKVCTYLNSLPCVEDSD  76

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSLVlrikkkdkrr  385
            FTNL+  +  KSN+I L LD NQ+V D+FL ARV W+N+ ++  G +SLV++I+KKDKRR
Sbjct  77   FTNLI--SGDKSNEISLVLDSNQIVVDKFLSARVFWINEKNEFTGLKSLVMKIRKKDKRR  134

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            IL+PYLQ+IH+V D IEQR++E++LF+N  + ++    GRWRSVPFTHP+TF+TVVM++D
Sbjct  135  ILQPYLQYIHSVFDEIEQRKKEVRLFVN--VDNEPQRNGRWRSVPFTHPATFDTVVMDTD  192

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LKN+VKSDLE+F KS+QYYH+LG+VW+RS+LLYGPS
Sbjct  193  LKNKVKSDLESFQKSKQYYHRLGKVWKRSYLLYGPS  228



>ref|XP_004234999.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum lycopersicum]
Length=474

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 176/216 (81%), Gaps = 5/216 (2%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
             L +++++  ++KW  +++D  +V+QF++VPQ N N QENQLYRKV  Y+NSL  +EDSD
Sbjct  17   ILLKTSVLQIVKKWWRFLEDGCYVYQFYRVPQFNHNMQENQLYRKVSTYLNSLPCVEDSD  76

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSLVlrikkkdkrr  385
            FTNL+  +  KSN+I L LD NQ+V D+FLGARV W+NK  +  G +SLV++I+KKDKRR
Sbjct  77   FTNLI--SGDKSNEISLVLDANQMVVDKFLGARVFWINKKDEFTGLKSLVMKIRKKDKRR  134

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            IL+PYLQ+IH+V D IEQR++E++LF+N  + ++    GRWRSVPF HP+TF+TVVM++D
Sbjct  135  ILQPYLQYIHSVFDEIEQRKKEVRLFVN--VDNEPQRNGRWRSVPFAHPATFDTVVMDTD  192

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LKN+VKSDLE+F KS+QYYH+LGRVW+RS+LLYGPS
Sbjct  193  LKNKVKSDLESFQKSKQYYHRLGRVWKRSYLLYGPS  228



>ref|XP_010252452.1| PREDICTED: probable mitochondrial chaperone bcs1 [Nelumbo nucifera]
Length=486

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 169/227 (74%), Gaps = 8/227 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
              VF   R+ L  +AL F  +KW   IDD  HV+QF+K+P+ N+N QENQLYRKV  YV+
Sbjct  14   AGVFLVFRIILSGTALWFLFKKWCRTIDDWCHVYQFYKIPEFNRNFQENQLYRKVSTYVS  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG---RSL  352
            SL+S+EDSD+ NL +    K N+I L LD NQ+V D FLGARVSWM++    G    ++ 
Sbjct  74   SLASIEDSDYANLFSGK--KLNEITLELDTNQLVYDTFLGARVSWMSEEKREGNSRCKTF  131

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            VL+IKKKDKRRILRPYLQHIH+V D IEQRR+E+KL+ N      +   GRW S+PFTHP
Sbjct  132  VLKIKKKDKRRILRPYLQHIHSVFDEIEQRRKEVKLYTNTETVHRN---GRWSSIPFTHP  188

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ST +TV M+ D+KN+VKSDLE+FLKS+QYYH+LGR W+RS+LLYGPS
Sbjct  189  STLDTVAMDPDIKNKVKSDLESFLKSKQYYHRLGRAWKRSYLLYGPS  235



>ref|XP_009142622.1| PREDICTED: mitochondrial chaperone BCS1 [Brassica rapa]
Length=468

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 164/223 (74%), Gaps = 11/223 (5%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V   VR+ L+++ L+  ++KW   I D  HV+Q +KVP+ N+  QEN LYRKV+ Y+NSL
Sbjct  13   VLFLVRIVLFKTGLIHMVKKWRRTIVDLFHVYQHYKVPEFNE-VQENHLYRKVYTYLNSL  71

Query  188  SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrik  367
            SS+EDSDFTNL      KSN+IVL LD NQVV D+FLGARV W N   + G +S VL+I+
Sbjct  72   SSIEDSDFTNLFTGK--KSNEIVLRLDRNQVVGDEFLGARVCWTNGEDENGAKSFVLKIR  129

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELK-LFMNRSLASDDSAAGRWRSVPFTHPSTFE  544
              DKRRIL PYLQHIHTV+D +EQR  ELK LF+N           RWRS+PF HP TF+
Sbjct  130  IADKRRILGPYLQHIHTVADELEQRNTELKKLFIN-------VKNKRWRSIPFNHPCTFD  182

Query  545  TVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             + ME+DLKN+VKSDLE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  183  NIAMETDLKNKVKSDLESFLKGKQYYNRLGRVWKRSYLLYGPS  225



>ref|XP_002320886.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE99201.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=488

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 170/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  38   RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  217
            ++ L++  +KW   I+D  HV+QFFKVP+ N++ QENQLY KV +Y++SL+S+EDSD+TN
Sbjct  27   KTGLIYITKKWWRSIEDCFHVYQFFKVPEFNESMQENQLYHKVSIYLSSLASMEDSDYTN  86

Query  218  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN--KVHDGGGRSLVlrikkkdkrril  391
            L   A  KSNDI+L LD NQV+ D FLGARVSW+N  K      R+LVL++++ DKRRIL
Sbjct  87   LF--AGKKSNDIILHLDPNQVIDDYFLGARVSWINDDKSDTTCCRTLVLKVRRADKRRIL  144

Query  392  rPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLK  571
            RPYLQHIH  SD +EQ+++ LKL++N  + S +    RWRSVPF HPSTF+T+VM+SDLK
Sbjct  145  RPYLQHIHITSDEVEQKKKGLKLYIN--IGSHEQNR-RWRSVPFNHPSTFDTIVMDSDLK  201

Query  572  NRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            N++KSDLE+FLK++QYYH+LGR W+RS+LLYGPS
Sbjct  202  NKLKSDLESFLKTKQYYHRLGRAWKRSYLLYGPS  235



>emb|CDY41542.1| BnaC04g00800D [Brassica napus]
Length=470

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 166/224 (74%), Gaps = 12/224 (5%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V   VR+ L+++ L+  ++KW   I D  HV+Q +KVP+ N   QEN LYRKV+ Y+NSL
Sbjct  13   VLFLVRIVLFKTGLIHMVKKWRRKIVDLFHVYQHYKVPEFN-GIQENHLYRKVYTYLNSL  71

Query  188  SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN-KVHDGGGRSLVlri  364
            SS+EDSDFTNL      KSN+IVL LD NQVV D+FLGARV W N +  + G +S VL+I
Sbjct  72   SSIEDSDFTNLFTGK--KSNEIVLRLDRNQVVGDEFLGARVCWTNGEDEEDGAKSFVLKI  129

Query  365  kkkdkrrilrPYLQHIHTVSDNIEQRRRELK-LFMNRSLASDDSAAGRWRSVPFTHPSTF  541
            +K DKRRIL PYLQHIHTVSD +EQR  ELK LF+N          GRWRS+PF HP TF
Sbjct  130  RKADKRRILGPYLQHIHTVSDELEQRSTELKRLFIN-------VVNGRWRSIPFNHPCTF  182

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            + + ME+DLKN+VKSDLE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  183  DNIAMETDLKNKVKSDLESFLKGKQYYNRLGRVWKRSYLLYGPS  226



>ref|XP_011038785.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Populus euphratica]
Length=488

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 171/215 (80%), Gaps = 7/215 (3%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  214
            +++ L++  +KW   I+D  HV+QFFKVP+ N++ QENQLY KV +Y++SL+S+EDSD+T
Sbjct  26   FKTGLIYITKKWWRSIEDCFHVYQFFKVPEFNESMQENQLYHKVSIYLSSLASMEDSDYT  85

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDG--GGRSLVlrikkkdkrri  388
            NL   +  KSNDI+L LD NQV+ D FLGARVSW+N  +      R+LVL++++ DKRRI
Sbjct  86   NLF--SGKKSNDIILHLDPNQVIDDYFLGARVSWINDDNSDTTCCRTLVLKVRRADKRRI  143

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDL  568
            LRPYLQHIH  SD +EQ+++ LKL++N  + S +    RWRSVPF HPSTF+T+VM+SDL
Sbjct  144  LRPYLQHIHITSDEVEQKKKGLKLYIN--IGSHEQNR-RWRSVPFNHPSTFDTIVMDSDL  200

Query  569  KNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            KN++KSDLE+FLK++QYYH+LGR W+RS+LLYGPS
Sbjct  201  KNKLKSDLESFLKTKQYYHRLGRAWKRSYLLYGPS  235



>gb|AAD20172.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL77654.1| At2g46620/F13A10.15 [Arabidopsis thaliana]
 gb|AAN28905.1| At2g46620/F13A10.15 [Arabidopsis thaliana]
Length=459

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 157/208 (75%), Gaps = 10/208 (5%)
 Frame = +2

Query  62   RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVK  241
            RK  DW     HV+QF+KVP+ N N QEN LY+KV++Y+NSLSS+E+SDFTNL      K
Sbjct  7    RKIIDW----FHVYQFYKVPEFNDNVQENHLYQKVYMYLNSLSSIENSDFTNLFTGK--K  60

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTV  421
            SN+I+L LD NQVV D+FLGARV W+N   + G R+ VL+I+K DKRRIL  YLQHIHTV
Sbjct  61   SNEIILRLDRNQVVGDEFLGARVCWINGEDEDGARNFVLKIRKADKRRILGSYLQHIHTV  120

Query  422  SDNIEQRRRELKLFMNRS----LASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSD  589
            SD +EQR  ELKLF+N      L       GRWRS+PF HP TF+ + ME+DLKN+VKSD
Sbjct  121  SDELEQRNTELKLFINVGIDDHLNKKKKKNGRWRSIPFDHPCTFDNIAMETDLKNKVKSD  180

Query  590  LETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LE+FLK +QYY++LGRVW+RS+LLYGPS
Sbjct  181  LESFLKGKQYYNRLGRVWKRSYLLYGPS  208



>ref|XP_011023131.1| PREDICTED: putative cell division cycle ATPase [Populus euphratica]
Length=488

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 166/215 (77%), Gaps = 7/215 (3%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  214
            +++ L++  +KW   I+D  HV+QFFKVP+ N+N Q+N LYRKV +Y++S++S+EDSDFT
Sbjct  26   FKTGLIYITKKWWRSIEDCFHVYQFFKVPEFNENMQKNHLYRKVSIYLSSIASIEDSDFT  85

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGR--SLVlrikkkdkrri  388
            NL      K +DIVL LD NQV+ D FLGARVSW+N+  +   R  + VL+I++ DKR+I
Sbjct  86   NLFTGK--KPHDIVLHLDPNQVIDDYFLGARVSWINQEKNDTNRCRTFVLKIRRTDKRKI  143

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDL  568
            LRPYLQHIH  SD +EQ+++++KL++N         +G WRSVPF HPSTF+T+ MESDL
Sbjct  144  LRPYLQHIHITSDELEQKKKDVKLYINND---SPGQSGHWRSVPFKHPSTFDTIAMESDL  200

Query  569  KNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            KN++KSDLE+FLK++ YYH+LGR W+RS+LLYGPS
Sbjct  201  KNKLKSDLESFLKAKHYYHRLGRAWKRSYLLYGPS  235



>ref|XP_011094241.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Sesamum indicum]
Length=478

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 174/225 (77%), Gaps = 18/225 (8%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNA-QENQLYRKVFVYVNSL-SS  193
            VRLFL+R+AL+  +RKW+DW+DD+LHVHQ FK+P+ N +  QENQ YR+V +Y+NSL  +
Sbjct  20   VRLFLHRTALIHVVRKWADWVDDRLHVHQHFKIPEFNDSTLQENQFYRRVSLYLNSLLPA  79

Query  194  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKV-----HDGGGRSLVl  358
            LEDSDFTNL+  A  K NDI+L  DD+QV++D FLGAR+SW+N V     +    RS +L
Sbjct  80   LEDSDFTNLL--AGKKPNDILLSPDDHQVIRDTFLGARLSWLNNVLRDDTNQVVSRSFML  137

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            R KKKDKRRIL PY QHIHTVSD+IEQR+ EL++           + G+W+SVPF HP+T
Sbjct  138  RFKKKDKRRILEPYFQHIHTVSDDIEQRK-ELRIHY--------YSNGKWKSVPFNHPAT  188

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            F+++ ++ DLK +++S+LETFL S+QYY+KLGRVW+RS+LLYGPS
Sbjct  189  FDSLAIDPDLKTKIQSELETFLNSKQYYNKLGRVWKRSYLLYGPS  233



>emb|CDX80032.1| BnaA05g01240D [Brassica napus]
Length=715

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 165/223 (74%), Gaps = 11/223 (5%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V   VR+ L+++ L+  ++KW   I D  HV+Q +KVP+ N+  QEN LYRKV+ Y+NSL
Sbjct  13   VLFLVRIVLFKTGLIHMVKKWRRTIVDLFHVYQHYKVPEFNE-VQENHLYRKVYTYLNSL  71

Query  188  SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrik  367
            SS+EDSDFTNL      KSNDIVL LD NQVV D+FLGARV W N   + G +S VL+I+
Sbjct  72   SSIEDSDFTNLFTGK--KSNDIVLRLDRNQVVGDEFLGARVCWTNGEDENGAKSFVLKIR  129

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELK-LFMNRSLASDDSAAGRWRSVPFTHPSTFE  544
            K DKRRIL PYLQHIHTV+D +EQR  ELK LF+N           RWRS+PF HP TF+
Sbjct  130  KADKRRILGPYLQHIHTVADELEQRNTELKKLFIN-------VKNKRWRSIPFNHPCTFD  182

Query  545  TVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             + ME+DLKN+VKSDLE+FLK +QY+++LGRVW+RS+LLYGPS
Sbjct  183  NIAMETDLKNKVKSDLESFLKGKQYHNRLGRVWKRSYLLYGPS  225



>ref|XP_004133798.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Cucumis 
sativus]
 gb|KGN56399.1| hypothetical protein Csa_3G119330 [Cucumis sativus]
Length=481

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 168/219 (77%), Gaps = 7/219 (3%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R+ L+R+ L+F ++KW   ++D  HV+Q F++P+ N+ +Q N LYRKV  Y+ SLSSLE
Sbjct  21   LRILLFRTGLIFLVKKWWANLEDCFHVYQSFRIPEFNETSQHNHLYRKVSAYLTSLSSLE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            DSDFTNL+     K NDI+L LD NQ VQD FLGA+V W N+    G R+ VLRI+K DK
Sbjct  81   DSDFTNLITGN--KPNDIILRLDSNQTVQDNFLGAKVFWTNE--QKGSRNFVLRIRKADK  136

Query  380  rrilrPYLQHIHTVS-DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            RRILRPYLQHIHT++ D  EQR+ +LKLFMN     ++ +  RW+S+ F HPSTF+++ M
Sbjct  137  RRILRPYLQHIHTLTADENEQRKGDLKLFMNSK--PNNHSDTRWKSIQFKHPSTFDSIAM  194

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            E+DLK +VKSDLE+FLKS+QYYH+LGRVW+RS+LLYGPS
Sbjct  195  ETDLKEKVKSDLESFLKSKQYYHRLGRVWKRSYLLYGPS  233



>gb|KJB24545.1| hypothetical protein B456_004G150200 [Gossypium raimondii]
Length=467

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 166/218 (76%), Gaps = 13/218 (6%)
 Frame = +2

Query  23   RLFLYRSALVFAL-RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            R+ L ++  +F   RKW   I D  HV+QFFKVP+ +++ Q NQLY KV +Y++SL+SLE
Sbjct  22   RVILIKTGFIFTFKRKWR-CIKDCFHVYQFFKVPEFSESMQRNQLYYKVLLYLHSLASLE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            DSDFTNL   A  K N+I+L LD NQ+++D FLGA++ W+N+      ++LVL+I+K DK
Sbjct  81   DSDFTNLF--AGRKPNEILLRLDTNQIIEDDFLGAKMYWINQ-----DKNLVLKIRKSDK  133

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            RR+L+PYLQHIHTV D  + R+RELKL+MN      D   GRWRSVPFTHPSTFET  ME
Sbjct  134  RRVLQPYLQHIHTVFDEFDGRKRELKLYMNVV----DDQKGRWRSVPFTHPSTFETTAME  189

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            SDLK +VKSDL +FL+++QYYHKLGRVW+RS+LLYGPS
Sbjct  190  SDLKIKVKSDLVSFLRAKQYYHKLGRVWKRSYLLYGPS  227



>ref|XP_008437854.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, chloroplastic 
[Cucumis melo]
Length=481

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 169/219 (77%), Gaps = 7/219 (3%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R+ L+R+ L+F ++KW   ++D  HV+Q F++P+ N+ +Q N LYRKV  Y+ SLSSLE
Sbjct  21   LRILLFRTGLIFIVKKWWANLEDCFHVYQSFRIPEFNETSQHNHLYRKVSAYLTSLSSLE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            DSD+TNL+     K NDI+L LD NQ VQD FLGA+V W N+    G R+ VL+I+K DK
Sbjct  81   DSDYTNLITGN--KPNDIILRLDSNQTVQDNFLGAKVFWTNE--QNGSRNFVLKIRKADK  136

Query  380  rrilrPYLQHIHTVS-DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            RRILRPYLQHIHT++ D+ EQR+ +LKLFMN     ++ +  RW+S+ F HPSTF+++ M
Sbjct  137  RRILRPYLQHIHTLTADDNEQRKGDLKLFMNSK--PNNHSDTRWKSIQFKHPSTFDSIAM  194

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            E+DLK +VKSDLE+FLKS+QYYH+LGRVW+RS+LLYGPS
Sbjct  195  ETDLKEKVKSDLESFLKSKQYYHRLGRVWKRSYLLYGPS  233



>gb|KJB41595.1| hypothetical protein B456_007G110900 [Gossypium raimondii]
Length=481

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 167/218 (77%), Gaps = 8/218 (4%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R+ L ++ L++ ++K    I+D  HV+QFFKVP+ N+  Q NQLY KV VY+NSL+ +E
Sbjct  24   LRVVLIKTGLIYIVKKKWRSIEDCFHVYQFFKVPEFNEGMQRNQLYHKVLVYLNSLTFIE  83

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            DSDFTNL      K N+IVL LD NQ+++D FLGA++SW+N+      ++LVL+I+K DK
Sbjct  84   DSDFTNLFTGK--KPNEIVLHLDPNQIIEDDFLGAKISWINE-----DKTLVLKIRKADK  136

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            RR+LRPYLQHIH+VSD  + ++R LKL++N      D    RWRSVPFTHPS+FET+ ME
Sbjct  137  RRVLRPYLQHIHSVSDEFDDKKRGLKLYVNVVDHQGDRKE-RWRSVPFTHPSSFETIAME  195

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            SDLKN+VKSDL +F K++QYYH+LGRVW+RS+LLYGPS
Sbjct  196  SDLKNKVKSDLYSFAKAKQYYHRLGRVWKRSYLLYGPS  233



>ref|XP_011075926.1| PREDICTED: uncharacterized protein LOC105160305 [Sesamum indicum]
Length=489

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 168/226 (74%), Gaps = 6/226 (3%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + +  AV  FL  ++L+ +L+     ++ K +VHQF+KVP+ N N QENQLYRKV+ Y+N
Sbjct  13   IILLCAVLRFLSNTSLIHSLKNTCRSLEQKCYVHQFYKVPKFNDNMQENQLYRKVYTYLN  72

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM--NKVHDGGGRSLV  355
            SL  +EDSDF NL +S+  KS +I L LD+NQ + D+FLGAR+ W   N     G +SLV
Sbjct  73   SLPCVEDSDFANLFSSS--KSAEINLILDENQTIVDKFLGARLRWRIENSEKKNGVKSLV  130

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            L+++K DKRRIL PYLQHIH V D+IEQRR+E++LF+N  + ++    GRW S  FTHP+
Sbjct  131  LKVRKNDKRRILVPYLQHIHQVFDDIEQRRKEVRLFVN--VENELQRNGRWISTSFTHPA  188

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            T ET+VM+SDLK R+KSDLE F KS+QYYH+LGRVW+RS+LLYGP+
Sbjct  189  TMETIVMDSDLKTRIKSDLENFQKSRQYYHRLGRVWKRSYLLYGPA  234



>ref|XP_010322229.1| PREDICTED: uncharacterized protein LOC101262523 [Solanum lycopersicum]
Length=512

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            F+ +++++   +KW   ++DK +V+QF+KVPQ N N QENQLYRK+  Y+NSL  +EDSD
Sbjct  17   FVSKTSILHIFKKWLRLLEDKFYVYQFYKVPQFNHNMQENQLYRKISTYLNSLPCVEDSD  76

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSLVlrikkkdkrr  385
            FTNL + +  KSNDI L L+ +Q + D FLGAR+SW+N+  +  G RS VL+I++KDKR+
Sbjct  77   FTNLYSGS--KSNDINLVLNADQKIVDNFLGARISWINEKDEKTGVRSFVLKIRRKDKRQ  134

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG--RWRSVPFTHPSTFETVVME  559
            ILR YLQHIH+  D IEQRR+E++LF+N +  S+ +  G  RW SVPFTHP+TF+TVVME
Sbjct  135  ILRTYLQHIHSKFDEIEQRRKEVRLFVNVNDESNGNGNGNRRWISVPFTHPATFDTVVME  194

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             DLKN+VKSDLETFLKS+Q+Y+++GR+W+R++LL+GPS
Sbjct  195  QDLKNKVKSDLETFLKSKQHYNRIGRIWKRNYLLHGPS  232



>ref|XP_002515676.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46728.1| ATP binding protein, putative [Ricinus communis]
Length=487

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 175/226 (77%), Gaps = 6/226 (3%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + VF  +R FL+R++ +  L  +    +D  HV+QF+KVPQ N++ Q NQL+RKVF Y++
Sbjct  14   IPVFFLLR-FLFRTSFLQILVGYWRSFEDHFHVYQFYKVPQFNEHFQGNQLFRKVFTYLS  72

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKV--HDGGGRSLV  355
            SL ++EDSDFTNL +    KSNDI+L LD+ QV+QD+FL ARV W N+   ++ G R+LV
Sbjct  73   SLPAMEDSDFTNLFSGP--KSNDIILHLDEKQVIQDKFLSARVWWSNEKSENNNGQRTLV  130

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            L+++KKDK+RILRPYLQHI +  D IEQR++E+KL+MN  +  +    GRWR VPFTHP+
Sbjct  131  LKLRKKDKKRILRPYLQHILSAVDEIEQRKKEIKLYMNLEI-REPQGNGRWRWVPFTHPA  189

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            T +TVVM+ DLKN+VK+DLE+FLKS+QYYH+LGRVW+RS+LLYG S
Sbjct  190  TMDTVVMDGDLKNKVKADLESFLKSKQYYHRLGRVWKRSYLLYGAS  235



>gb|KJB19872.1| hypothetical protein B456_003G122600 [Gossypium raimondii]
Length=473

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 171/225 (76%), Gaps = 5/225 (2%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V +F  +R FL++++L+  L +    ++D LHVHQ ++VPQ N   QENQLY KV  Y+N
Sbjct  13   VGLFLILR-FLFKTSLLLILLQKFQCLEDWLHVHQLYRVPQFNHLFQENQLYVKVSTYLN  71

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW-MNKVHDGGGRSLVl  358
            SL SLEDSDFTNL   +  KSNDI+L LD +Q ++D FLGARVSW + K  +GG R LVL
Sbjct  72   SLPSLEDSDFTNLFTGS--KSNDILLHLDTDQTIRDVFLGARVSWTLEKSENGGARVLVL  129

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            R++K DKRRILRPYLQHI +V+ +I QR++E+KL MN    S     GRWRSVPF HP++
Sbjct  130  RLRKNDKRRILRPYLQHILSVAGDISQRKKEIKLRMNVDSPSS-GENGRWRSVPFNHPAS  188

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            F+T+VM+ DLKN+VK+DLE FLKS+Q+Y +LGRVW+RS+LLYGPS
Sbjct  189  FDTLVMDVDLKNKVKADLEMFLKSKQFYQRLGRVWKRSYLLYGPS  233



>ref|XP_011093096.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Sesamum indicum]
Length=468

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 167/222 (75%), Gaps = 22/222 (10%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNA-QENQLYRKVFVYVNSLSSL  196
            VRLFL+R+AL++ +R+  +W++D++HVHQ F+VP+ N +  QEN  YR++ +Y+NSL SL
Sbjct  22   VRLFLHRTALIYVVRRCVEWVEDRVHVHQHFRVPEFNDSTHQENLFYRRLSLYLNSLPSL  81

Query  197  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKV---HDGGGRSLVlrik  367
            EDSDFTNL   + +  NDI+L LDD+Q V D FLGAR+SW+N++   H    +       
Sbjct  82   EDSDFTNLF--SGINPNDILLSLDDHQQVHDIFLGARLSWLNQIVRDHQNQKKK------  133

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFET  547
              DKRRIL+PYLQHIH VSD+IEQR +EL++         + + G+W+SVPF HP+TF++
Sbjct  134  --DKRRILKPYLQHIHAVSDDIEQRGKELRIH--------NHSNGKWKSVPFNHPATFDS  183

Query  548  VVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +V++ DLK +++SDLE FLKS+QYYHKLGRVW+RS+LLYGPS
Sbjct  184  LVIDPDLKTKIRSDLEAFLKSKQYYHKLGRVWKRSYLLYGPS  225



>ref|XP_010054126.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW78500.1| hypothetical protein EUGRSUZ_D02641 [Eucalyptus grandis]
Length=472

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 158/218 (72%), Gaps = 7/218 (3%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +RL   ++     L+ W     D  +V+Q  KVP+ N   QEN LYR+V VY+NSL SLE
Sbjct  21   LRLLFRKTGPFHLLKGWWRSTQDWFYVYQVLKVPEFNDAVQENPLYRRVSVYLNSLPSLE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            +SDFTNL   A  K NDI+L LD NQ + D FLGAR+SW N    G  R+ VLRI++ DK
Sbjct  81   ESDFTNLF--AGKKPNDILLHLDPNQTIDDVFLGARLSWTND-QRGDRRAFVLRIRRADK  137

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
              ILRPYLQHIH VSD I++++R+LKL +N     DD  +GRWRSVPFTHPST +T+ ME
Sbjct  138  MSILRPYLQHIHAVSDEIDRKKRDLKLHIN----VDDGGSGRWRSVPFTHPSTLDTIAME  193

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             DLK++VKSDLE+FLK++QYYH+LGRVW+RSFLLYGPS
Sbjct  194  PDLKDKVKSDLESFLKAKQYYHRLGRVWKRSFLLYGPS  231



>ref|XP_006367360.1| PREDICTED: uncharacterized protein LOC102582634 [Solanum tuberosum]
Length=509

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            F+ +++++  L+KW   ++DK +V+QF+KVPQ N N QENQLYRK+  Y+NSL  +EDSD
Sbjct  17   FVSKTSILHILKKWLRLLEDKFYVYQFYKVPQFNHNMQENQLYRKISTYLNSLPCVEDSD  76

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSLVlrikkkdkrr  385
            FTNL + +  KSN+I L L+ +Q + D FLGAR+SW+N+  +  G RS VL+I++ DKR+
Sbjct  77   FTNLFSGS--KSNEINLVLNADQKIVDNFLGARISWINEKDEKTGVRSFVLKIRRNDKRQ  134

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG--RWRSVPFTHPSTFETVVME  559
            ILR YLQHIH+  D IEQRR+E++LF+N +  S+ +  G  RW SVPFTHP+TF+TVVME
Sbjct  135  ILRTYLQHIHSKFDEIEQRRKEVRLFVNVNDESNGNGNGNRRWISVPFTHPATFDTVVME  194

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             DLKN+VK+DLETFLKS+Q+Y+++GR+W+R++LL+GPS
Sbjct  195  QDLKNKVKADLETFLKSKQHYNRIGRIWKRNYLLHGPS  232



>ref|XP_004155177.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FtsH-like [Cucumis sativus]
Length=481

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 167/219 (76%), Gaps = 7/219 (3%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R+ L+R+ L+F ++KW   ++D  HV+Q F++P+ N+ +Q N LYRKV  Y+ SLSSLE
Sbjct  21   LRILLFRTGLIFLVKKWWANLEDCFHVYQSFRIPEFNETSQHNHLYRKVSAYLTSLSSLE  80

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            DSDFTNL+     K NDI+L LD NQ VQD FLGA+V W N+    G R+ VLRI+K DK
Sbjct  81   DSDFTNLITGN--KPNDIILRLDSNQTVQDXFLGAKVFWTNE--QKGSRNFVLRIRKADK  136

Query  380  rrilrPYLQHIHTVS-DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            RRILRPYLQHIHT++ D  EQR+ +LKL MN     ++ +  RW+S+ F HPSTF+++ M
Sbjct  137  RRILRPYLQHIHTLTADENEQRKGDLKLXMNSK--PNNHSDTRWKSIQFKHPSTFDSIAM  194

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            E+DLK +VKSDLE+FLKS+QYYH+LGRVW+RS+LLYGPS
Sbjct  195  ETDLKXKVKSDLESFLKSKQYYHRLGRVWKRSYLLYGPS  233



>ref|XP_004307905.1| PREDICTED: cell division control protein 48-like [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 167/225 (74%), Gaps = 9/225 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + VF  +R     S L   L+ W   ID + HV+QF+KVPQ N N QENQLYRK+ +Y+N
Sbjct  15   IPVFYVLRFLSKTSLLHMLLKSWQSLID-RFHVYQFYKVPQFNHNFQENQLYRKISLYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSLVl  358
            SL ++EDSDFTNL + +  KSNDI    D+N  V D FL A+VSW N+  D  G RS VL
Sbjct  74   SLPNIEDSDFTNLFSGS--KSNDIFFQHDNNHSVGDTFLSAKVSWTNEKSDVDGIRSYVL  131

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            RIKK DKRR+ R Y QHI TVSD IEQR +E+KL+MN  LA+++    RWRSVPFTHP+T
Sbjct  132  RIKKTDKRRVFRQYFQHILTVSDEIEQRNKEIKLYMN--LATENE---RWRSVPFTHPAT  186

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             ++VVM+++LKN+V+SDLE FLKS+QYYH+LGRVW+RSFLLYGPS
Sbjct  187  LDSVVMDTELKNKVRSDLEQFLKSKQYYHRLGRVWKRSFLLYGPS  231



>gb|KDP30317.1| hypothetical protein JCGZ_18154 [Jatropha curcas]
Length=482

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 168/216 (78%), Gaps = 5/216 (2%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            FL +++ +  L K+    +D  HV+QFF VPQ N++ QEN LY KV  Y+ SL ++EDSD
Sbjct  22   FLSKTSFLQILVKYLQSFEDYFHVYQFFTVPQYNEHFQENLLYNKVSSYLTSLPAIEDSD  81

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN-KVHDGGGRSLVlrikkkdkrr  385
            FTNL + +  KSN+I+L LD  QV+QD FL ARV W+N K  + G R+ VL+++KKDKRR
Sbjct  82   FTNLFSGS--KSNEIILRLDAKQVIQDNFLSARVWWINQKSENDGKRTFVLKLRKKDKRR  139

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            ILRPYLQHI + +D IEQR++E+KL+MN  + ++    GRW SVPFTHPST +TVVME+D
Sbjct  140  ILRPYLQHILSQADEIEQRKKEIKLYMN--VENEPQENGRWMSVPFTHPSTMDTVVMEAD  197

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LKN+VK+DLE+FLKS+QYYH+LGRVW+RS+LLYGPS
Sbjct  198  LKNKVKTDLESFLKSKQYYHRLGRVWKRSYLLYGPS  233



>gb|KFK37429.1| hypothetical protein AALP_AA4G255900 [Arabis alpina]
Length=451

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 155/208 (75%), Gaps = 8/208 (4%)
 Frame = +2

Query  59   LRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAV  238
            ++KW   I D  HV+QF+KVP+ N+N QEN LY KV+ Y+NSLSS+E+SDFTNL      
Sbjct  2    VKKWRRTISDFCHVYQFYKVPEFNENLQENHLYSKVYSYLNSLSSIENSDFTNLFTGK--  59

Query  239  KSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG---RSLVlrikkkdkrrilrPYLQH  409
            KSN+I+L LD NQ++ D+FLGARV W+N   D  G   R+ VL+I+K DKRRIL  YLQH
Sbjct  60   KSNEIILRLDRNQIISDEFLGARVCWINGEDDKDGSRSRNFVLKIRKADKRRILSLYLQH  119

Query  410  IHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSD  589
            IHTVS+ IEQR  ELKLFMN  +      + RWRSV F HPSTFE + ME DLK +VKSD
Sbjct  120  IHTVSEEIEQRNTELKLFMNIGIGI---GSARWRSVSFNHPSTFENIAMEVDLKEKVKSD  176

Query  590  LETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LE+FLK +QYY++LGRVW+RS+LLYG S
Sbjct  177  LESFLKGKQYYNRLGRVWKRSYLLYGTS  204



>gb|AFP55581.1| ATP binding protein [Rosa rugosa]
Length=490

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 170/226 (75%), Gaps = 11/226 (5%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALV-FALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYV  178
            + +F  +R FL R++L+   ++ W   ID K HV+QF+KVPQ N N QENQLYRK+ VY+
Sbjct  15   IPLFYVLR-FLSRTSLLHMVVKSWQSLID-KFHVYQFYKVPQFNHNYQENQLYRKISVYL  72

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-RSLV  355
            NSL ++EDSDFTNL + +  KSNDI    D+N  V D FL A+VSW N+  D  G RS V
Sbjct  73   NSLPNIEDSDFTNLFSGS--KSNDIFFQHDNNHSVHDTFLSAKVSWTNEKSDVDGIRSYV  130

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKK DKRR+ R Y QHI  VSD IEQR +++KL+MN  LA+++    RWRSVPFTHP+
Sbjct  131  LRIKKTDKRRVFRQYFQHILIVSDEIEQRNKDIKLYMN--LATENE---RWRSVPFTHPA  185

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            T +TVVM+ +LKN+V+SDLE FLKS+QYYH+LGRVW+RSFLLYGPS
Sbjct  186  TLDTVVMDMELKNKVRSDLEQFLKSKQYYHRLGRVWKRSFLLYGPS  231



>gb|KHN35399.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=388

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 164/220 (75%), Gaps = 16/220 (7%)
 Frame = +2

Query  26   LFLYRSALVF-ALRKWSDWI--DDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSL  196
            LF++ S LV  A+R    WI  +D  HV+QFFKVP+LN+  Q N LYRKV +Y++SL S+
Sbjct  3    LFIFLSTLVLIAVRAKKLWIAIEDWFHVYQFFKVPELNETTQHNHLYRKVSLYLHSLPSI  62

Query  197  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkd  376
            EDS F NL+     K NDIVLCL  NQ +QD FLGA + W N+       + VL+I+K D
Sbjct  63   EDSVFANLITGK--KQNDIVLCLGPNQTIQDHFLGATLFWFNQTG-----TFVLKIRKVD  115

Query  377  krrilrPYLQHIHTVSDNIEQR-RRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVV  553
            KRRILRPYLQHIH V+D I+Q+ +R+L+LF+N   A D    GRWRSVPFTHPSTF+T+ 
Sbjct  116  KRRILRPYLQHIHAVADEIDQQGKRDLRLFINS--AHD---FGRWRSVPFTHPSTFDTIA  170

Query  554  MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ME DLK +VKSDLE+FL+++QYYH+LGRVW+RSFLLYGPS
Sbjct  171  MEPDLKTKVKSDLESFLRAKQYYHRLGRVWKRSFLLYGPS  210



>ref|XP_011043686.1| PREDICTED: ATP-dependent zinc metalloprotease YME1 homolog [Populus 
euphratica]
Length=496

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 168/227 (74%), Gaps = 8/227 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFAL-RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYV  178
            + VF  +  FL +++ +  L R W  + +DK +V+Q FKVPQ N    ENQLY KV  Y+
Sbjct  17   IVVFLVIIRFLAKTSFLHILVRCWRSF-EDKFYVYQIFKVPQFNDLLLENQLYHKVSTYL  75

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK--VHDGGGRSL  352
             SL ++EDSDFTNL + +  K+NDI+L LD NQV+ D FLGARV W N+    + G R+L
Sbjct  76   TSLPAIEDSDFTNLFSGS--KANDIILHLDKNQVIHDSFLGARVHWSNEKYCEENGKRAL  133

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            VL+++KKDKR ILRPYLQHI +V+D +EQ+ +E+KLFMN  L  +    GRWRSVPFTHP
Sbjct  134  VLKLRKKDKRMILRPYLQHILSVADQVEQKSKEIKLFMN--LEKNPYENGRWRSVPFTHP  191

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +T +T++M+ DLKN+VK+DLE FLKS+QYYH+LG VW+RS+LLYG S
Sbjct  192  ATMDTMIMDGDLKNKVKADLELFLKSKQYYHRLGHVWKRSYLLYGAS  238



>ref|XP_011084544.1| PREDICTED: mitochondrial chaperone BCS1-like [Sesamum indicum]
Length=486

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 165/216 (76%), Gaps = 9/216 (4%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            FL +++L+ +L++   +++ K +V+QF++VP+ N+N QENQLYRKV+ Y+NSL  +EDS+
Sbjct  22   FLAKTSLIHSLKRGWQFLEGKSYVYQFYRVPKFNENMQENQLYRKVYTYLNSLPCVEDSE  81

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW-MNKVHDGGGRSLVlrikkkdkrr  385
            F NL + +  KS +I L LD+NQ + D FLGARV W +    + G +SLVL+I+K DKRR
Sbjct  82   FANLFSGS--KSTEINLILDENQTIADHFLGARVCWKIENCEEKGVKSLVLKIRKNDKRR  139

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMN--RSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            IL PYLQHIH V D IEQ+R+E++L++N    L  D    GRWRS  FTHP+T ET+VM+
Sbjct  140  ILVPYLQHIHQVFDEIEQKRKEVRLYVNVENGLQRD----GRWRSTSFTHPATMETIVMD  195

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            +DLK R+KSDLE FLKS+QYYH+LGRVW+RS+LLYG
Sbjct  196  ADLKTRIKSDLENFLKSRQYYHRLGRVWKRSYLLYG  231



>ref|XP_003553796.1| PREDICTED: mitochondrial chaperone BCS1-like [Glycine max]
Length=452

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 164/220 (75%), Gaps = 16/220 (7%)
 Frame = +2

Query  26   LFLYRSALVF-ALRKWSDWI--DDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSL  196
            LF++ S LV  A+R    WI  +D  HV+QFFKVP+LN+  Q N LYRKV +Y++SL S+
Sbjct  3    LFIFLSTLVLIAVRAKKLWIAIEDWFHVYQFFKVPELNETTQHNHLYRKVSLYLHSLPSI  62

Query  197  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkd  376
            EDS F NL+     K NDIVLCL  NQ +QD FLGA + W N+       + VL+I+K D
Sbjct  63   EDSVFANLITGK--KQNDIVLCLGPNQTIQDHFLGATLFWFNQTG-----TFVLKIRKVD  115

Query  377  krrilrPYLQHIHTVSDNIEQR-RRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVV  553
            KRRILRPYLQHIH V+D I+Q+ +R+L+LF+N   A D    GRWRSVPFTHPSTF+T+ 
Sbjct  116  KRRILRPYLQHIHAVADEIDQQGKRDLRLFINS--AHD---FGRWRSVPFTHPSTFDTIA  170

Query  554  MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ME DLK +VKSDLE+FL+++QYYH+LGRVW+RSFLLYGPS
Sbjct  171  MEPDLKTKVKSDLESFLRAKQYYHRLGRVWKRSFLLYGPS  210



>ref|XP_002301424.2| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE80697.2| AAA-type ATPase family protein [Populus trichocarpa]
Length=488

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 164/215 (76%), Gaps = 7/215 (3%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  214
            +++ L++  +KW   I+D  HV+QFFKVP+ N+N Q+N LY +V +Y++S++S+EDSDF 
Sbjct  26   FKTGLIYITKKWWRSIEDCFHVYQFFKVPEFNENMQKNHLYCEVSIYLSSIASIEDSDFI  85

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGR--SLVlrikkkdkrri  388
            NL      K +DIVL LD NQV+ D FLGARVSW+N+  +   R  + VL+I++ DKR+I
Sbjct  86   NLFTGK--KPHDIVLHLDPNQVIDDYFLGARVSWINEEKNDTNRCRTFVLKIRRADKRKI  143

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDL  568
            LRPYLQHIH  SD +EQ+++++KL++N         + +WRSVPF HPSTF+T+ MESDL
Sbjct  144  LRPYLQHIHITSDELEQKKKDVKLYIN---IDSHEQSRQWRSVPFKHPSTFDTIAMESDL  200

Query  569  KNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            KN++KSDLE+FLK++ YYH+LGR W+RS+LLYGPS
Sbjct  201  KNKLKSDLESFLKAKHYYHRLGRAWKRSYLLYGPS  235



>ref|XP_002318453.2| hypothetical protein POPTR_0012s02770g [Populus trichocarpa]
 gb|EEE96673.2| hypothetical protein POPTR_0012s02770g [Populus trichocarpa]
Length=488

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 163/222 (73%), Gaps = 6/222 (3%)
 Frame = +2

Query  14   AAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSS  193
            A +  FL +++ +  L +     +DK +V+Q FKVPQ N    ENQLY KV  Y+ SL +
Sbjct  13   ALIIRFLAKTSFLHILARCWRSFEDKFYVYQIFKVPQFNDLFLENQLYHKVSTYLTSLPA  72

Query  194  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK--VHDGGGRSLVlrik  367
            +EDSDFTNL + +  K+NDI+L LD NQV+ D FLGARV W N+      G R+LVL+++
Sbjct  73   IEDSDFTNLFSGS--KANDIILHLDKNQVIHDSFLGARVHWSNEKYCEGNGKRTLVLKLR  130

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFET  547
            KKDKR ILRPYLQHI +V+D +EQ+ +E+KLFMN  L  +    GRWRSVPFTHP+T +T
Sbjct  131  KKDKRMILRPYLQHILSVADQVEQKSKEIKLFMN--LEKNPYENGRWRSVPFTHPATMDT  188

Query  548  VVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ++M+ DLKN+VK+DLE FLKS+QYYH+LG VW+RS+LLYG S
Sbjct  189  MIMDGDLKNKVKADLELFLKSKQYYHRLGHVWKRSYLLYGAS  230



>ref|XP_008234685.1| PREDICTED: probable mitochondrial chaperone bcs1 [Prunus mume]
Length=488

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 164/227 (72%), Gaps = 11/227 (5%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            +S+   +R     S L   ++ W   ID + HV+QF+K+PQ N++ QENQLYRK+ +Y+N
Sbjct  15   ISLVLVLRFLSKTSLLQIFIKSWQSLID-RFHVYQFYKIPQFNEHFQENQLYRKISLYLN  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQ-VVQDQFLGARVSWMNK--VHDGGGRSL  352
            SL S+EDSDFTNL + +  KSNDI    D N  VV D F  A+VSW N+      G RS 
Sbjct  74   SLPSIEDSDFTNLFSGS--KSNDIFFQHDANHSVVHDTFFRAKVSWTNQKSSQPNGIRSF  131

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            VL+I K DKRR+ R Y QHI TV+D +EQR +E+KL+MN S  ++     RWRSVPFTHP
Sbjct  132  VLKINKSDKRRVFRQYFQHILTVADEVEQRNKEIKLYMNLSTENE-----RWRSVPFTHP  186

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +TF+TVVM+++LKN+V+SDLE FLKS+QYYH+LGRVW+RSFLLYGPS
Sbjct  187  ATFDTVVMDAELKNKVRSDLENFLKSKQYYHRLGRVWKRSFLLYGPS  233



>ref|XP_002321380.2| hypothetical protein POPTR_0015s01020g [Populus trichocarpa]
 gb|EEF05507.2| hypothetical protein POPTR_0015s01020g [Populus trichocarpa]
Length=496

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + VF  +R     S L    R W  + +DK  V+Q FKVPQ N   QENQLY KV  Y+ 
Sbjct  18   IIVFLVLRFLSKTSFLHILARCWRSF-EDKFCVYQIFKVPQFNDLFQENQLYHKVSTYLT  76

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH---DGGGRSL  352
            SL ++EDSDFTNL + +  K+NDI+L LD NQV+ D FLGARV W N+ +   + G R+L
Sbjct  77   SLPAIEDSDFTNLFSGS--KANDIILHLDKNQVIHDSFLGARVQWSNEKYCEGNNGKRTL  134

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            VL+++KKDKR ILRPYLQHI +V+D I+Q+  E+KLFMN  L      +GRW SVPFTHP
Sbjct  135  VLKLRKKDKRTILRPYLQHILSVADQIKQKNEEIKLFMN--LEKKPYESGRWTSVPFTHP  192

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +T +TVVM+ +LK++VK+DLE FLKS+QYYH+LG VW+RS+LLYG S
Sbjct  193  ATMDTVVMDGELKSKVKADLELFLKSKQYYHRLGHVWKRSYLLYGAS  239



>ref|XP_007221060.1| hypothetical protein PRUPE_ppa016223mg, partial [Prunus persica]
 gb|EMJ22259.1| hypothetical protein PRUPE_ppa016223mg, partial [Prunus persica]
Length=396

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 163/219 (74%), Gaps = 12/219 (5%)
 Frame = +2

Query  29   FLYRSALV-FALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  205
            FL +++L+   ++ W   ID + HV+QF+K+PQ N++ QENQLYRK+ +Y+NSL S+EDS
Sbjct  1    FLSKTSLLQIFIKSWQSLID-RFHVYQFYKIPQFNEHFQENQLYRKISLYLNSLPSIEDS  59

Query  206  DFTNLVNSAAVKSNDIVLCLDDNQ-VVQDQFLGARVSWMNK--VHDGGGRSLVlrikkkd  376
            DFTNL + +  KSNDI    D N  VV D F  A+VSW N+      G RS VL+I K D
Sbjct  60   DFTNLFSGS--KSNDIFFQHDANHSVVHDTFFSAKVSWTNQKSSQPDGIRSFVLKINKSD  117

Query  377  krrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            KRR+ R Y QHI TV+D +EQR +E+KL+MN S  ++     RWRSVPFTHP+TF+TVVM
Sbjct  118  KRRVFRQYFQHILTVADEVEQRNKEIKLYMNLSTENE-----RWRSVPFTHPATFDTVVM  172

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +++LKN+V+SDLE FLKS+QYYH+LGRVW+RSFLL GPS
Sbjct  173  DAELKNKVRSDLENFLKSKQYYHRLGRVWKRSFLLCGPS  211



>ref|XP_003520880.1| PREDICTED: uncharacterized protein LOC100776680 [Glycine max]
Length=462

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 153/199 (77%), Gaps = 13/199 (7%)
 Frame = +2

Query  80   IDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVL  259
            I+D  HV+QFFKVP+LN   Q N LYRKV +Y++SL S+EDSDF NL+     K NDIVL
Sbjct  31   IEDWFHVYQFFKVPELNDTTQHNHLYRKVSLYLHSLPSIEDSDFANLITGK--KQNDIVL  88

Query  260  CLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQ  439
            CL  NQ ++D FLGA + W N+       + +L+I+K DKRRILRPYLQHIH V+D I+Q
Sbjct  89   CLGPNQTIEDHFLGATLFWFNQTG-----TFLLKIRKVDKRRILRPYLQHIHAVADEIDQ  143

Query  440  R-RRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQ  616
            R +R+L LFMN    +DD    RWRSVPFTHPSTF+TV ME DLK++VKSDLE+FL+++Q
Sbjct  144  RGKRDLLLFMN---IADDFR--RWRSVPFTHPSTFDTVAMEPDLKSKVKSDLESFLRAKQ  198

Query  617  YYHKLGRVWRRSFLLYGPS  673
            YYH+LGRVW+RSFLLYGPS
Sbjct  199  YYHRLGRVWKRSFLLYGPS  217



>ref|XP_008376774.1| PREDICTED: probable mitochondrial chaperone bcs1 [Malus domestica]
Length=490

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 161/217 (74%), Gaps = 9/217 (4%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            F+ +++LV    K    + D+  V+QF+K+PQ N++ QEN+LYRK+ VY++SL S+EDSD
Sbjct  23   FVSKTSLVHKFTKLGQSLADRFRVYQFYKIPQFNEHFQENRLYRKISVYLDSLPSIEDSD  82

Query  209  FTNLVNSAAVKSNDIVLCLDD-NQVVQDQFLGARVSWMN-KVHDGGGRSLVlrikkkdkr  382
            FTNL     VKSNDI    D  N  V D FL A++SW N K    G RS VL+I + DKR
Sbjct  83   FTNLF--TGVKSNDIFFQHDAANSAVHDTFLSAKLSWTNEKSQSDGIRSFVLKINRSDKR  140

Query  383  rilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMES  562
            R+ R Y QHI TV+D IEQR RE+KL+MN  L+S++    RWRSVPFTHP+TF+TVVM++
Sbjct  141  RVFRQYFQHILTVADEIEQRNREIKLYMN--LSSENE---RWRSVPFTHPATFDTVVMDA  195

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +LKN+++SDLE F KS+QYYH+LGRVW+RSFLLYGPS
Sbjct  196  ELKNKIRSDLENFSKSKQYYHRLGRVWKRSFLLYGPS  232



>ref|XP_010933795.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
Length=497

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 156/223 (70%), Gaps = 6/223 (3%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V   A +R  L   AL++ L +W  W+D+++ V+Q+F++P+ N+++QEN LYRK   YV 
Sbjct  15   VCGLAVLRTILSARALLYHLGRWWRWVDERVQVYQYFEIPRYNESSQENPLYRKAAAYVA  74

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlr  361
            SL SLED+    L +S+  K ND +L L   Q   D FLGARVSW ++   GG   LVLR
Sbjct  75   SLPSLEDAAAATL-SSSGRKPNDFLLHLGPGQSAHDSFLGARVSWSSRSPGGG--CLVLR  131

Query  362  ikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
            ++++D+ R+LRPYLQH+ +V+D I+ RRRE++LF N   A       RWRSVPFTHPST 
Sbjct  132  VRRQDRTRVLRPYLQHVESVADEIDLRRREVRLFTN---AGGGGEGPRWRSVPFTHPSTL  188

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +TV M+ DLK RV++DLE FLK + YYH+LGRVWRRS+LLYGP
Sbjct  189  DTVAMDPDLKTRVRADLEAFLKGRAYYHRLGRVWRRSYLLYGP  231



>ref|XP_011044701.1| PREDICTED: uncharacterized protein LOC105139793 [Populus euphratica]
Length=496

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 161/227 (71%), Gaps = 8/227 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            + VF  +R     S L    R W  + +DK  V+Q FKVPQ N   QENQLY KV  Y+ 
Sbjct  18   IIVFLVLRFLSKTSFLHILARCWRSF-EDKFCVYQIFKVPQFNDLFQENQLYHKVSTYLT  76

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH---DGGGRSL  352
            SL + EDSDFTNL + +  K+NDI+L LD NQV+ D FLGARV W N+ +   + G R+L
Sbjct  77   SLPATEDSDFTNLFSGS--KANDIILHLDKNQVIHDSFLGARVQWSNEKYCEGNDGKRTL  134

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            VL+++ KDKR ILRPYLQHI +V+D I+Q+  E+KLFMN  L  +    GRW SVPFTHP
Sbjct  135  VLKLRMKDKRTILRPYLQHILSVADQIKQKNEEIKLFMN--LEKNPYENGRWTSVPFTHP  192

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +T +T+VM+ +LK++VK+DLE FLKS+QYYH+LG VW+RS+LLYG S
Sbjct  193  ATMDTMVMDGELKSKVKADLELFLKSKQYYHRLGHVWKRSYLLYGAS  239



>ref|XP_007135287.1| hypothetical protein PHAVU_010G116600g [Phaseolus vulgaris]
 gb|ESW07281.1| hypothetical protein PHAVU_010G116600g [Phaseolus vulgaris]
Length=477

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 160/220 (73%), Gaps = 4/220 (2%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R  L+++ L+ ++RK    + D  HV+QF KVP+ N+  Q N L+RKV +Y++SL S+E
Sbjct  20   IRRLLFKTGLIHSIRKLLRRVQDWFHVYQFLKVPEFNEAMQRNHLHRKVSLYLHSLPSIE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN-KVHDGGGRSLVlrikkkd  376
            D+DFTNLV  +    NDIVL L+ NQ +QD FLGA + W   K       S VL+I+K D
Sbjct  80   DADFTNLV--SGYDQNDIVLRLEPNQTIQDNFLGATLFWFEQKTEPERISSFVLKIRKTD  137

Query  377  krrilrPYLQHIHTVSDNIE-QRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVV  553
            KRRILR YL+HI+TV+D +E QR+R L+LFMN +     +   RWRSVPFTHP+TFET+V
Sbjct  138  KRRILRQYLRHINTVADEMENQRKRHLRLFMNAAATEGGTGETRWRSVPFTHPATFETIV  197

Query  554  MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ME DLKN++KSD+E+FLK++QYY KLGR W+RSFLLYG S
Sbjct  198  MEKDLKNKIKSDMESFLKAKQYYRKLGRAWKRSFLLYGSS  237



>ref|XP_010109213.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXC21393.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=486

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 169/227 (74%), Gaps = 10/227 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFAL-RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYV  178
            +++F   R FLY++ +V  L R W  +++ +LHV+Q +KVPQ N++ QENQLYRK+  Y+
Sbjct  10   IALFLVSR-FLYKTNVVLILVRSWQSFVE-RLHVYQLYKVPQYNEHFQENQLYRKISTYL  67

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN-KVHDGGGRSLV  355
            NSL S+EDSD+TNL + +  KSNDI   LD +Q ++D FL A V W N K    G RS V
Sbjct  68   NSLPSVEDSDYTNLFSGS--KSNDIFSHLDTSQSIRDTFLNAGVWWTNQKTEPDGVRSFV  125

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG-RWRSVPFTHP  532
            LRIKK DKRR+ R Y QHI +VSD IEQR++E+KL +   L     A   RWRS+PFTHP
Sbjct  126  LRIKKSDKRRVFRQYFQHILSVSDEIEQRKKEIKLHI---LGFSGGAGNERWRSIPFTHP  182

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ++FETVV++SDLK+++KSDLE FLKS+QYYH+LGRVW+RS+LLYGPS
Sbjct  183  ASFETVVLDSDLKSKIKSDLELFLKSKQYYHRLGRVWKRSYLLYGPS  229



>ref|XP_008381389.1| PREDICTED: mitochondrial chaperone BCS1-like [Malus domestica]
Length=479

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 165/226 (73%), Gaps = 10/226 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            VS+   +R F+ +++LV  L K  + + D+  V+QF+K+PQ N++ QENQLY K+ VY++
Sbjct  15   VSLVLVLR-FMSKTSLVHKLTKLWESLADRFRVYQFYKIPQFNEHFQENQLYGKISVYLD  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLD-DNQVVQDQFLGARVSW-MNKVHDGGGRSLV  355
            SL S+EDSDFTNL   A  KSNDIV   D +N  V D FL A++SW + K    G RS V
Sbjct  74   SLPSIEDSDFTNLFTGA--KSNDIVFRHDANNSAVHDTFLSAKLSWTIQKSQSDGIRSFV  131

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            L+I + DKRR+ R Y QHI TV+D IEQR R++KL+MN S  ++     RW SVPFTHP+
Sbjct  132  LKINRSDKRRVFRQYFQHILTVADEIEQRNRDIKLYMNLSRENE-----RWXSVPFTHPA  186

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            TF+TVVM+++LKN+V+SDLE F KS QYYH+LGRVW+RSFLLYGPS
Sbjct  187  TFDTVVMDAELKNKVRSDLENFSKSXQYYHRLGRVWKRSFLLYGPS  232



>ref|XP_009351948.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X2 [Pyrus 
x bretschneideri]
Length=479

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 164/226 (73%), Gaps = 10/226 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            VS+   +R F+ +++LV    K    + D+  V+QF+K+PQ N++ QENQLY K+ VY++
Sbjct  15   VSLVLVLR-FMSKTSLVHKFTKLWQSLADRFRVYQFYKIPQFNEHFQENQLYGKISVYLD  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLD-DNQVVQDQFLGARVSW-MNKVHDGGGRSLV  355
            SL S+EDSDFTNL   A  KSNDIV   D +N  V D FL A++SW + K    G RS V
Sbjct  74   SLPSIEDSDFTNLFTGA--KSNDIVFRHDANNSAVHDTFLSAKLSWTIQKSQSDGIRSFV  131

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            L+I + DKRR+ R Y QHI TV+D IEQR R++KL+MN S  ++     RWRSVPF HP+
Sbjct  132  LKINRSDKRRVFRQYFQHILTVADEIEQRNRDIKLYMNLSCENE-----RWRSVPFMHPA  186

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            TF+TVVM+++LKN+V+SDLE F KS+QYYH+LGRVW+RSFLLYGPS
Sbjct  187  TFDTVVMDAELKNKVRSDLENFSKSKQYYHRLGRVWKRSFLLYGPS  232



>ref|XP_009775982.1| PREDICTED: uncharacterized protein LOC104225813 [Nicotiana sylvestris]
Length=512

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 167/218 (77%), Gaps = 7/218 (3%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            F  +++L+  L+KW   ++DK +V++++KVP+ N N QENQLYR +  Y+NSL  LEDS+
Sbjct  17   FASKTSLLHILKKWLRLLEDKCYVYRYYKVPRFNHNMQENQLYRHISTYLNSLPCLEDSN  76

Query  209  FTNLVNSAAVKSNDIVLCLDD-NQ-VVQDQFLGARVSWMNKVHDGGG-RSLVlrikkkdk  379
            FTNL   +  KSN+I L LDD NQ +V D FLGARV W+N+  D  G  S VL+I+KKDK
Sbjct  77   FTNLF--SGNKSNEINLVLDDSNQNIVVDNFLGARVCWINEKDDKTGLNSFVLKIRKKDK  134

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            RRILRPYLQHIHT  D IEQRR +++LF+N +   D +   RW SVPFTHP+TF+TVVME
Sbjct  135  RRILRPYLQHIHTKFDEIEQRRNKVRLFININDELDKNR--RWISVPFTHPATFDTVVME  192

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             DLKN+VK+ L+TFLKS+Q+Y ++GR+W+R++LLYGPS
Sbjct  193  QDLKNKVKAALDTFLKSKQHYTRVGRIWKRNYLLYGPS  230



>ref|XP_009361315.1| PREDICTED: probable mitochondrial chaperone bcs1 [Pyrus x bretschneideri]
Length=490

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 157/217 (72%), Gaps = 9/217 (4%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            F+ +++LV    K    + D+  V+QF+K+PQ N++ QEN+LYRK+ VY++SL S+EDSD
Sbjct  23   FVSKTSLVHKFTKLWQSLADRFRVYQFYKIPQFNEHFQENRLYRKISVYLDSLPSIEDSD  82

Query  209  FTNLVNSAAVKSNDIVLCLDD-NQVVQDQFLGARVSWMN-KVHDGGGRSLVlrikkkdkr  382
            FTNL   A  KSNDI    D  N  V D FL A++SW N K    G RS VL+I + DKR
Sbjct  83   FTNLFTGA--KSNDIFFQHDAANSAVHDTFLSAKLSWTNQKSQSDGIRSFVLKINRSDKR  140

Query  383  rilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMES  562
            R+ R Y QHI TV+D IEQR RE+ L+MN S     S   RWRSVPFTHP+TF+TVVM++
Sbjct  141  RVFRQYFQHILTVADEIEQRNREINLYMNLS-----SENERWRSVPFTHPATFDTVVMDA  195

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +LKN+++SDLE F KS+QYYH+LGRVW+RSFLLYGPS
Sbjct  196  ELKNKIRSDLENFSKSKQYYHRLGRVWKRSFLLYGPS  232



>ref|XP_010919325.1| PREDICTED: uncharacterized protein LOC105043468 [Elaeis guineensis]
Length=489

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 154/223 (69%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V     +R  L   AL++ + +W  W+D+++  +Q+F++P+ N+++QEN LYRK   YV 
Sbjct  16   VCGLVILRTILSARALLYHMGRWWRWVDERVQAYQYFEIPRYNESSQENPLYRKAAAYVA  75

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlr  361
            SL SLED+D   L +S   K ND +L L   Q   D FLGAR+SW N+   GG   LVLR
Sbjct  76   SLPSLEDADAATLCSSGR-KPNDFLLHLCPGQSAPDSFLGARLSWSNRPPGGG--CLVLR  132

Query  362  ikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
            ++++D+ R+LRPYLQH+ +V+D IE RRRE++LF N           RWRSVPFTHPST 
Sbjct  133  VRRQDRTRVLRPYLQHVESVADEIELRRREVRLFTN------SGKGPRWRSVPFTHPSTL  186

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +TV ++ DLKNR+++DLE FLK + YYH+LGRVWRRS+LLYGP
Sbjct  187  DTVAIDPDLKNRLRADLEAFLKGRAYYHRLGRVWRRSYLLYGP  229



>ref|XP_009351947.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X1 [Pyrus 
x bretschneideri]
Length=490

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 164/226 (73%), Gaps = 10/226 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            VS+   +R F+ +++LV    K    + D+  V+QF+K+PQ N++ QENQLY K+ VY++
Sbjct  15   VSLVLVLR-FMSKTSLVHKFTKLWQSLADRFRVYQFYKIPQFNEHFQENQLYGKISVYLD  73

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLD-DNQVVQDQFLGARVSW-MNKVHDGGGRSLV  355
            SL S+EDSDFTNL   A  KSNDIV   D +N  V D FL A++SW + K    G RS V
Sbjct  74   SLPSIEDSDFTNLFTGA--KSNDIVFRHDANNSAVHDTFLSAKLSWTIQKSQSDGIRSFV  131

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            L+I + DKRR+ R Y QHI TV+D IEQR R++KL+MN S  ++     RWRSVPF HP+
Sbjct  132  LKINRSDKRRVFRQYFQHILTVADEIEQRNRDIKLYMNLSCENE-----RWRSVPFMHPA  186

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            TF+TVVM+++LKN+V+SDLE F KS+QYYH+LGRVW+RSFLLYGPS
Sbjct  187  TFDTVVMDAELKNKVRSDLENFSKSKQYYHRLGRVWKRSFLLYGPS  232



>ref|XP_008803962.1| PREDICTED: uncharacterized protein LOC103717381 [Phoenix dactylifera]
Length=499

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 156/223 (70%), Gaps = 4/223 (2%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V     +R  L   AL++ L +W  W+D+++  +Q+F++P+ N+  QEN LYRK   Y+ 
Sbjct  21   VCGLVILRTILSARALLYHLGRWWRWVDERMQAYQYFEIPRYNEGTQENPLYRKAAAYMA  80

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlr  361
            SL S+ED+D   L +S+  K ND +L L   Q V D FLGAR+SW N+   GG   LVLR
Sbjct  81   SLPSIEDADAATL-SSSGRKPNDFLLHLGPGQSVPDSFLGARLSWSNRPPGGG--CLVLR  137

Query  362  ikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
            ++++D+ R+LRPYLQH+ +V++ IE RRRE++LF N S + D     RWRSVPFTHPST 
Sbjct  138  VRRQDRTRVLRPYLQHVESVANEIELRRREVRLFTN-SGSGDCGEGPRWRSVPFTHPSTL  196

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +TV ++ +LK RV++DLE F+K + YYH+LGRVWRRS+LLYGP
Sbjct  197  DTVAIDPELKTRVRADLEAFVKGRAYYHRLGRVWRRSYLLYGP  239



>ref|XP_004502706.1| PREDICTED: mitochondrial chaperone BCS1-like [Cicer arietinum]
Length=488

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 163/223 (73%), Gaps = 9/223 (4%)
 Frame = +2

Query  11   FAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLS  190
            F  +R F   SAL + L++W    +D+LH+HQ FK+P  + N +ENQLYRK+  Y++SL 
Sbjct  22   FLILRFFRKTSAL-YILKQWWLSFEDRLHLHQSFKIPLYDHNFRENQLYRKILTYIDSLP  80

Query  191  SLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRS-LVlrik  367
            S++DSDFTNL +      +DI L LD NQ+V D FLGA+VSW N    G   S LVLR+K
Sbjct  81   SVQDSDFTNLFSGP--NPSDIFLHLDANQIVHDTFLGAKVSWTNNASAGDSASALVLRMK  138

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRR-ELKLFMNRSLASDDSAAGRWRSVPFTHPSTFE  544
            KKDKRR+ + Y QHI +V+D IEQRR+ ++KLFMN S         RWRSVPFTHP++FE
Sbjct  139  KKDKRRVFQQYFQHILSVADEIEQRRKKDIKLFMNSSAGE----LSRWRSVPFTHPASFE  194

Query  545  TVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            TV M+++LKN+VK+DL+ FLKS+QYY++LGRVW+RS+LLYG S
Sbjct  195  TVAMDAELKNKVKTDLDQFLKSKQYYNRLGRVWKRSYLLYGAS  237



>ref|XP_010035300.1| PREDICTED: uncharacterized protein LOC104424536 [Eucalyptus grandis]
Length=489

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 161/216 (75%), Gaps = 3/216 (1%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
             LYR++L+  L      ++D+ H +Q +++PQ +++ QENQLYRKV  Y++SL+SL+ SD
Sbjct  24   LLYRTSLLHKLAALLRSVEDRCHAYQHYRIPQYSEHLQENQLYRKVSTYLSSLASLDGSD  83

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrri  388
            FTNL + A  +SND+VL LD ++ V D+FL A +SW N+      R+ VL+I+K+D+RR+
Sbjct  84   FTNLFSGA--RSNDVVLRLDPDRPVADRFLSAPLSWANEAGGPERRAFVLKIRKRDRRRV  141

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG-RWRSVPFTHPSTFETVVMESD  565
            L+PYLQHI  VSD IEQ++ E++LFMN          G RW SVPFTHP+T +TVVM+ +
Sbjct  142  LQPYLQHIFQVSDEIEQKKNEVRLFMNLDGGDRPGEGGPRWLSVPFTHPATIDTVVMDPE  201

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LK +VKSDLE+FLKS+QYYH+LGRVW+RS+LL+G S
Sbjct  202  LKGKVKSDLESFLKSKQYYHRLGRVWKRSYLLHGAS  237



>ref|XP_007039156.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
 gb|EOY23657.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
Length=479

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 153/205 (75%), Gaps = 9/205 (4%)
 Frame = +2

Query  62   RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVK  241
            R   DW     HV+Q ++VP+ N   Q+N+LY KV  Y+NSL SLEDSDFTNL   +  K
Sbjct  35   RSLGDW----FHVYQSYRVPEFNDLFQDNELYHKVSTYLNSLPSLEDSDFTNLFTGS--K  88

Query  242  SNDIVLCLDDNQVVQDQFLGARVSW-MNKVHDGGGRSLVlrikkkdkrrilrPYLQHIHT  418
            SNDIVL LD NQ + D FLGARV+W + K  +   R  VLR++K DKRRILRPYLQHI +
Sbjct  89   SNDIVLHLDTNQTIGDTFLGARVTWTVEKSENNRSRVFVLRLRKNDKRRILRPYLQHILS  148

Query  419  VSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLET  598
             +D+I+QR++E+KL MN  + +     GRWRSVPF HP++F+T+VM+ DLKNRVK+DLE 
Sbjct  149  AADDIDQRKKEIKLHMN--VENSSGQNGRWRSVPFHHPASFDTLVMDVDLKNRVKADLEM  206

Query  599  FLKSQQYYHKLGRVWRRSFLLYGPS  673
            FLKS+QYYH+LGRVW+RS+LLYG S
Sbjct  207  FLKSKQYYHRLGRVWKRSYLLYGAS  231



>ref|XP_004510634.1| PREDICTED: uncharacterized protein LOC101511087 [Cicer arietinum]
Length=483

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 164/228 (72%), Gaps = 11/228 (5%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V   +R  L+++ L++A +K    + D  HV+Q+ KVP+ N+N Q N+LYRKV +Y++SL
Sbjct  16   VCFVIRWLLFKTGLIYATKKLQRKLQDCFHVYQYLKVPEFNENMQRNELYRKVSLYLHSL  75

Query  188  SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH--DGGGRSLVlr  361
             SLEDSDFTNL+       NDIVL +D NQ+++D+FLGA + W NK    D  G + VL+
Sbjct  76   PSLEDSDFTNLITGH--NQNDIVLSIDSNQLIEDRFLGATLFWSNKKTEPDRTG-AFVLK  132

Query  362  ikkkdkrrilrPYLQHIHTVSDNIEQR-RRELKLFMNRSLASDDSAAGR---WRSVPFTH  529
            I+K DKRRILR YL+HIH VSD I  R  R+L+LF+N  +   D   GR   W+SV FTH
Sbjct  133  IRKTDKRRILRSYLRHIHDVSDEITNRGERDLQLFVN--VTGSDGGGGRRTRWKSVAFTH  190

Query  530  PSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            P+TFET+ ME+DLKN++KSDLE+FLK++QYY ++GR W+RSFLLYG S
Sbjct  191  PATFETMAMETDLKNKIKSDLESFLKAKQYYRRIGRAWKRSFLLYGES  238



>ref|XP_010693170.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 157/218 (72%), Gaps = 10/218 (5%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +RLFL R      L+ W + I DK H HQF KVP+ N N QENQL+R+V +Y+NSL SLE
Sbjct  22   LRLFLKRKIRTSKLKNWWNLISDKFHDHQFLKVPEFNDNNQENQLFRRVSLYLNSLESLE  81

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            +SDF NL   +  K  DI+L L+ NQ + D FL A + W   V     +S +L+I+K+DK
Sbjct  82   NSDFINLF--SGTKPTDILLSLNPNQTIVDHFLDAPLIWSYDVVSPTQKSFLLKIRKRDK  139

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            RR+LRPYLQHIHT+SD+I+ R ++++LF N       S +G W++VPF+HP+T ET+ M+
Sbjct  140  RRVLRPYLQHIHTISDDIDHRVKDIRLFTN-------STSG-WKTVPFSHPATIETISMD  191

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            SDLK ++KSDLETF KS+ YYH+LGRVWRRS+LLYGPS
Sbjct  192  SDLKLKIKSDLETFQKSKLYYHRLGRVWRRSYLLYGPS  229



>ref|XP_009599055.1| PREDICTED: uncharacterized protein LOC104094765 [Nicotiana tomentosiformis]
Length=499

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 16/221 (7%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            F  +++L+  L+KW   +++K  V+Q++KVPQ N N QENQLYR++  Y+NSL  LEDS+
Sbjct  17   FASKTSLLDILKKWLRLLEEKCCVYQYYKVPQFNHNMQENQLYRQISTYLNSLPCLEDSN  76

Query  209  FTNLVNSAAVKSNDIVLCLDD---NQVVQDQFLGARVSWMNKVHDGGG-RSLVlrikkkd  376
            F NL   +  KSN+I L LDD   N +V D FLGARV W+N+  D  G  S VL+I+KKD
Sbjct  77   FINLF--SGYKSNEINLLLDDSNQNIIVVDNFLGARVCWINEKDDKTGLNSFVLKIRKKD  134

Query  377  krrilrPYLQHIHTVSDNIEQRRRE--LKLFMNRSLASDDSAAGRWRSVPFTHPSTFETV  550
            KRR+LRPYLQHIHT  D IEQR  E  ++LF+N           RW SVPFTHP+TF+TV
Sbjct  135  KRRLLRPYLQHIHTKFDEIEQRGNEVMMRLFIN--------INRRWISVPFTHPATFDTV  186

Query  551  VMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            VME DLKN+VK+DL+TFLKS+Q+Y ++GR+W+R++LLYGPS
Sbjct  187  VMEQDLKNKVKADLDTFLKSKQHYTRIGRIWKRNYLLYGPS  227



>ref|XP_008790554.1| PREDICTED: nuclear valosin-containing protein-like [Phoenix dactylifera]
Length=511

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 156/227 (69%), Gaps = 8/227 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V   A +R  L   AL++ L +W  W+D+++  +Q+F++P+ N+N+QEN LYRKV  YV 
Sbjct  15   VCGLAILRTILSARALLYHLGRWWRWVDERVQAYQYFEIPRYNENSQENPLYRKVANYVA  74

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK----VHDGGGRS  349
            SL SLED+    L +S   K ND +L L   Q   D FLGARV+W N+        GG  
Sbjct  75   SLPSLEDAAAATLFSSGR-KPNDFLLHLGPGQSASDSFLGARVTWSNRPPGGATAAGGGC  133

Query  350  LVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTH  529
            LVLR++++D+ R+LRPYLQH+ +V+++IE RRRE++LF N   A       RWRSVPFTH
Sbjct  134  LVLRVRRQDRTRVLRPYLQHVESVAEDIEIRRREVRLFTN---AGGSGEGPRWRSVPFTH  190

Query  530  PSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            PST +TV M+ DLK RV++DLE FLK + YYH+LGRVWRRS+LLYGP
Sbjct  191  PSTLDTVAMDPDLKTRVRADLEAFLKGRAYYHRLGRVWRRSYLLYGP  237



>gb|EYU19673.1| hypothetical protein MIMGU_mgv1a027053mg [Erythranthe guttata]
Length=470

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 149/215 (69%), Gaps = 22/215 (10%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
             L +++L+ +L+K   ++++K +V+QF++VP+ N N QENQLYRKV+ Y+NSL  +EDSD
Sbjct  22   ILSKTSLIHSLKKSWRFVEEKCYVYQFYRVPKFNDNMQENQLYRKVYAYLNSLPCVEDSD  81

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrri  388
            F NL   +  KS +I L LD+NQ + DQFLGAR+   +K      R LV           
Sbjct  82   FANLF--SGTKSTEINLILDENQTIADQFLGARIRKNDKR-----RILV-----------  123

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDL  568
              PYLQ IH   D IEQ+R+E++LF+N  + +     GRWRS  FTHP+T +T+VM++DL
Sbjct  124  --PYLQSIHQAFDEIEQKRKEVRLFVN--VENGLRGDGRWRSTSFTHPATMDTIVMDADL  179

Query  569  KNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            K R+KSDLE FLKS+QYYH+LGRVW+RS+LLYG +
Sbjct  180  KTRIKSDLENFLKSRQYYHRLGRVWKRSYLLYGSA  214



>ref|XP_004145938.1| PREDICTED: uncharacterized protein LOC101204309 [Cucumis sativus]
Length=519

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 157/218 (72%), Gaps = 12/218 (6%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            F+ +++LV+ + K    I D  HV+QF+++PQ ++N Q NQLY +V  Y++SL SLEDS+
Sbjct  67   FITKTSLVYMIVKGFQAITDYFHVYQFYRIPQFDENLQHNQLYLRVHTYLHSLPSLEDSN  126

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGR-----SLVlrikkk  373
            F N+   A  K  DI L LD NQ V D FLGA++ W  ++H    R     SL+L+++K 
Sbjct  127  FANIFCGA--KPGDIFLRLDTNQTVHDSFLGAKLRWKIEMHTDHHRQNNLFSLLLKLRKD  184

Query  374  dkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVV  553
            DKRRI R Y QHI +++D IEQ++RE+K+ +N      D  A RW++VPFTHP+TF TVV
Sbjct  185  DKRRIFRQYFQHILSITDEIEQQKREIKMHINV-----DGGARRWKAVPFTHPATFGTVV  239

Query  554  MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            M++DLKN+VKSDLE FLKS+QYYHKLGRVW+RSFLLYG
Sbjct  240  MDADLKNKVKSDLEQFLKSKQYYHKLGRVWKRSFLLYG  277



>gb|KGN49849.1| hypothetical protein Csa_5G139270 [Cucumis sativus]
Length=524

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 157/218 (72%), Gaps = 12/218 (6%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            F+ +++LV+ + K    I D  HV+QF+++PQ ++N Q NQLY +V  Y++SL SLEDS+
Sbjct  72   FITKTSLVYMIVKGFQAITDYFHVYQFYRIPQFDENLQHNQLYLRVHTYLHSLPSLEDSN  131

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGR-----SLVlrikkk  373
            F N+   A  K  DI L LD NQ V D FLGA++ W  ++H    R     SL+L+++K 
Sbjct  132  FANIFCGA--KPGDIFLRLDTNQTVHDSFLGAKLRWKIEMHTDHHRQNNLFSLLLKLRKD  189

Query  374  dkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVV  553
            DKRRI R Y QHI +++D IEQ++RE+K+ +N      D  A RW++VPFTHP+TF TVV
Sbjct  190  DKRRIFRQYFQHILSITDEIEQQKREIKMHINV-----DGGARRWKAVPFTHPATFGTVV  244

Query  554  MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            M++DLKN+VKSDLE FLKS+QYYHKLGRVW+RSFLLYG
Sbjct  245  MDADLKNKVKSDLEQFLKSKQYYHKLGRVWKRSFLLYG  282



>ref|XP_010662911.1| PREDICTED: 26S protease regulatory subunit 6B-like [Vitis vinifera]
Length=475

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 162/222 (73%), Gaps = 9/222 (4%)
 Frame = +2

Query  5    SVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNS  184
            + F  +RL L +++++  +RKW   + D  +V Q ++VPQ NQ  QEN+LYRK+  Y+NS
Sbjct  15   ATFLILRLLL-KTSVILIVRKWVRSLGDMCYVWQCYRVPQYNQLLQENELYRKLSAYINS  73

Query  185  LSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGR-SLVlr  361
            L+S+EDSDF NLV  +  +SND+VL LD NQ V D +LGARV+W N V +  GR   VLR
Sbjct  74   LASVEDSDFANLVTGS--RSNDVVLSLDPNQTVFDSYLGARVAWTNVVGESDGRRCFVLR  131

Query  362  ikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
            I+KKDKRRILRPYLQHI    +  E   +ELKL++N    S   + GRWRSVPFTH +T 
Sbjct  132  IRKKDKRRILRPYLQHILAKYEEFE---KELKLYIN--CESRRLSDGRWRSVPFTHQATM  186

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            ETV M+SDLK++VKSDLE FLKS+QYY +LGRVW+RS+LL+G
Sbjct  187  ETVAMDSDLKSKVKSDLELFLKSKQYYQRLGRVWKRSYLLHG  228



>ref|XP_007147339.1| hypothetical protein PHAVU_006G115600g [Phaseolus vulgaris]
 gb|ESW19333.1| hypothetical protein PHAVU_006G115600g [Phaseolus vulgaris]
Length=478

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 151/208 (73%), Gaps = 15/208 (7%)
 Frame = +2

Query  62   RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVK  241
            R+  DW     HV+QF  VP+LNQ   +NQLY  + +Y++SL S++DS F NLV      
Sbjct  40   RRMEDW----FHVYQFLTVPELNQTKHQNQLYTNLSLYLHSLPSIQDSHFANLVTGK--N  93

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNK---VHDGGGRSLVlrikkkdkrrilrPYLQHI  412
             NDIVLCL  NQ++QD FLGA + W N+    +  G  + VL+I+K DKRRILRPYLQHI
Sbjct  94   QNDIVLCLAPNQIIQDNFLGATIYWFNQPTHTNPKGTGTYVLKIRKVDKRRILRPYLQHI  153

Query  413  HTVSDNIEQR-RRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSD  589
            H V+  IEQ+ +R+L LF N   ++D+   G WRSVPFTHPSTF+T+ ME DLKN+VKSD
Sbjct  154  HAVAHEIEQQGKRDLCLFTN---SADE--FGHWRSVPFTHPSTFDTIAMEPDLKNKVKSD  208

Query  590  LETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LE+FL+++QYYH+ GRVW+RSFLLYGPS
Sbjct  209  LESFLRAKQYYHRNGRVWKRSFLLYGPS  236



>gb|AES72562.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=493

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 165/226 (73%), Gaps = 15/226 (7%)
 Frame = +2

Query  11   FAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLS  190
            +  +R F   SAL F L+ W   ++++LH+HQ FK+P  + N +ENQLYRK+  Y++SL 
Sbjct  22   YLILRFFRKTSALHF-LKHWWLSLENRLHLHQSFKIPLYDHNFRENQLYRKILTYLDSLP  80

Query  191  SLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRS-LVlrik  367
            S++D+DFTNL +      +DI L LD NQ+V D FLGA++SW N    G   S LVLR+K
Sbjct  81   SVQDADFTNLFSGP--NPSDIFLHLDANQIVHDTFLGAKLSWTNNTVAGDSASALVLRMK  138

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRR-ELKLFMNRSLASDDSAAG---RWRSVPFTHPS  535
            KKDKRR+ + Y QHI +V+D +EQRR+ ++KLFMN       S AG   RWRSVPFTHP+
Sbjct  139  KKDKRRVFQQYFQHILSVADELEQRRKKDIKLFMN-------SVAGETYRWRSVPFTHPA  191

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            TFETV M+++LKN+VK+DL+ F+KS+QYY++LGRVW+RS+LLYG S
Sbjct  192  TFETVAMDAELKNKVKTDLDQFIKSKQYYNRLGRVWKRSYLLYGAS  237



>ref|XP_003602311.1| Mitochondrial chaperone BCS1 [Medicago truncatula]
Length=507

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 165/226 (73%), Gaps = 15/226 (7%)
 Frame = +2

Query  11   FAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLS  190
            +  +R F   SAL F L+ W   ++++LH+HQ FK+P  + N +ENQLYRK+  Y++SL 
Sbjct  14   YLILRFFRKTSALHF-LKHWWLSLENRLHLHQSFKIPLYDHNFRENQLYRKILTYLDSLP  72

Query  191  SLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRS-LVlrik  367
            S++D+DFTNL +      +DI L LD NQ+V D FLGA++SW N    G   S LVLR+K
Sbjct  73   SVQDADFTNLFSGP--NPSDIFLHLDANQIVHDTFLGAKLSWTNNTVAGDSASALVLRMK  130

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRR-ELKLFMNRSLASDDSAAG---RWRSVPFTHPS  535
            KKDKRR+ + Y QHI +V+D +EQRR+ ++KLFMN       S AG   RWRSVPFTHP+
Sbjct  131  KKDKRRVFQQYFQHILSVADELEQRRKKDIKLFMN-------SVAGETYRWRSVPFTHPA  183

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            TFETV M+++LKN+VK+DL+ F+KS+QYY++LGRVW+RS+LLYG S
Sbjct  184  TFETVAMDAELKNKVKTDLDQFIKSKQYYNRLGRVWKRSYLLYGAS  229



>emb|CDP05017.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 148/179 (83%), Gaps = 6/179 (3%)
 Frame = +2

Query  140  QENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM  319
            QENQLYRKV  Y++SL ++EDSDFTNL + A  K N+I L LD NQ+V D FLGAR+ W+
Sbjct  2    QENQLYRKVHTYLSSLPAVEDSDFTNLFSGA--KPNEINLVLDPNQIVLDNFLGARLFWI  59

Query  320  NKVHDGGG-RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA  496
            N+  DG G +SLVL+I+K DKRRILRPYLQHIH+V + +EQR+ ++KL++N  +  +   
Sbjct  60   NQKCDGSGLKSLVLKIRKSDKRRILRPYLQHIHSVFEELEQRK-DVKLYIN--VEDEPQR  116

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             GRWRSVPFTHP+T ++VVM+SDLKN+VKSDLE+FLKS+QYY++LGRVW+RS+LLYGPS
Sbjct  117  NGRWRSVPFTHPATIDSVVMDSDLKNKVKSDLESFLKSKQYYNRLGRVWKRSYLLYGPS  175



>ref|XP_004160408.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis sativus]
Length=501

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 156/217 (72%), Gaps = 12/217 (6%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            + +++LV+ + K    I D  HV+QF+++PQ ++N Q NQLY +V  Y++SL SLEDS+F
Sbjct  50   ITKTSLVYMIVKGFQAITDYFHVYQFYRIPQFDENLQHNQLYLRVHTYLHSLPSLEDSNF  109

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGR-----SLVlrikkkd  376
             N+   A  K  DI L LD NQ V D FLGA++ W  ++H    R     SL+L+++K D
Sbjct  110  ANIFCGA--KPGDIFLRLDTNQTVHDSFLGAKLRWKIEMHTDYHRQNNLFSLLLKLRKDD  167

Query  377  krrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            KRRI R Y QHI +++D IEQ++RE+K+ +N      D  A RW++VPFTHP+TF TVVM
Sbjct  168  KRRIFRQYFQHILSITDEIEQQKREIKMHINV-----DGGARRWKAVPFTHPATFGTVVM  222

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            ++DLKN+VKSDLE FLKS+QYYHKLGRVW+RSFLLYG
Sbjct  223  DADLKNKVKSDLEQFLKSKQYYHKLGRVWKRSFLLYG  259



>ref|XP_006599768.1| PREDICTED: uncharacterized protein LOC100792584, partial [Glycine 
max]
Length=281

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 158/228 (69%), Gaps = 8/228 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVY  175
            V V   VR  L+++ L+  +RK    + D  HV+QF KVP+ N+  N + N L+RKV +Y
Sbjct  8    VVVGFTVRWLLFKTGLMHTIRKRFRRVVDWCHVYQFLKVPEFNETNNMRRNNLHRKVSLY  67

Query  176  VNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN-KVHDGGGRSL  352
            ++SL S+ED+DFTNL+        DIVL LD NQ ++D+FLGA + W N K       + 
Sbjct  68   LHSLPSIEDADFTNLITGN--DQTDIVLRLDPNQTIEDRFLGATLYWFNQKTEPNRISTF  125

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIE-QRRRELKLFMNRSLASDDSAAGRWRSVPFTH  529
            VL+I+K DKRRILR YL+HI+TV+D +E Q +R L+LFMN S   D     RWRSVPFTH
Sbjct  126  VLQIRKTDKRRILRQYLRHINTVADEMENQSKRNLRLFMNASAVED--GGTRWRSVPFTH  183

Query  530  PSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            P+ FET+ ME DLKN++KSDLE+FLK++QYY K+GR W+RS+LLYG  
Sbjct  184  PAMFETMAMEKDLKNKIKSDLESFLKAKQYYRKIGRAWKRSYLLYGAG  231



>ref|XP_007136478.1| hypothetical protein PHAVU_009G048600g [Phaseolus vulgaris]
 gb|ESW08472.1| hypothetical protein PHAVU_009G048600g [Phaseolus vulgaris]
Length=482

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 156/215 (73%), Gaps = 10/215 (5%)
 Frame = +2

Query  26   LFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  205
             F  +++ +  L +W    +++LH+HQ FK+P+ N +AQENQLYR++  Y++SL S++DS
Sbjct  22   FFFRKTSALHILNQWFLSFENRLHIHQSFKIPRYNLHAQENQLYRQILTYLDSLPSVQDS  81

Query  206  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrr  385
            D+TNL   +    +DI L LD N  V D FLGA++SW       GG + VLRIKKKDKRR
Sbjct  82   DYTNLF--SGTNPSDIFLHLDPNHTVHDTFLGAKLSWTKDAAVSGGDAFVLRIKKKDKRR  139

Query  386  ilrPYLQHIHTVSDNIEQ-RRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMES  562
            + R Y QHI +V+D IEQ R++++KL++N       S A  WRS PFTHP++F+TV ME+
Sbjct  140  VFRQYFQHILSVADEIEQHRKKDIKLYVN-------SGAREWRSAPFTHPASFDTVAMEA  192

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            +LKN+VKSDL+ FLKS+QYYH+LGRVW+RS+LLYG
Sbjct  193  ELKNKVKSDLDQFLKSKQYYHRLGRVWKRSYLLYG  227



>gb|KHN23332.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=463

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 156/211 (74%), Gaps = 14/211 (7%)
 Frame = +2

Query  38   RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  217
            +++ +  L +W    +++LH+HQ FK+P+ N ++QEN LYRK+  Y++SL S+EDSD+TN
Sbjct  20   KTSALHILNQWFLSFENRLHLHQSFKIPRYNLHSQENSLYRKILTYLDSLPSVEDSDYTN  79

Query  218  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilrP  397
            L +      +DI L LD N  V D FLGAR+SW N      G +LVLR+KKKDKRR+ R 
Sbjct  80   LFSGP--NPSDIFLHLDPNHTVHDTFLGARLSWTN----ASGDALVLRLKKKDKRRVFRQ  133

Query  398  YLQHIHTVSDNIEQRRR-ELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            Y QHI +V+D IEQRR+ ++KL++N       S +G WRS PFTHP++FETV M+++LKN
Sbjct  134  YFQHILSVADEIEQRRKKDVKLYVN-------SDSGEWRSAPFTHPASFETVAMDAELKN  186

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            +VKSDLE F+KS+QYYH+LGRVW+RS+LLYG
Sbjct  187  KVKSDLEQFVKSKQYYHRLGRVWKRSYLLYG  217



>ref|XP_003529879.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=476

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 160/227 (70%), Gaps = 9/227 (4%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQ-NAQENQLYRKVFVYV  178
            V V   +R FL+++ L+  +R     + D  HV+QF KVP+ N+ N Q N L+RKV +Y+
Sbjct  14   VVVGFTIRWFLFKTGLIHTIRIRFPRVVDWFHVYQFLKVPEFNETNMQPNNLHRKVSLYL  73

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN-KVHDGGGRSLV  355
            +SL S+ED+D+TNL+   A   +DIVL LD NQ ++D+FLGAR+ W N K       S V
Sbjct  74   HSLPSIEDADYTNLI--TANDQSDIVLRLDPNQTIEDRFLGARLYWFNQKTEPNRISSFV  131

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIE-QRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
            L+I+K DKRRILR YL+HI T++D +  Q +R L+LFMN    +      RWRSVPFTHP
Sbjct  132  LQIRKTDKRRILRQYLRHIDTIADEMNNQSKRHLRLFMN----AGAGGGTRWRSVPFTHP  187

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +TFET+ ME DLKN++KSDLE+FLK++QYY KLGR W+RS+LLYG S
Sbjct  188  ATFETMAMEKDLKNKIKSDLESFLKAKQYYRKLGRAWKRSYLLYGAS  234



>ref|XP_008437620.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis melo]
Length=447

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 146/201 (73%), Gaps = 12/201 (6%)
 Frame = +2

Query  80   IDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVL  259
            I D  HV+QF+++PQ ++N Q NQLY +V  Y++S  SLEDSDF N+   A  K  DI L
Sbjct  9    ITDCFHVYQFYRIPQFDENLQHNQLYLRVHTYLHSFPSLEDSDFANIFCGA--KPGDIFL  66

Query  260  CLDDNQVVQDQFLGARVSWMNKVHDGGGR-----SLVlrikkkdkrrilrPYLQHIHTVS  424
             LD +Q V D FLGA++ W  ++H    R     SL+L+++K DKRRI R Y QHI +++
Sbjct  67   RLDTSQTVHDSFLGAKLRWKIEMHTDHHRQNNHFSLLLKLRKDDKRRIFRQYFQHILSIT  126

Query  425  DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFL  604
            D IEQ++RE+K+ +N      D  A RW++VPFTHP+TF TVVM++DLKN+VKSDLE FL
Sbjct  127  DEIEQQKREIKMHINV-----DGGARRWKAVPFTHPATFGTVVMDADLKNKVKSDLEQFL  181

Query  605  KSQQYYHKLGRVWRRSFLLYG  667
            KS+QYYHKLGRVW+RSFLLYG
Sbjct  182  KSKQYYHKLGRVWKRSFLLYG  202



>ref|XP_003626582.1| Mitochondrial chaperone BCS1 [Medicago truncatula]
 gb|AES82800.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=468

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 149/215 (69%), Gaps = 10/215 (5%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++ + L+    K    I+D  HV+Q F VP+LN N Q N LYRK+ +Y +SL SL++S  
Sbjct  26   IFETGLIHESTKLWRIIEDWFHVYQVFHVPELNDNMQHNTLYRKLSLYFHSLPSLQNSQL  85

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrril  391
             NLV S     ND+VL L  NQ + D FLGA VSW N+      R+ +LRI+K DK+RIL
Sbjct  86   NNLVTSNT-NQNDVVLTLAPNQTIHDHFLGATVSWFNQTQPN--RTFILRIRKFDKQRIL  142

Query  392  rPYLQHIHTVSDNIE-QRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDL  568
            R Y+QHIH V D IE Q  R+L+ +MN   ASD    G WR VPFTHPSTFET+ ME+DL
Sbjct  143  RAYIQHIHAVVDEIEKQGNRDLRFYMN---ASD---FGPWRFVPFTHPSTFETITMETDL  196

Query  569  KNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            KNRVKSDLE+FLK +QYYH+LGR+W+RSFLLYG S
Sbjct  197  KNRVKSDLESFLKGKQYYHRLGRLWKRSFLLYGSS  231



>ref|XP_003523343.1| PREDICTED: mitochondrial chaperone BCS1-like isoform 1 [Glycine 
max]
Length=480

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 157/217 (72%), Gaps = 14/217 (6%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +  F  +++ +  L +W    +++LH+HQ FK+P+ N ++ +N LYRK+  Y++SL S+E
Sbjct  20   IVFFFRKTSALHILNQWFLSFENRLHLHQSFKIPRYNLHSLDNSLYRKILTYLDSLPSVE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            DSD+TNL +      +DI L LD N  V D FLGAR+SW N      G +LVLR+KKKDK
Sbjct  80   DSDYTNLFSGP--NPSDIFLHLDPNHTVHDTFLGARLSWTN----ASGDALVLRLKKKDK  133

Query  380  rrilrPYLQHIHTVSDNIEQRRR-ELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            RR+ R Y QHI +V+D IEQRR+ ++KL++N       S +G WRS PFTHP++FETV M
Sbjct  134  RRVFRQYFQHILSVADEIEQRRKKDVKLYVN-------SDSGEWRSAPFTHPASFETVAM  186

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            +++LKN+VKSDL+ FLKS+QYYH+LGRVW+RS+LLYG
Sbjct  187  DAELKNKVKSDLDQFLKSKQYYHRLGRVWKRSYLLYG  223



>gb|EPS72484.1| hypothetical protein M569_02272 [Genlisea aurea]
Length=482

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 157/221 (71%), Gaps = 16/221 (7%)
 Frame = +2

Query  26   LFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ-ENQLYRKVFVYVNSLSSLED  202
            LFL+R+AL+F ++KWS+ + + +HV+Q  +VP+L+   Q EN  YR+V +YVNSL SLED
Sbjct  22   LFLHRTALIFVVKKWSEGVLNAVHVYQHLRVPELDGLTQRENHFYRRVSLYVNSLPSLED  81

Query  203  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGG-----GRSLVlrik  367
            SD+ NL++    ++NDI+L  +  Q + D FL AR+SW+N++          RS  LRI+
Sbjct  82   SDYANLISGK--RANDIILSPEGGQPIGDVFLSARLSWVNRIERDDRNRVVSRSFELRIR  139

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFET  547
            KKDKRR+L+PYL+HIH VS +IEQR ++LK+  N          G W   PF HP+ FET
Sbjct  140  KKDKRRVLQPYLRHIHAVSGDIEQRGKQLKIHNN--------VDGEWIPAPFAHPANFET  191

Query  548  VVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +V++ ++K ++K DLETF+KS+Q YHKLGR+W+RS+LLYGP
Sbjct  192  LVLDPEVKAKIKHDLETFVKSEQQYHKLGRLWKRSYLLYGP  232



>dbj|BAJ87142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 142/212 (67%), Gaps = 11/212 (5%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  214
            Y+SA   A R W  W D+    +Q+++VP+      EN L+RK   YV SL SLED+D  
Sbjct  31   YKSAAHAARRLWR-WADEWAQAYQYYEVPRFAGEGAENPLFRKAAAYVASLPSLEDADAA  89

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilr  394
             +++SA+ KSND  L L       D FLGAR++W N     GG  LVLR+++ D+ R+LR
Sbjct  90   CVLSSAS-KSNDFSLQLGPGHTAHDAFLGARLAWTN-----GGERLVLRVRRHDRTRVLR  143

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            PYLQH+ +V+D +E RRR+L+L+ N   A     A RW S PFTHP+T +TV M+ DLK 
Sbjct  144  PYLQHVESVADEMELRRRDLRLYANTGAA----LAPRWSSAPFTHPATLDTVAMDPDLKT  199

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            RV+SDLE+FLK + YYH+LGRVWRRS+LLYGP
Sbjct  200  RVRSDLESFLKGRAYYHRLGRVWRRSYLLYGP  231



>ref|XP_008664748.1| PREDICTED: transitional endoplasmic reticulum ATPase-like [Zea 
mays]
 tpg|DAA49287.1| TPA: hypothetical protein ZEAMMB73_293837 [Zea mays]
Length=504

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 147/217 (68%), Gaps = 6/217 (3%)
 Frame = +2

Query  17   AVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSL  196
            AVRL L   +   ALR+   W D++   +Q ++VP+L  +  EN L+RK   YV SL SL
Sbjct  21   AVRLVLSYKSAAHALRRAWRWADERAQAYQHYEVPRLAADGAENPLFRKAAAYVASLPSL  80

Query  197  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkd  376
            ED+D   +++SAA KSN   L L      +D FLGAR++W +   D     LVLR+++ D
Sbjct  81   EDADAACVLSSAA-KSNGFALRLGPGHAARDAFLGARLAWTSAGAD----RLVLRVRRHD  135

Query  377  krrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            + R+LRPYLQH+ +V+D +E RRREL+L+ + S A   S A RW S PFTHP+T +TV M
Sbjct  136  RTRVLRPYLQHLESVADEMEARRRELRLYASASGAGS-SPAPRWTSAPFTHPATLDTVAM  194

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            + +LK RV++DLE+FLK + YYH+LGRVWRRS+LLYG
Sbjct  195  DPELKARVRADLESFLKGRGYYHRLGRVWRRSYLLYG  231



>ref|XP_010671395.1| PREDICTED: uncharacterized protein LOC104888200 [Beta vulgaris 
subsp. vulgaris]
Length=480

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 164/225 (73%), Gaps = 5/225 (2%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            VS+F  +RL LY +++   +  W  ++ D  H++  +K+PQ N + QENQL+RKVF Y+ 
Sbjct  16   VSIFILLRL-LYHTSVFHIIISWLIFLLDHFHIYHLYKIPQYNDHFQENQLFRKVFTYIR  74

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM-NKVHDGGGRSLVl  358
            SL SLEDSDF  L   +  K  DI++ L+ +  V D FL A+V+W+ NK ++  G ++VL
Sbjct  75   SLPSLEDSDFAALF--SGDKPGDILVSLNSDGYVTDTFLRAKVTWIYNKSNNYEG-NVVL  131

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            ++K KDK+RIL PY+QHI+ V D+IEQ+++EL++++N S   +D    +WRS PF +PS+
Sbjct  132  KMKSKDKKRILVPYIQHIYKVVDDIEQKKKELRIYLNCSSNDNDGLNSQWRSFPFVNPSS  191

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            F+ +V+++D+K++VK+DLE +LKS+QYY+K+GR WRRS+LLYG S
Sbjct  192  FDNIVLDNDVKSKVKNDLEVYLKSKQYYNKIGRAWRRSYLLYGGS  236



>ref|XP_004982590.1| PREDICTED: uncharacterized protein LOC101755261 [Setaria italica]
Length=523

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 148/222 (67%), Gaps = 11/222 (5%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVN  181
            V   AA+RL L   +   ALR+   W D+    +Q+++VP+L  +  EN L+RK   YV 
Sbjct  21   VLAVAALRLVLSYKSAAHALRRAWRWADEWAQAYQYYEVPRLAGDDAENPLFRKAAAYVA  80

Query  182  SLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlr  361
            SL SLED+D   +++SAA KSN+  L L      +D FLGAR++W N    G GR LVLR
Sbjct  81   SLPSLEDADAACVLSSAA-KSNEFALQLGPGHAARDAFLGARLAWTNA---GDGR-LVLR  135

Query  362  ikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
            +++ D+ R+LRPYLQH+ +V+D +E RRREL+L+ N         A RW S PFTHP+T 
Sbjct  136  VRRHDRTRVLRPYLQHVESVADEMEARRRELRLYAN------TGGAPRWASAPFTHPATL  189

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            +TV M+ +LK RV++DLE FLK + YYH+LGRVWRRS+LLYG
Sbjct  190  DTVAMDPELKARVRADLEGFLKGRAYYHRLGRVWRRSYLLYG  231



>ref|XP_008644692.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Zea mays]
 gb|AFW68354.1| hypothetical protein ZEAMMB73_211551 [Zea mays]
Length=513

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 141/211 (67%), Gaps = 10/211 (5%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  214
            Y+SA     R W  W D+    +Q+++VP+L  +  EN L+RK   YV SL SLED+D  
Sbjct  31   YKSAAHAVRRAWR-WADEWAQAYQYYEVPRLAVDGAENPLFRKAAAYVASLPSLEDADAA  89

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilr  394
             +++SAA KSND  L L      +D FLGAR++W N   DG    LVLR+++ D+ R+LR
Sbjct  90   CVLSSAA-KSNDFALQLGPGHTARDAFLGARLAWTNAGGDG---RLVLRVRRHDRTRVLR  145

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            PYLQH+ +V+D +E RRREL++  N         A RW S PFTHP+T +TV M+ DLK 
Sbjct  146  PYLQHLESVADEMEARRRELRVHANAG-----GGAPRWASAPFTHPATLDTVAMDPDLKA  200

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            RV++DLE+FLK + YYH+LGRVWRRS+LLYG
Sbjct  201  RVRADLESFLKGRAYYHRLGRVWRRSYLLYG  231



>ref|XP_003527995.2| PREDICTED: mitochondrial chaperone BCS1-like [Glycine max]
Length=475

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 154/213 (72%), Gaps = 12/213 (6%)
 Frame = +2

Query  38   RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  217
            +++ +  L +W    +++LH+HQ FK+P+ N ++QEN LYRK+  Y++SL S+EDSD+TN
Sbjct  26   KTSALHILNQWFLSFENRLHLHQSFKIPRYNLHSQENSLYRKILTYLDSLPSVEDSDYTN  85

Query  218  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRS--LVlrikkkdkrril  391
            L +      +DI L LD N  V D FLGA++SW N      G +  LVLR+KKKDKRR+ 
Sbjct  86   LFSGP--NPSDIFLHLDPNHTVHDTFLGAKLSWTNAAAAATGGADALVLRLKKKDKRRVF  143

Query  392  rPYLQHIHTVSDNIEQRRR-ELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDL  568
            R Y QHI +V+D IEQRR+ ++ +++N       S AG W S PFTHP++FETV M+++L
Sbjct  144  RQYFQHILSVADEIEQRRKKDVTMYVN-------SGAGEWGSAPFTHPASFETVAMDAEL  196

Query  569  KNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            KN+VKSDLE F+KS+QYYH+LGRVW+RS+LLYG
Sbjct  197  KNKVKSDLEQFVKSKQYYHRLGRVWKRSYLLYG  229



>ref|XP_002464362.1| hypothetical protein SORBIDRAFT_01g016970 [Sorghum bicolor]
 gb|EER91360.1| hypothetical protein SORBIDRAFT_01g016970 [Sorghum bicolor]
Length=531

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 150/224 (67%), Gaps = 12/224 (5%)
 Frame = +2

Query  17   AVRLFL-YRSALVFALRKWSDWIDDKLHVHQFFKVPQL-----NQNAQENQLYRKVFVYV  178
            A+RL L Y+SA     R W  W D+    +Q+++VP+L     +    EN L+RK   YV
Sbjct  25   ALRLVLSYKSAAHAVRRAWR-WADEWAQAYQYYEVPRLVAAAGDGGGAENPLFRKAAAYV  83

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVl  358
             SL SLED+D   +++SAA KSND  L L      +D FLGAR++W N    G GR LVL
Sbjct  84   ASLPSLEDADAACVLSSAA-KSNDFALQLGPGHTARDAFLGARLAWTNA---GDGRGLVL  139

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDS-AAGRWRSVPFTHPS  535
            R+++ D+ R+LRPYLQH+ +V+D +E RRREL+L+ N +  +     A RW S PFTHP+
Sbjct  140  RVRRHDRTRVLRPYLQHVESVADEMEARRRELRLYANANAGAGGGDCAPRWTSAPFTHPA  199

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            T +TV M+ DLK RV++DLE+FLK + YYH+LGRVWRRS+LLYG
Sbjct  200  TLDTVAMDPDLKARVRADLESFLKGRAYYHRLGRVWRRSYLLYG  243



>ref|XP_004986004.1| PREDICTED: uncharacterized protein LOC101775542 [Setaria italica]
Length=515

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 144/212 (68%), Gaps = 6/212 (3%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  214
            Y+SAL +ALR+     D+    +Q+ +VP+   +  EN L+RK   YV +L SLED+D T
Sbjct  33   YKSAL-YALRRLWRCADEWAQAYQYHEVPRFACDGAENPLFRKAAAYVAALPSLEDADAT  91

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilr  394
            ++++SA+  +  + L L      +D FLGAR++W N   D     LVLR+++ D+ R+LR
Sbjct  92   SVLSSASRTNGGLSLQLGPGHTARDAFLGARLAWTNTDDD----RLVLRVRRHDRTRVLR  147

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            PYLQH+ +V+D +EQRRREL+LF N  +    + A RW S PFTHP+T + V M+ DLK 
Sbjct  148  PYLQHVESVADEMEQRRRELRLFANTGV-DGTTGAPRWASAPFTHPATLDAVAMDPDLKA  206

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            RV++DLE+FLK + YYH+LGR WRRS+LLYGP
Sbjct  207  RVRADLESFLKGRAYYHRLGRAWRRSYLLYGP  238



>ref|XP_002465991.1| hypothetical protein SORBIDRAFT_01g049680 [Sorghum bicolor]
 gb|EER92989.1| hypothetical protein SORBIDRAFT_01g049680 [Sorghum bicolor]
Length=525

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 145/215 (67%), Gaps = 7/215 (3%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQL---NQNAQENQLYRKVFVYVNSLSSLEDS  205
            Y+SAL +ALR+     D+    +Q+ +VP+      +  EN L+RK   YV +L SLED+
Sbjct  28   YKSAL-YALRRLWRCADEWAQAYQYHEVPRFAGAGCDGAENPLFRKAAAYVAALPSLEDA  86

Query  206  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrr  385
            D   +V+SA+  +  + L L      +D FLGAR+SW +    GG   LVLR+++ D+ R
Sbjct  87   DAACVVSSASRTNGGLSLQLGPGHTARDAFLGARLSWTSA--GGGPERLVLRVRRHDRSR  144

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            +LRPYLQH+ +V+D +EQRRREL+LF N    +D + A RW S PFTHP+T + V M+ D
Sbjct  145  VLRPYLQHVESVADEMEQRRRELRLFANAGTDAD-TGAPRWASAPFTHPATLDDVAMDPD  203

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            LK RV++DLE+FLK + YYH+LGRVWRRS+LLYGP
Sbjct  204  LKARVRADLESFLKGRAYYHRLGRVWRRSYLLYGP  238



>ref|XP_009382317.1| PREDICTED: uncharacterized protein LOC103970312 [Musa acuminata 
subsp. malaccensis]
Length=517

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 149/218 (68%), Gaps = 3/218 (1%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R+ L   +LV+   +W  W+D++   +Q F++P+ +++ QEN LYR+   YV +L SLE
Sbjct  20   LRIVLSLKSLVYCWGRWWRWVDERTQAYQSFEIPRYSESGQENPLYRRAAAYVAALPSLE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDG-GGRSLVlrikkkd  376
            D+    L +S   K ND  L L   Q   D FLG RVSW N    G GG  LVLR++++D
Sbjct  80   DAAAATLFSSGR-KPNDFFLLLGPGQSAADSFLGDRVSWTNAPAGGAGGPRLVLRLRRQD  138

Query  377  krrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            + R+LRPYLQH+ +V+D++E RR+E++LF + +    D    RWRS PFTHP+T +TV M
Sbjct  139  RTRVLRPYLQHVESVADDLELRRKEVRLFTSYA-GVGDGGGPRWRSAPFTHPATLDTVAM  197

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + DLK RV++DLE+FLK + YYH++GRVWRRS+LLYGP
Sbjct  198  DLDLKARVRADLESFLKGRAYYHRVGRVWRRSYLLYGP  235



>ref|NP_001150338.1| ATP binding protein [Zea mays]
 gb|ACG38730.1| ATP binding protein [Zea mays]
 gb|ACN27703.1| unknown [Zea mays]
 tpg|DAA42904.1| TPA: ATP binding protein [Zea mays]
Length=523

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 147/217 (68%), Gaps = 11/217 (5%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVP-----QLNQNAQENQLYRKVFVYVNSLSSLE  199
            Y+SAL +ALR+     D+    +Q+ +VP     Q   +  EN L+RKV  YV +L SLE
Sbjct  24   YKSAL-YALRRLWRCADEWAQAYQYHEVPRFAGAQCGCDGAENPLFRKVAAYVAALPSLE  82

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            D+D   +V+SA+  +  + L L      +D +LGAR++W +     GG  LVLR+++ D+
Sbjct  83   DADAACVVSSASRTNGGLSLQLGPGHTARDTYLGARLAWTSA----GGERLVLRVRRHDR  138

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
             R+LRPYLQH+ +V++ +EQRRREL+LF N ++ +  + A RW S PFTHP+T + V M+
Sbjct  139  SRVLRPYLQHVESVAEEMEQRRRELRLFANTAVDAT-TGAPRWASAPFTHPATLDAVAMD  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             DLK RV++DLE+FLK + YYH+LGRVWRRS+LLYGP
Sbjct  198  PDLKARVRADLESFLKGRAYYHRLGRVWRRSYLLYGP  234



>ref|XP_003574206.1| PREDICTED: uncharacterized protein LOC100834121 [Brachypodium 
distachyon]
Length=520

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 138/216 (64%), Gaps = 11/216 (5%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQ-LNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            Y+SA   A R W  W D+    +Q+++VP+ L     EN L+RK   YV+SL SLED+D 
Sbjct  28   YKSAAHAARRLWR-WADEWAQAYQYYEVPRFLGGGGDENPLFRKAAAYVSSLPSLEDADA  86

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk---r  382
              +++SA+ KSND  L L      +D FLGAR++W N        +    + +  +    
Sbjct  87   ACVLSSAS-KSNDFALQLGPGHTARDAFLGARLAWTNAGGGAAAGARERLVLRVRRHDRT  145

Query  383  rilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMES  562
            R+LRPYLQH+ +V+D +E RRREL+L  N       +AA RW S PFTHP+T +TV M+ 
Sbjct  146  RVLRPYLQHVESVADEMELRRRELRLHANTG-----AAAPRWASAPFTHPATLDTVAMDP  200

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +LK R+++DLETFLK + YYH+LGRVWRRS+LLYGP
Sbjct  201  ELKTRIRADLETFLKGRAYYHRLGRVWRRSYLLYGP  236



>ref|XP_009411477.1| PREDICTED: uncharacterized protein LOC103993224 [Musa acuminata 
subsp. malaccensis]
Length=498

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 147/216 (68%), Gaps = 2/216 (1%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R+ L    LV  L +W  W++++   +Q F++P+ +   QEN LYR+   YV +L SLE
Sbjct  20   LRIVLSFKTLVHCLGRWWRWVEERTQAYQNFEIPRYSDCGQENPLYRRAAAYVAALPSLE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdk  379
            D+   NL +S   K ND  L L       D FLGARVSW N    GG   LVLR++++D+
Sbjct  80   DAAAANLFSSGR-KPNDFFLLLGPGHSATDSFLGARVSWTNAPCAGGVPRLVLRLRRQDR  138

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
             R+LRPYLQH+ +V+D++E RRRE++LF + S+ + D    RWRSV FTHP+T +TV M+
Sbjct  139  TRVLRPYLQHVESVADDLELRRREVRLFTS-SVGAGDGGGPRWRSVLFTHPATLDTVAMD  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
             +LK R+++DLE+FLK + YYH+LGRVWRRS+LL+G
Sbjct  198  PELKARIRADLESFLKGRAYYHRLGRVWRRSYLLHG  233



>ref|XP_006441187.1| hypothetical protein CICLE_v10023517mg [Citrus clementina]
 gb|ESR54427.1| hypothetical protein CICLE_v10023517mg [Citrus clementina]
Length=480

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 159/230 (69%), Gaps = 22/230 (10%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFAL----RKWSDWIDDKLHVHQFFKVPQ--LNQNAQENQLYRK  163
            V++   +R FL +++ +  L    R + DW     HV+Q +K+PQ   N N QEN LY K
Sbjct  13   VTLILIIR-FLSKTSFLHILLNKYRSFEDW----FHVYQSYKIPQYNENNNLQENLLYGK  67

Query  164  VFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG  343
            V  Y+NSL+SLEDS FTNL   +  K NDI+L LD NQ V D FLGARV W N     G 
Sbjct  68   VSTYLNSLASLEDSQFTNLFTGS--KCNDIILNLDANQTVVDTFLGARVYWTN-----GV  120

Query  344  RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPF  523
            + L +R +KKDKRRILRPYLQH+ +V++  E ++RE++L  N      D+    WRS+PF
Sbjct  121  KELTMRFRKKDKRRILRPYLQHVLSVAEENESKQREIRLHFNLY----DNGRCCWRSIPF  176

Query  524  THPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            THP+T ++VV++ D+KNRVKSDLE FLKS+QYY+KLGRVW+RS+LLYGPS
Sbjct  177  THPATMDSVVLDGDVKNRVKSDLELFLKSKQYYNKLGRVWKRSYLLYGPS  226



>gb|EAZ25345.1| hypothetical protein OsJ_09159 [Oryza sativa Japonica Group]
Length=523

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 144/216 (67%), Gaps = 13/216 (6%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQ--LNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            Y+SAL +A+R+   W D+    +Q+ +VP+   +    EN L+RK   YV  L SLED+D
Sbjct  33   YKSAL-YAVRRLWRWADEWAQAYQYHEVPRFACDGGGAENPLFRKAAQYVAVLPSLEDAD  91

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrri  388
              ++++SA+  +    L L      +D FLGAR++W N+     G  LVLR+++ D+ R+
Sbjct  92   AASVLSSASRTNGGFSLQLGPGHTARDAFLGARLAWTNR-----GDVLVLRVRRHDRTRV  146

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG--RWRSVPFTHPSTFETVVMES  562
            LRPYLQH+ +V+D +E RRREL+LF N  +   D + G  RW S PFTHP+T +TV M+ 
Sbjct  147  LRPYLQHVESVADEMELRRRELRLFANTGV---DGSTGTPRWASAPFTHPATLDTVAMDP  203

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            DLK RV++DLE FLK + YYH+LGRVWRRS+LLYGP
Sbjct  204  DLKARVRADLENFLKGRAYYHRLGRVWRRSYLLYGP  239



>gb|EAY88267.1| hypothetical protein OsI_09720 [Oryza sativa Indica Group]
Length=521

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 144/216 (67%), Gaps = 13/216 (6%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQ--LNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            Y+SAL +A+R+   W D+    +Q+ +VP+   +    EN L+RK   YV  L SLED+D
Sbjct  31   YKSAL-YAVRRLWRWADEWAQAYQYHEVPRFACDGGGAENPLFRKAAQYVAVLPSLEDAD  89

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrri  388
              ++++SA+  +    L L      +D FLGAR++W N+     G  LVLR+++ D+ R+
Sbjct  90   AASVLSSASRTNGGFSLQLGPGHTARDAFLGARLAWTNR-----GDVLVLRVRRHDRTRV  144

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG--RWRSVPFTHPSTFETVVMES  562
            LRPYLQH+ +V+D +E RRREL+LF N  +   D + G  RW S PFTHP+T +TV M+ 
Sbjct  145  LRPYLQHVESVADEMELRRRELRLFANTGV---DGSTGTPRWASAPFTHPATLDTVAMDP  201

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            DLK RV++DLE FLK + YYH+LGRVWRRS+LLYGP
Sbjct  202  DLKARVRADLENFLKGRAYYHRLGRVWRRSYLLYGP  237



>ref|NP_001048744.1| Os03g0114400 [Oryza sativa Japonica Group]
 gb|AAO17023.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93631.1| ATPase, AAA family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10658.1| Os03g0114400 [Oryza sativa Japonica Group]
 dbj|BAG98508.1| unnamed protein product [Oryza sativa Japonica Group]
Length=523

 Score =   186 bits (472),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 144/216 (67%), Gaps = 13/216 (6%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQ--LNQNAQENQLYRKVFVYVNSLSSLEDSD  208
            Y+SAL +A+R+   W D+    +Q+ +VP+   +    EN L+RK   YV  L SLED+D
Sbjct  33   YKSAL-YAVRRLWRWADEWAQAYQYHEVPRFACDGGGAENPLFRKAAQYVAVLPSLEDAD  91

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrri  388
              ++++SA+  +    L L      +D FLGAR++W N+     G  LVLR+++ D+ R+
Sbjct  92   AASVLSSASRTNGGFSLQLGPGHTARDAFLGARLAWTNR-----GDVLVLRVRRHDRTRV  146

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG--RWRSVPFTHPSTFETVVMES  562
            LRPYLQH+ +V+D +E RRREL+LF N  +   D + G  RW S PFTHP+T +TV M+ 
Sbjct  147  LRPYLQHVESVADEMELRRRELRLFANTGV---DGSTGTPRWASAPFTHPATLDTVAMDP  203

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            DLK RV++DLE FLK + YYH+LGRVWRRS+LLYGP
Sbjct  204  DLKARVRADLENFLKGRAYYHRLGRVWRRSYLLYGP  239



>ref|XP_006491957.1| PREDICTED: mitochondrial chaperone BCS1-like [Citrus sinensis]
Length=482

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 159/230 (69%), Gaps = 22/230 (10%)
 Frame = +2

Query  2    VSVFAAVRLFLYRSALVFAL----RKWSDWIDDKLHVHQFFKVPQ--LNQNAQENQLYRK  163
            V++   +R FL +++ +  L    R + DW     HV+Q +K+PQ   N N QEN LY K
Sbjct  13   VTLILIIR-FLSKTSFLHILLNKYRSFEDW----FHVYQSYKIPQYNENNNLQENLLYGK  67

Query  164  VFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG  343
            V  Y+NSL+SLEDS FTNL   +  K NDI+L LD NQ V D FLGARV W N     G 
Sbjct  68   VSTYLNSLASLEDSQFTNLFTGS--KCNDIILNLDANQTVVDTFLGARVYWTN-----GV  120

Query  344  RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPF  523
            + L +R +KKDKRRILRPYLQH+ +V++  E ++RE++L  N      D+    WRS+PF
Sbjct  121  KELTMRFRKKDKRRILRPYLQHVLSVAEENESKQREIRLHFNLY----DNGRCCWRSIPF  176

Query  524  THPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            THP+T ++VV++ D+KN+VKSDLE FLKS+QYY+KLGRVW+RS+LLYGPS
Sbjct  177  THPATMDSVVLDGDVKNKVKSDLELFLKSKQYYNKLGRVWKRSYLLYGPS  226



>ref|XP_006649262.1| PREDICTED: uncharacterized protein LOC102709999 [Oryza brachyantha]
Length=514

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 147/220 (67%), Gaps = 8/220 (4%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKV--FVYVNSLSS  193
            +RL L   + ++A+R+   W D+    +Q+ +VP+   +  EN L+RK   +V V +L S
Sbjct  17   LRLALSHKSALYAVRRLWRWADEWAQAYQYHEVPRFACDGAENPLFRKAAQYVAVAALPS  76

Query  194  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkk  373
            LED+D  ++++S++  +    L L      +D FLGAR++W N+  DG    LVLR+++ 
Sbjct  77   LEDADAASVLSSSSRTNGGFSLQLGPGHTARDAFLGARLAWTNREEDGR-EVLVLRVRRH  135

Query  374  dkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG--RWRSVPFTHPSTFET  547
            D+ R+LRPYLQH+ +V+D +E RRREL+LF N  +   D + G  RW S PFTHP+T +T
Sbjct  136  DRTRVLRPYLQHVESVADEMELRRRELRLFANTGV---DGSTGTPRWASAPFTHPATLDT  192

Query  548  VVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            V M+ DLK RV++DLE FLK + YYH+LGRVWRRS+LLYG
Sbjct  193  VAMDPDLKARVRADLENFLKGRAYYHRLGRVWRRSYLLYG  232



>gb|KDO59683.1| hypothetical protein CISIN_1g044297mg, partial [Citrus sinensis]
Length=440

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 143/196 (73%), Gaps = 13/196 (7%)
 Frame = +2

Query  92   LHVHQFFKVPQ--LNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCL  265
             HV+Q +K+PQ   N N QEN LY KV  Y+NSL+SLEDS FTNL   +  K NDI+L L
Sbjct  2    FHVYQSYKIPQYNENNNLQENLLYGKVSTYLNSLASLEDSQFTNLFTGS--KCNDIILNL  59

Query  266  DDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRR  445
            D NQ V D FLGARV W N V     + L +R +KKDKRRILRPYLQH+ +V++  E ++
Sbjct  60   DANQTVVDTFLGARVYWTNGV-----KELTMRFRKKDKRRILRPYLQHVLSVAEENESKQ  114

Query  446  RELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYH  625
            RE++L  N      D+    WRS+PFTHP+T ++VV++ D+KN+VKSDLE FLKS+QYY+
Sbjct  115  REIRLHFNLY----DNGRCCWRSIPFTHPATMDSVVLDGDVKNKVKSDLELFLKSKQYYN  170

Query  626  KLGRVWRRSFLLYGPS  673
            KLGRVW+RS+LLYGPS
Sbjct  171  KLGRVWKRSYLLYGPS  186



>gb|EPS71797.1| hypothetical protein M569_02959, partial [Genlisea aurea]
Length=455

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 140/216 (65%), Gaps = 27/216 (13%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            L R  L   LR+W  + +D  +VHQ +++P+ N   QEN L+RK + Y+NSL S+EDSDF
Sbjct  27   LIRHTLKTRLRRW--YAEDSFYVHQSYRIPKYNDAMQENLLFRKAYSYLNSLPSVEDSDF  84

Query  212  TNLVNSAAVKSNDIVLCLDDNQV-VQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrri  388
              L  S+    + I L +D+NQ  V D FLG+R+   ++                   RI
Sbjct  85   AKLY-SSFTPWDIITLVVDENQTTVVDTFLGSRIRRNDRR------------------RI  125

Query  389  lrPYLQHIHTVSDNIEQRRRELKL-FMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            L PYLQHIH V D +EQ+R  ++L F+N +  ++    GRWRS PFTHP+T ET+VM+ D
Sbjct  126  LVPYLQHIHQVYDEMEQKRNSVRLLFINATTGTN----GRWRSTPFTHPATMETIVMDPD  181

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            LKNR+K+DLE F+KS+QYYH+LGRVW+R++LLYG S
Sbjct  182  LKNRIKADLENFVKSRQYYHRLGRVWKRNYLLYGAS  217



>gb|KDP28443.1| hypothetical protein JCGZ_14214 [Jatropha curcas]
Length=412

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 130/168 (77%), Gaps = 12/168 (7%)
 Frame = +2

Query  194  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGG--GRSLVlrik  367
            +EDSDFTNL+     KSN+I+L LD NQ++ D FLGAR+SW+N+V       R+ +L+I+
Sbjct  1    MEDSDFTNLL--IGKKSNEIILRLDPNQIIDDDFLGARISWINEVKSNATQSRAFILKIR  58

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASD------DSAAGRWRSVPFTH  529
            K DKRR+LRPYLQHIHTV + ++Q++ ELKL+MN  + +D       +   RWR VPF+H
Sbjct  59   KADKRRLLRPYLQHIHTVFNELDQKKPELKLYMN--IHNDHHHHQIQNQNRRWRYVPFSH  116

Query  530  PSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            PSTFET+ ME+DLKN++KSDLE+FLK++QYYH+LGRVW+R +LLYG S
Sbjct  117  PSTFETIAMEADLKNKLKSDLESFLKAKQYYHRLGRVWKRCYLLYGQS  164



>ref|NP_001065078.2| Os10g0519300 [Oryza sativa Japonica Group]
 gb|AAG13445.1|AC051634_26 hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54650.1| ATPase, AAA family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26992.2| Os10g0519300 [Oryza sativa Japonica Group]
Length=532

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 138/224 (62%), Gaps = 10/224 (4%)
 Frame = +2

Query  23   RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ---ENQLYRKVFVYVNSLSS  193
            R+ L   ++  A+R+   W D+    +Q+++VP+         EN L+RK   YV +L S
Sbjct  29   RVVLSYKSVAHAVRRMWRWADEWAQAYQYYEVPRFGGGGGEGVENPLFRKAAAYVAALPS  88

Query  194  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkk  373
            LED+D    V S+A K+ND  L L       D FLGAR++W N    G G     R+  +
Sbjct  89   LEDAD-AACVLSSACKTNDFSLQLGPGHTAHDAFLGARLAWTNAGPAGDGGGGRERLVLR  147

Query  374  dk----rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
             +     R+LRPYLQH+ +V+D +E RRREL+L+ N     D + + +W S PFTHP+T 
Sbjct  148  VRRHDRTRVLRPYLQHVESVADEMELRRRELRLYAN--TGGDGAPSPKWTSAPFTHPATL  205

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ETV M+ +LK RV++DLE+FLK + YYH+LGR WRRS+LLYGPS
Sbjct  206  ETVAMDPELKARVRADLESFLKGRAYYHRLGRAWRRSYLLYGPS  249



>gb|EAY79221.1| hypothetical protein OsI_34338 [Oryza sativa Indica Group]
Length=535

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 138/224 (62%), Gaps = 10/224 (4%)
 Frame = +2

Query  23   RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ---ENQLYRKVFVYVNSLSS  193
            R+ L   ++  A+R+   W D+    +Q+++VP+         EN L+RK   YV +L S
Sbjct  31   RVVLSYKSVAHAVRRMWRWADEWAQAYQYYEVPRFGGGGGEGVENPLFRKAAAYVAALPS  90

Query  194  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkk  373
            LED+D    V S+A K+ND  L L       D FLGAR++W N    G G     R+  +
Sbjct  91   LEDAD-AACVLSSACKTNDFSLQLGPGHTAHDAFLGARLAWTNAGPAGDGGGGRERLVLR  149

Query  374  dk----rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
             +     R+LRPYLQH+ +V+D +E RRREL+L+ N     D + + +W S PFTHP+T 
Sbjct  150  VRRHDRTRVLRPYLQHVESVADEMELRRRELRLYAN--TGGDGAPSPKWTSAPFTHPATL  207

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ETV M+ +LK RV++DLE+FLK + YYH+LGR WRRS+LLYGPS
Sbjct  208  ETVAMDPELKARVRADLESFLKGRAYYHRLGRAWRRSYLLYGPS  251



>ref|XP_002882079.1| hypothetical protein ARALYDRAFT_346472 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58338.1| hypothetical protein ARALYDRAFT_346472 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 127/180 (71%), Gaps = 7/180 (4%)
 Frame = +2

Query  2    VSVFAA--VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVY  175
            V+ FA   VR+ L+++ L++ ++ W   I D  HV+QF+KVP+ N N QEN LY+KV+ Y
Sbjct  13   VATFALFLVRIVLFKTGLIYMVKLWRRKIIDWFHVYQFYKVPEFNDNVQENHLYQKVYSY  72

Query  176  VNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLV  355
            +NSLSS+E+SDFTNL      KSN+I+L LD NQVV D+FLGARV W+N   + G R+ V
Sbjct  73   LNSLSSIENSDFTNLFTGK--KSNEIILRLDRNQVVGDEFLGARVCWINGEDEDGARNFV  130

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMN---RSLASDDSAAGRWRSVPFT  526
            L+I+K DKRRIL PYLQHIHTVSD +EQR  ELKLF+N   R L++  +A      + FT
Sbjct  131  LKIRKADKRRILGPYLQHIHTVSDELEQRSTELKLFINDLDRYLSTKSTAVSLSGILNFT  190



>gb|ABR16249.1| unknown [Picea sitchensis]
Length=550

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 151/237 (64%), Gaps = 17/237 (7%)
 Frame = +2

Query  5    SVFAAVRLF--LYRSALVFALRKWSDWIDDKLHVHQFFKVPQL--NQNAQENQLYRKVFV  172
            S+ A + +F  L  + L+  +R+W +   ++   ++FF++P+       QEN LY KV  
Sbjct  9    SLMAIIVVFQNLVPTQLLEMVRRWLESWQERWKAYKFFRIPEQYGCDGFQENGLYNKVST  68

Query  173  YVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVH--DGGG-  343
            YV++L    D+ + NL   +A  SNDI + L+  Q V+D FLGAR+ W+++V   DG G 
Sbjct  69   YVSTLGGAVDTHYANLC--SAKNSNDIFVSLEAGQSVEDVFLGARLWWIHEVKEKDGEGD  126

Query  344  --RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDD---SAAGR-  505
              +S +L+I K+DK  +LRPYL+H+  V+++++ R+RELKL+ N          S A R 
Sbjct  127  AVKSFILKIHKRDKAGVLRPYLEHVQAVAEDVDHRKRELKLYTNSQKFGRQKWTSMAFRQ  186

Query  506  --WRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              W SV F HP+TF+T+ ME+DLKN++K DL+ F++ + YYH+LGR W+R +LLYGP
Sbjct  187  PDWTSVAFKHPATFDTIAMEADLKNKIKMDLDAFVRGKNYYHRLGRAWKRGYLLYGP  243



>ref|XP_009391570.1| PREDICTED: mitochondrial chaperone BCS1-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 138/231 (60%), Gaps = 15/231 (6%)
 Frame = +2

Query  2    VSVFAAV--RLFLYRSALVFA-----LRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYR  160
            VSV  AV   LFL R+ L F      L +W  W+D+  H +Q F++P+  ++  EN L R
Sbjct  7    VSVVVAVLGGLFLLRAGLSFKCLLYLLGRWWSWLDEHTHAYQHFEIPRYTESGLENPLIR  66

Query  161  KVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGG  340
                YV SLSS E       + S+  + N+  +       V D FLG R+SW      GG
Sbjct  67   HATAYVASLSSHE---CAVAIVSSGYEPNEFSVHPAPGHPVPDSFLGCRLSWSAT---GG  120

Query  341  GRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSV-  517
            G  LVLR++++D  R+LRPYLQH+ +V+ N+E RRRE  LF+  S    +S   RWR V 
Sbjct  121  GDRLVLRLRRQDCSRVLRPYLQHVESVAKNLELRRRETNLFVI-SRGGGESGEPRWRPVA  179

Query  518  PFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            PFTHP+  +TV M+ ++K  V++DLE FL  + YYH++GR WRRS+LL+GP
Sbjct  180  PFTHPARLDTVAMDPEVKAWVRADLEAFLNGRAYYHRVGRNWRRSYLLHGP  230



>ref|XP_006849190.1| hypothetical protein AMTR_s00027p00211720 [Amborella trichopoda]
 gb|ERN10771.1| hypothetical protein AMTR_s00027p00211720 [Amborella trichopoda]
Length=466

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 125/197 (63%), Gaps = 12/197 (6%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQNAQE-NQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLC  262
            ++ H  + +++P+ N  + E N LY KV +YV +LS  ED+DF+NL    A  S +  L 
Sbjct  28   NRRHSCRIYRIPEHNGISNEKNSLYSKVSIYVTALSQAEDADFSNLY---AKNSGEFFLQ  84

Query  263  LDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQR  442
             D N  ++D FLG  V W ++      ++ +L+IKK  K   LRPYLQH+  +++  E R
Sbjct  85   PDSNHAIKDSFLGTTVWWKHEA-PVSEKAFLLQIKKASKPGFLRPYLQHVQAMANEGEAR  143

Query  443  RRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYY  622
            RRE +L  N S         +WRSVPF HP+TFET+ M++DLKN++KSDLE F+K + YY
Sbjct  144  RREPRLHTNAS-------GNQWRSVPFKHPATFETLAMDADLKNKIKSDLEAFVKGRNYY  196

Query  623  HKLGRVWRRSFLLYGPS  673
             KLGR W+R++L YGP+
Sbjct  197  QKLGRPWKRNYLFYGPA  213



>gb|AET02010.2| P-loop nucleoside triphosphate hydrolase superfamily protein, 
putative [Medicago truncatula]
Length=457

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 129/220 (59%), Gaps = 32/220 (15%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  199
            +R  L+++ L+   +K    + D  +++Q+ KVP+LNQ  Q N  YRKV +Y++SL SLE
Sbjct  20   IRYILFKTGLIHTTKKLHKKLQDFFYLYQYLKVPELNQTMQPNMFYRKVSLYLHSLPSLE  79

Query  200  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM-NKVHDGGGRSLVlrikkkd  376
            DSDFTNL+       NDIVL LD +Q+++D+FLGA V W   K       + V++I+K D
Sbjct  80   DSDFTNLITGN--NQNDIVLTLDSDQIIEDRFLGATVYWFYTKTEPNQTGAFVIKIRKTD  137

Query  377  krrilrPYLQHIHTVSDNIE-QRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVV  553
            KRRIL  YL HI T+S  IE   +R+L+LF+N  +        RWRSVPF HPSTFET+ 
Sbjct  138  KRRILSSYLHHITTMSAEIEYNGKRDLRLFVN--ITGGGGGGRRWRSVPFNHPSTFETI-  194

Query  554  MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
                                     LGRVW+RSFLLYG S
Sbjct  195  -------------------------LGRVWKRSFLLYGES  209



>emb|CDY27312.1| BnaC04g50930D [Brassica napus]
Length=245

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V    R+ L+++ L++ ++KW   + D  HV Q +KVP+ N N QEN LY KV+ Y+NSL
Sbjct  18   VLFLARIVLFKTGLIYMVKKWWRTVVDVFHVCQSYKVPEFNDNLQENHLYMKVYSYLNSL  77

Query  188  SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrik  367
            SS+EDSDFTNL      KSN+I+L LD NQ+V D+FLGARV W NK    G RS VL+I+
Sbjct  78   SSIEDSDFTNLFTEK--KSNEIILHLDRNQIVGDEFLGARVCWYNK---DGTRSFVLKIR  132

Query  368  kkdkrrilrPYLQHIHTVSDNIEQRRRELKLF  463
            K DKRRIL PYLQHIH V+D +EQR  ELKLF
Sbjct  133  KADKRRILGPYLQHIHRVTDELEQRNTELKLF  164



>ref|XP_003627534.1| Cell division cycle protein-like protein [Medicago truncatula]
Length=459

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 127/222 (57%), Gaps = 34/222 (15%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLH--VHQFFKVPQLNQNAQENQLYRKVFVYVNSLSS  193
            +R  L+++ L+   +K       +    ++Q+ KVP+LNQ  Q N  YRKV +Y++SL S
Sbjct  20   IRYILFKTGLIHTNKKTPTKKLTRFFFILYQYLKVPELNQTMQPNMFYRKVSLYLHSLPS  79

Query  194  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM-NKVHDGGGRSLVlrikk  370
            LEDSDFTNL+       NDIVL LD +Q+++D+FLGA V W   K       + V++I+K
Sbjct  80   LEDSDFTNLITGN--NQNDIVLTLDSDQIIEDRFLGATVYWFYTKTEPNQTGAFVIKIRK  137

Query  371  kdkrrilrPYLQHIHTVSDNIE-QRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFET  547
             DKRRIL  YL HI T+S  IE   +R+L+LF+N  +        RWRSVPF HPSTFET
Sbjct  138  TDKRRILSSYLHHITTMSAEIEYNGKRDLRLFVN--ITGGGGGGRRWRSVPFNHPSTFET  195

Query  548  VVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            +                          LGRVW+RSFLLYG S
Sbjct  196  I--------------------------LGRVWKRSFLLYGES  211



>ref|XP_003562201.1| PREDICTED: uncharacterized protein LOC100825790 [Brachypodium 
distachyon]
Length=500

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 135/226 (60%), Gaps = 24/226 (11%)
 Frame = +2

Query  35   YRSALVFALRKWSDWIDDKLHVHQFFKVPQ-------LNQNAQENQLYRKVFVYVNSLSS  193
            YRSA+ F  R W    D+    +Q+ +VP+         +  +EN L+RK  VYV+SL S
Sbjct  20   YRSAMYFLRRLWR-LCDEWTQAYQYHEVPRRLGLTGAEEEEEEENPLFRKALVYVSSLPS  78

Query  194  LEDSDFTN---LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlri  364
            LED+D      L  S + K   + L L       D FLGAR++W  +  D     LVLR+
Sbjct  79   LEDADAATVLLLSPSPSRKKTGLSLRLGHGHAACDAFLGARLAWTYRRDDD--DVLVLRV  136

Query  365  kkkdkrrilrPYLQHIHTVSDNIE-QRRR--ELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            ++ D+ R+LRPYLQH+ +V+D ++ QRRR  EL++F N       +   RW S PFT+P+
Sbjct  137  RRHDRTRVLRPYLQHVESVADELDLQRRRRGELRVFAN-------TGGARWASAPFTNPA  189

Query  536  TFETVV-MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            T +T V M+S LK RV++DLE+F   + YY +LG VWRRS+LL+GP
Sbjct  190  TLDTAVAMDSGLKARVRADLESFASGRAYYRRLGLVWRRSYLLHGP  235



>gb|EEE51276.1| hypothetical protein OsJ_32176 [Oryza sativa Japonica Group]
Length=486

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 109/220 (50%), Gaps = 48/220 (22%)
 Frame = +2

Query  23   RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ---ENQLYRKVFVYVNSLSS  193
            R+ L   ++  A+R+   W D+    +Q+++VP+         EN L+RK   YV +L S
Sbjct  29   RVVLSYKSVAHAVRRMWRWADEWAQAYQYYEVPRFGGGGGEGVENPLFRKAAAYVAALPS  88

Query  194  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkk  373
            LED+D    V S+A K+ND  L L       D FLGAR++W N                 
Sbjct  89   LEDAD-AACVLSSACKTNDFSLQLGPGHTAHDAFLGARLAWTNA----------------  131

Query  374  dkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVV  553
                            + +    R  L L              RW S PFTHP+T ETV 
Sbjct  132  --------------GPAGDGGGGRERLVL--------------RWTSAPFTHPATLETVA  163

Query  554  MESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            M+ +LK RV++DLE+FLK + YYH+LGR WRRS+LLYGPS
Sbjct  164  MDPELKARVRADLESFLKGRAYYHRLGRAWRRSYLLYGPS  203



>ref|XP_003546854.2| PREDICTED: uncharacterized protein LOC100820437 [Glycine max]
Length=567

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 112/202 (55%), Gaps = 8/202 (4%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVL  259
            D L  + +F++P+ N       N LYR   +Y+N+ +    +    L  S +  SN I  
Sbjct  84   DLLSPYSYFEIPEFNGYCGVDLNDLYRHAHLYLNASNHAPATACRRLTLSRSPSSNRISF  143

Query  260  CLDDNQVVQDQFLGARVSWMNKVHDGGG-----RSLVlrikkkdkrrilrPYLQHIHTVS  424
             +  N  V D F G RV+W + V          RS  LR+ K+ +  +L PYL H+ + +
Sbjct  144  AVAPNHTVHDAFRGHRVAWTHHVETAQDSLEERRSFTLRLPKRHRHALLSPYLAHVTSRA  203

Query  425  DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFL  604
            +  E+  RE +LF N + +S    +G W SVPF HPSTFET+ ME +LK  +K+DL  F 
Sbjct  204  EEFERVSRERRLFTNNTTSSGSFESG-WVSVPFRHPSTFETLAMEPELKKNIKNDLTAFA  262

Query  605  KSQQYYHKLGRVWRRSFLLYGP  670
            + +++Y ++GR W+R +LL+GP
Sbjct  263  EGKEFYKRVGRAWKRGYLLHGP  284



>ref|XP_003531459.1| PREDICTED: uncharacterized protein LOC100783574 [Glycine max]
Length=516

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 113/202 (56%), Gaps = 8/202 (4%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVL  259
            D L  + +F++P+ N     + N LYR V +Y+N+ +    +    L  S +  SN I  
Sbjct  38   DLLSPYSYFEIPEFNGYCGVELNDLYRHVHLYLNAANHAPAAACRRLTLSCSPSSNRISF  97

Query  260  CLDDNQVVQDQFLGARVSWMNKVHDGGG-----RSLVlrikkkdkrrilrPYLQHIHTVS  424
             +  N  V D F G RV W + V          RS  LR+ K+ +  +L PYL H+ + +
Sbjct  98   AVAPNHTVHDAFRGHRVGWTHHVETAQDSLEERRSFTLRLPKRHRHALLSPYLAHVTSRA  157

Query  425  DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFL  604
            +  E+  RE +LF N + AS    +G W SVPF HPSTFET+ +E +LK ++K+DL  F 
Sbjct  158  EEFERVSRERRLFTNNTTASGSFESG-WVSVPFRHPSTFETLALEPELKKQIKNDLTAFA  216

Query  605  KSQQYYHKLGRVWRRSFLLYGP  670
              +++Y ++GR W+R +LL+GP
Sbjct  217  DGKEFYKRVGRAWKRGYLLHGP  238



>gb|KHN06336.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=307

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 5/93 (5%)
 Frame = +2

Query  398  YLQHIHTVSDNIE-QRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            YL+HI T++D +  Q +R L+LFMN    +      RWRSVPF HP+TFET+ ME DLKN
Sbjct  55   YLRHIDTIADEMNNQSKRHLRLFMN----AGAGGGTRWRSVPFNHPATFETMAMEKDLKN  110

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            ++KSDLE+FLK++QYY KLGR W+RS+LLYG S
Sbjct  111  KIKSDLESFLKAKQYYRKLGRAWKRSYLLYGAS  143



>ref|XP_007149116.1| hypothetical protein PHAVU_005G042400g [Phaseolus vulgaris]
 gb|ESW21110.1| hypothetical protein PHAVU_005G042400g [Phaseolus vulgaris]
Length=518

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 113/202 (56%), Gaps = 8/202 (4%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVL  259
            D L  + +F++P+ N       N LYR V +Y+N+ +    +    L  S +  SN I  
Sbjct  38   DLLSPYSYFEIPEFNGYCGVDLNDLYRHVHLYLNAANHAPAAACRRLTLSRSPSSNRISF  97

Query  260  CLDDNQVVQDQFLGARVSWMNKVHDG-----GGRSLVlrikkkdkrrilrPYLQHIHTVS  424
             +  N  VQD F G RV+W + V          RS  LR+ K+ +  +L PYL H+   +
Sbjct  98   AVAPNHTVQDSFRGHRVTWTHHVDTAQDSLEEKRSFTLRLPKRHRHTLLSPYLAHVTARA  157

Query  425  DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFL  604
            +  E+  RE +LF N +  S    +G W SVPF HPSTFET+ +E +LK ++K+DL  F 
Sbjct  158  EEFERVSRERRLFTNNTTGSGSFESG-WVSVPFRHPSTFETLALEPELKRQIKNDLTAFA  216

Query  605  KSQQYYHKLGRVWRRSFLLYGP  670
              +++Y+++GR W+R +LL+GP
Sbjct  217  DGKEFYNRVGRAWKRGYLLHGP  238



>ref|XP_004488574.1| PREDICTED: uncharacterized protein LOC101489676 [Cicer arietinum]
Length=521

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 119/217 (55%), Gaps = 9/217 (4%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S L+  L    + + D L  + +F++P+ N     + N LYR V +Y+NS++    +   
Sbjct  23   SQLLSVLHSLYESLQDLLSPYSYFEIPEFNGYCGVELNDLYRHVHLYLNSVNHSPAAACR  82

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdk  379
             L  S +  SN I   +  N  V D F   R+SW   ++ V D     RS  LR+ K+ +
Sbjct  83   RLTLSRSPSSNRISFAVAPNHTVHDTFNNHRLSWTHHVDAVQDSLEEKRSFTLRLPKRHR  142

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
              +L  YL HI + ++  E+  RE +LF N + A   S    W SVPF HPSTFET+ +E
Sbjct  143  HALLSSYLSHITSRAEEFERVSRERRLFTNNNGAG--SFEPGWVSVPFRHPSTFETLALE  200

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             DLK ++K DL  F   +++YH++GR W+R +LL+GP
Sbjct  201  PDLKKQIKDDLTAFASGKEFYHRVGRAWKRGYLLHGP  237



>ref|XP_006359141.1| PREDICTED: putative cell division cycle ATPase-like [Solanum 
tuberosum]
Length=516

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 120/217 (55%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            + LV     + + I D    + +F++P+ N       N LYR V +Y+NS++S   S   
Sbjct  23   TQLVSLFHSFYESIQDFFSPYSYFEIPEFNGYCGVDVNDLYRHVNLYLNSINS--SSTCR  80

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdk  379
             L  S +  SN I   +  NQ+V D F G  ++W ++V +        RS  L++ K+ +
Sbjct  81   RLTLSRSKSSNRISYTVAPNQMVHDAFRGHHLTWTHQVDNVQDSVEEKRSFTLKLPKRHR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
              +L PYL+ +   ++  E+  RE +LF N    S +S    W SVPF HPSTFET+ ++
Sbjct  141  LELLTPYLEQVTARAEEFERVSRERRLFTNNGHGSYESG---WSSVPFRHPSTFETLALK  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +LK ++  DL  F + +++YHK+GR W+R +LLYGP
Sbjct  198  PELKTQLMDDLTAFSQGKEFYHKIGRAWKRGYLLYGP  234



>ref|XP_004229339.1| PREDICTED: putative cell division cycle ATPase [Solanum lycopersicum]
Length=512

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 114/204 (56%), Gaps = 12/204 (6%)
 Frame = +2

Query  80   IDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDI  253
            I D    + +F++P+ N       N LYR V +Y+NS++S   S    L  S +  SN I
Sbjct  36   IQDFFSPYSYFEIPEFNGYCGVDVNDLYRHVNLYLNSINS--SSTCRRLTLSRSKSSNRI  93

Query  254  VLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrrilrPYLQHIHT  418
               +  NQ+V D F G  ++W ++V +        RS  L++ K+ +  +L PYL+ +  
Sbjct  94   SYTVAPNQMVHDAFRGHHLTWTHQVDNVQDSVEEKRSFTLKLPKRHRLELLPPYLEQLTA  153

Query  419  VSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLET  598
             ++  E+  RE +LF N    S +S    W SVPF HPSTFET+ +E DLK ++  DL  
Sbjct  154  RAEEFERVSRERRLFTNNGHGSYESG---WSSVPFRHPSTFETLALEPDLKTQLMDDLTA  210

Query  599  FLKSQQYYHKLGRVWRRSFLLYGP  670
            F + +++YH +GR W+R +LLYGP
Sbjct  211  FSQGKEFYHNIGRAWKRGYLLYGP  234



>ref|XP_006369479.1| hypothetical protein POPTR_0001s23830g [Populus trichocarpa]
 gb|ERP66048.1| hypothetical protein POPTR_0001s23830g [Populus trichocarpa]
Length=563

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 120/218 (55%), Gaps = 11/218 (5%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSL-SSLEDSDF  211
            + L+  L    + + D +  + +F +P+ N     + N LYR V +Y+NS+ SS   S  
Sbjct  23   TQLLSLLHSLYESLQDFISPYSYFDIPEFNGYCGVEINDLYRHVNLYLNSVNSSATASTC  82

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkd  376
                 S +  SN I   +  N  + D F G  +SW   ++ V D     RS  L++ K+ 
Sbjct  83   RRFTLSRSKSSNCISFTIAPNHTIHDSFNGHSLSWTHHVDTVQDSLEEKRSFTLKLPKRL  142

Query  377  krrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
            +  +L PY+QH+ + ++  E+  RE +LF N   AS +S    W SVPF HPSTFET+ +
Sbjct  143  RHLLLSPYIQHVTSRAEEFERVSRERRLFTNNGNASYESG---WVSVPFRHPSTFETLAL  199

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            E  LK ++  DL+ F   +++YH++GR W+R +LLYGP
Sbjct  200  EPHLKKQMMEDLKAFASGREFYHRVGRAWKRGYLLYGP  237



>ref|XP_011041988.1| PREDICTED: uncharacterized protein LOC105137805 [Populus euphratica]
Length=526

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 114/205 (56%), Gaps = 11/205 (5%)
 Frame = +2

Query  80   IDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSL-SSLEDSDFTNLVNSAAVKSND  250
            + D +  + +F +P+ N       N LYR V +Y+NS+ SS   S       S +  SN 
Sbjct  36   LQDLISQYSYFDIPEFNGCCGVDINDLYRHVNLYLNSVNSSATASTCRRFSLSRSRSSNC  95

Query  251  IVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdkrrilrPYLQHIH  415
            I   +  N  + D F G  + W   ++ V D     RS  LR+ K+ +  +L PYLQH+ 
Sbjct  96   ISFTIAPNHTIHDSFNGHSLCWTHHVDTVQDSLEEKRSFTLRLPKRHRHMLLSPYLQHVT  155

Query  416  TVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLE  595
            + ++  E+  RE +LF N   AS +S    W SVPF HPSTFET+ +E  LK ++  DL+
Sbjct  156  SRAEEFERVSRERRLFTNNGNASYESG---WVSVPFRHPSTFETLALEPQLKRQIMEDLK  212

Query  596  TFLKSQQYYHKLGRVWRRSFLLYGP  670
             F + ++YYH++GR W+R +LLYGP
Sbjct  213  AFARGREYYHRVGRAWKRGYLLYGP  237



>ref|XP_011093400.1| PREDICTED: mitochondrial chaperone BCS1-like [Sesamum indicum]
Length=513

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 109/204 (53%), Gaps = 11/204 (5%)
 Frame = +2

Query  80   IDDKLHVHQFFKVPQLNQNAQE--NQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDI  253
            + D +  + +F VP+ N       N LYR V +Y+NSL S   S    L  S +  SN I
Sbjct  36   LQDFITPYAYFDVPEFNGYCAVDLNDLYRHVNLYLNSLHSAAAS-CRRLTLSRSKSSNRI  94

Query  254  VLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrrilrPYLQHIHT  418
               +  N  V D F G R+SW + V          RS  L++ K+ +  +L PY+ H+  
Sbjct  95   SYSVAPNHTVHDSFDGHRLSWTHHVETVQDSLDEKRSFTLKLPKRRRLALLGPYIDHVTA  154

Query  419  VSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLET  598
             +   E+  RE +LF N    S +S    W SVPF HPSTFET+ +E +LKN++  DL  
Sbjct  155  RAQEFERVSRERRLFTNNGHGSYESG---WSSVPFRHPSTFETLALEPELKNQLVDDLTA  211

Query  599  FLKSQQYYHKLGRVWRRSFLLYGP  670
            F   +++Y K+GR W+R +LLYGP
Sbjct  212  FADGKEFYQKIGRAWKRGYLLYGP  235



>ref|XP_009617194.1| PREDICTED: ATPase family gene 2 protein-like [Nicotiana tomentosiformis]
Length=514

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 118/217 (54%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            + L+  L    + I D    + +F++P+ N       N LYR V +Y+NS++S   S   
Sbjct  23   TQLLSVLHSCYESIQDFFSPYSYFEIPEFNGYCGVDVNDLYRHVNLYLNSINS--SSTCP  80

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdk  379
             L  S +  S  I   L  N  V D F G  +SW ++V +        RS  L++ K+ +
Sbjct  81   RLTLSRSKSSKSISYTLAPNHTVNDTFRGHHLSWTHQVDNVQDSVEEKRSFTLKLPKRQR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
              +L PYL+H+   ++  E+  RE +LF N    S +S    W SVPF HPSTFET+ +E
Sbjct  141  LELLTPYLEHVTARAEEFERVSRERRLFTNNGHGSYESG---WSSVPFRHPSTFETLALE  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +LK ++  DL  F + +++YHK+GR W+R +LLYGP
Sbjct  198  PELKTQLMDDLTAFSEGKEFYHKIGRAWKRGYLLYGP  234



>emb|CDY61723.1| BnaA04g27130D [Brassica napus]
Length=128

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 9/126 (7%)
 Frame = +2

Query  59   LRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAV  238
            ++KW   + D  HV+Q +KVP+ N N QEN LY KV+ Y+NSLSS+EDSDFTNL      
Sbjct  2    VKKWWKTVVDVFHVYQSYKVPEFNNNLQENHLYMKVYAYLNSLSSMEDSDFTNLFTGK--  59

Query  239  KSNDIVLCLDDNQVVQDQF-------LGARVSWMNKVHDGGGRSLVlrikkkdkrrilrP  397
            KSN+I+L L  NQ+V D+F       LGARV W NK ++ G RS VL+I+K DK RIL P
Sbjct  60   KSNEIILRLYQNQIVGDEFLAVPGRVLGARVCWYNKENEDGTRSFVLKIRKADKWRILGP  119

Query  398  YLQHIH  415
            YLQHIH
Sbjct  120  YLQHIH  125



>ref|XP_002313465.2| hypothetical protein POPTR_0009s02930g [Populus trichocarpa]
 gb|EEE87420.2| hypothetical protein POPTR_0009s02930g [Populus trichocarpa]
Length=505

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 112/205 (55%), Gaps = 11/205 (5%)
 Frame = +2

Query  80   IDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSL-SSLEDSDFTNLVNSAAVKSND  250
            + D +  + +F +P+ N       N LYR V +Y+NS+ SS   S       S +  SN 
Sbjct  36   LQDLISQYSYFDIPEFNGYCGVDINDLYRHVNLYLNSVNSSATASTCRRFSLSRSRSSNC  95

Query  251  IVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrrilrPYLQHIH  415
            I   +  N  + D F G  + W ++V          RS  L++ K+ +  +L PYLQH+ 
Sbjct  96   ISFTIAPNHTIHDSFNGHSLCWTHQVDTVQDSLEEKRSFTLKLPKRHRHMLLSPYLQHVT  155

Query  416  TVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLE  595
            + ++  E+  RE +LF N   AS +S    W SVPF HPSTFET+ +E  LK ++  DL+
Sbjct  156  SRAEEFERVSRERRLFTNNGNASYESG---WVSVPFRHPSTFETLALEPQLKRQIMEDLK  212

Query  596  TFLKSQQYYHKLGRVWRRSFLLYGP  670
             F   ++YYH++GR W+R +LLYGP
Sbjct  213  AFSSGREYYHRVGRAWKRGYLLYGP  237



>ref|XP_009791983.1| PREDICTED: ATPase family gene 2 protein-like [Nicotiana sylvestris]
Length=514

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 117/217 (54%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            + L+  L    + I D    + +F++P+ N       N LYR V +Y+NS++S   S   
Sbjct  23   TQLLSVLHSCYESIQDFFSPYSYFEIPEFNGYCGVDVNDLYRHVNLYLNSINS--SSTCP  80

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdk  379
             L  S +  S  I   L  N  V D F G   SW ++V +        RS  L++ K+ +
Sbjct  81   RLTLSRSKSSKSISYTLAPNHTVNDTFCGHHFSWTHQVDNVQDSVEEKRSFTLKLPKRHR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
              +L+PYL+H+   ++  E+  RE +LF N    S +S    W SVPF HPSTFET+ +E
Sbjct  141  LELLKPYLEHVTARAEEFERVSRERRLFTNNGHGSYESG---WSSVPFRHPSTFETLALE  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +LK ++  DL  F + + +YHK+GR W+R +LLYGP
Sbjct  198  PELKTQLMDDLTAFSEGKDFYHKIGRAWKRGYLLYGP  234



>gb|KEH38185.1| chaperone BCS1-A-like protein, putative [Medicago truncatula]
Length=520

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 114/215 (53%), Gaps = 9/215 (4%)
 Frame = +2

Query  47   LVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFTNL  220
            L+  L    + + D L  + +F++P+ N     + N LYR V +Y+N+++    +    L
Sbjct  25   LLSVLHSLYESLQDLLSPYSYFEIPEFNGYCGVELNDLYRHVHLYLNAVNHSSATACRRL  84

Query  221  VNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrr  385
              S +  SN I   +  N  V D F   R+SW + V          RS  LR  K+ +  
Sbjct  85   TLSRSPSSNRISFAVAPNHTVHDTFNNHRLSWTHHVDTMQDSVEEKRSFTLRFPKRHRHA  144

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            +L  YL H+ + ++  E+  RE +LF N +     S    W SVPF HPSTFET+ +E D
Sbjct  145  LLSAYLSHVTSRAEEFERVSRERRLFTNNN--GTGSFESGWVSVPFRHPSTFETLALEPD  202

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            LK ++K DL  F   +++YH++GR W+R +LL+GP
Sbjct  203  LKKQIKDDLTAFASGKEFYHRVGRAWKRGYLLHGP  237



>gb|KDP20377.1| hypothetical protein JCGZ_05260 [Jatropha curcas]
Length=518

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 110/196 (56%), Gaps = 11/196 (6%)
 Frame = +2

Query  107  FFKVPQLNQ--NAQENQLYRKVFVYVNSL-SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQ  277
            +F++P+ N       N LYR V +Y+NS+ SS   +    L  S +  SN I   +  NQ
Sbjct  45   YFEIPEFNGYCGVDINDLYRHVNLYLNSVNSSTSAAACRRLTLSRSKSSNCISFTVAPNQ  104

Query  278  VVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQR  442
             V D F G  +SW + V          RS  L++ K+ +  +L  YLQH+ + ++  E+ 
Sbjct  105  TVHDIFNGHSLSWTHHVETVQDSLEEKRSFTLKLPKRHRHTLLSLYLQHVTSRAEEFERV  164

Query  443  RRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYY  622
             RE +LF N   AS +S    W SVPF HPSTF+T+ +E  LK ++  DL+ F   +++Y
Sbjct  165  SRERRLFTNNGNASYESG---WVSVPFRHPSTFDTLALEPQLKKQIMEDLKAFANGREFY  221

Query  623  HKLGRVWRRSFLLYGP  670
            HK+GR W+R +LLYGP
Sbjct  222  HKVGRAWKRGYLLYGP  237



>ref|XP_011009649.1| PREDICTED: uncharacterized protein LOC105114707 [Populus euphratica]
Length=524

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 113/205 (55%), Gaps = 11/205 (5%)
 Frame = +2

Query  80   IDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSL-SSLEDSDFTNLVNSAAVKSND  250
            + D +  + +F +P+ N       N LYR V +Y+NS+ SS   S       S +  SN 
Sbjct  36   LQDFISPYSYFDIPEFNGYCGVDINDLYRHVNLYLNSVNSSATASTCRRFTLSRSKSSNC  95

Query  251  IVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdkrrilrPYLQHIH  415
            I   +  N  + D F G  + W   ++ V D     RS  L++ K+ +  +L PY+QH+ 
Sbjct  96   ISFTIAPNHTIHDSFNGHSLYWTHHVDTVQDSLEEKRSFTLKLPKRLRHLLLSPYIQHVT  155

Query  416  TVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLE  595
            + ++  E+  RE +LF N   AS +S    W SVPF HPSTFET+ +E  LK ++  DL+
Sbjct  156  SRAEEFERVSRERRLFTNNGNASYESG---WVSVPFRHPSTFETLALEPHLKKQMMEDLK  212

Query  596  TFLKSQQYYHKLGRVWRRSFLLYGP  670
             F   +++YH++GR W+R +LLYGP
Sbjct  213  AFASGREFYHRVGRAWKRGYLLYGP  237



>ref|XP_006482802.1| PREDICTED: uncharacterized protein LOC102622284 [Citrus sinensis]
Length=530

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 117/217 (54%), Gaps = 10/217 (5%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S L+  L  + + + D    + +F++P+ N       N LYR V +Y+NS++    S   
Sbjct  23   SQLLSLLHSFYESLQDLFSPYSYFEIPEFNGYCGVDVNDLYRHVNLYLNSVNPAGSSTCR  82

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdk  379
             L  S +  SN I   +  N  V D F G  +SW   ++ V D     RS  L++ K+ +
Sbjct  83   RLTLSRSRSSNRISFTVAPNHTVHDSFSGHSLSWTHHVDTVQDSVEEKRSFTLKLPKRHR  142

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            + +L  YL H+ + ++  E+  RE +LF N    S DS    W SVPF HPSTFET+ +E
Sbjct  143  QTLLSAYLDHVTSRAEEFERVSRERRLFTNNGHGSYDSG---WVSVPFRHPSTFETLALE  199

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              LK ++  DL  F   +++YH++GR W+R +LLYGP
Sbjct  200  PQLKKQITEDLTAFANGKEFYHRVGRAWKRGYLLYGP  236



>gb|KDO46037.1| hypothetical protein CISIN_1g009640mg [Citrus sinensis]
Length=530

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 117/217 (54%), Gaps = 10/217 (5%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S L+  L  + + + D    + +F++P+ N       N LYR V +Y+NS++    S   
Sbjct  23   SQLLSLLHSFYESLQDLFSPYSYFEIPEFNGYCGVDVNDLYRHVNLYLNSVNPAGSSTCR  82

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdk  379
             L  S +  SN I   +  N  V D F G  +SW   ++ V D     RS  L++ K+ +
Sbjct  83   RLTLSRSRSSNRISFTVAPNHTVHDSFSGHSLSWTHHVDTVQDSVEEKRSFTLKLPKRHR  142

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            + +L  YL H+ + ++  E+  RE +LF N    S DS    W SVPF HPSTFET+ +E
Sbjct  143  QTLLSAYLDHVTSRAEEFERVSRERRLFTNNGHGSYDSG---WVSVPFRHPSTFETLALE  199

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              LK ++  DL  F   +++YH++GR W+R +LLYGP
Sbjct  200  PQLKKQITEDLTAFANGKEFYHRVGRAWKRGYLLYGP  236



>ref|XP_006439008.1| hypothetical protein CICLE_v10031208mg [Citrus clementina]
 gb|ESR52248.1| hypothetical protein CICLE_v10031208mg [Citrus clementina]
Length=530

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 117/217 (54%), Gaps = 10/217 (5%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S L+  L  + + + D    + +F++P+ N       N LYR V +Y+NS++    S   
Sbjct  23   SQLLSLLHSFYESLQDLFSPYSYFEIPEFNGYCGVDVNDLYRHVNLYLNSVNPAGSSTCR  82

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdk  379
             L  S +  SN I   +  N  V D F G  +SW   ++ V D     RS  L++ K+ +
Sbjct  83   RLTLSRSRSSNRISFTVAPNHTVHDSFSGHSLSWTHHVDTVQDSVEEKRSFTLKLPKRHR  142

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            + +L  YL H+ + ++  E+  RE +LF N    S DS    W SVPF HPSTFET+ +E
Sbjct  143  QTLLSAYLDHVTSRAEEFERVSRERRLFTNNGHGSYDSG---WVSVPFRHPSTFETLALE  199

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              LK ++  DL  F   +++YH++GR W+R +LLYGP
Sbjct  200  PQLKKQITEDLTAFANGKEFYHRVGRAWKRGYLLYGP  236



>emb|CDP07666.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 118/217 (54%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            + L+  L  + + + D    H +F++P+ N       N LYR V +Y+NS+     S   
Sbjct  23   TQLLSFLHSFYESLQDFFSPHAYFEIPEFNGYCGVDVNDLYRHVNLYLNSV--YPSSSCR  80

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdk  379
             L  S +  SN I   +  N  V D F G  +SW + V          RS  L++ K+ +
Sbjct  81   RLSLSRSKSSNRIAFTVAPNHTVHDSFDGHHLSWTHHVETIQDSLEEKRSFTLQLPKRHR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
              +L PYLQH+ T ++  E+  RE +LF N    S +S    W SVPF HPSTFET+ +E
Sbjct  141  LTLLSPYLQHVTTKAEEFERVSRERRLFTNNGHGSYESG---WSSVPFRHPSTFETLALE  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +LK+++  DL+ F + +++Y K+GR W+R +LL+GP
Sbjct  198  PELKDQLMDDLKAFSEGKEFYQKIGRAWKRGYLLHGP  234



>ref|XP_007014067.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOY31686.1| ATP binding protein, putative [Theobroma cacao]
Length=519

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/217 (33%), Positives = 118/217 (54%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S L+  L  + + + D    + +F++P+ N   +   N LYR   +Y+NS++    +   
Sbjct  23   SQLLSLLHSFYESLQDLFTPYSYFEIPEFNGYCSVDLNDLYRHGSLYLNSVN--PSATCR  80

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdk  379
             L  S +  SN I   +  N  + D F G  +SW + V          RS  L++ K+ +
Sbjct  81   RLTLSRSKSSNCISFTVAPNHTIHDTFNGHSISWTHHVETVQDSLEEKRSFTLKLPKRHR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            + +L+PYL H+ + ++  E+  RE +LF N    S +S    W SV F HPSTF+T+ +E
Sbjct  141  QTLLKPYLDHVISSAEEFERVSRERRLFTNNGHGSYESG---WVSVSFRHPSTFDTLALE  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +LK ++  DL  F K +++YH++GR W+R +LLYGP
Sbjct  198  PELKKQIMEDLTAFAKGREFYHRVGRAWKRGYLLYGP  234



>ref|XP_008363332.1| PREDICTED: uncharacterized protein LOC103427036 [Malus domestica]
Length=427

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 115/212 (54%), Gaps = 20/212 (9%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSL----------SSLEDSDFTNLVNS  229
            D L  + +F VP+ N       N LYR V +Y+NSL          +S   S  + L  S
Sbjct  38   DMLTPYSYFDVPEFNGYCGVHLNHLYRHVNLYLNSLVNANTSASSATSSSSSFNSRLTLS  97

Query  230  AAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdkrrilr  394
             +  SN I   +  N  V D F G  +SW   ++ V D     RS VL++ K+ +  +L+
Sbjct  98   RSNSSNRISFTVAPNHSVHDSFRGLTLSWTHHVDTVQDSLEEKRSFVLKLPKRHRHALLQ  157

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            PYL H+   ++  E+  RE +LF N   AS DS    W SVPF HPSTFET+  E  LKN
Sbjct  158  PYLHHLTARAEEFERVSRERRLFTNNGHASYDSG---WVSVPFRHPSTFETLAXEPQLKN  214

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            ++  DL  F + +++YH++GR W+R +LLYGP
Sbjct  215  QLTGDLTAFAEGKEFYHRVGRAWKRGYLLYGP  246



>ref|XP_002512196.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50230.1| ATP binding protein, putative [Ricinus communis]
Length=517

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 111/203 (55%), Gaps = 11/203 (5%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFTN-LVNSAAVKSNDIV  256
            D +  + +F +P+ N       N LYR V +Y+NS+SS   +     L  S +  SN I 
Sbjct  38   DLISPYSYFDIPEFNGYCGVDINDLYRHVNLYLNSVSSSTSAAACRRLTLSRSKSSNCIS  97

Query  257  LCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrrilrPYLQHIHTV  421
              +  NQ V D F G  + W + V          RS  L++ K+ +  +L PYLQH+ + 
Sbjct  98   FTVAPNQTVHDTFSGHSLYWTHHVETVQDSLEEKRSFTLKLPKRHRCNLLGPYLQHVTSR  157

Query  422  SDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETF  601
            ++  E+  RE +LF N   AS +S    W SVPF HPSTFET+ +E  LK ++  DL+ F
Sbjct  158  AEEFERVSRERRLFTNNGNASHESG---WVSVPFRHPSTFETLALEPQLKKQIMGDLKAF  214

Query  602  LKSQQYYHKLGRVWRRSFLLYGP  670
               + +YH++GR W+R +LL+GP
Sbjct  215  SNGKAFYHRVGRAWKRGYLLHGP  237



>ref|XP_010243399.1| PREDICTED: ATPase family gene 2 protein-like [Nelumbo nucifera]
Length=524

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 117/217 (54%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S L+  L  + + + D    + +F++P+ N       N LYR V +Y+NS+     +   
Sbjct  23   SQLLSLLHSFYESLQDFFSPYSYFEIPEFNGHYGVDVNDLYRHVNLYLNSVDP--SATCR  80

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdk  379
             L  + +  SN I   +  N  V D F G RVSW   +  V D     RS  L++ K+ +
Sbjct  81   RLTLTLSKTSNRISFTIAPNHTVHDSFNGHRVSWTHHLETVQDSIEEKRSFSLKLPKRHR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            R +L  YL+ + T ++  E+  RE +L+ N    S +S    W SVPF HPSTF+T+ +E
Sbjct  141  RTLLPSYLEFVSTRAEEFERVSRERRLYTNNGHGSYESG---WVSVPFRHPSTFDTLALE  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +LK ++  DL  F   +++YH++GR W+R +LLYGP
Sbjct  198  LELKEQITEDLTAFANGREFYHRVGRSWKRGYLLYGP  234



>ref|XP_008647225.1| PREDICTED: probable mitochondrial chaperone bcs1 [Zea mays]
Length=199

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 69/92 (75%), Gaps = 5/92 (5%)
 Frame = +2

Query  404  QHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG--RWRSVPFTHPSTFETVVMESDLKNR  577
            +H+ +V++ +EQRRREL+LF N  +   D+A G  RW S PFTHP+T +TV M+ DLK  
Sbjct  12   KHVESVAEEMEQRRRELRLFANTGV---DAATGTPRWVSAPFTHPATLDTVAMDPDLKVC  68

Query  578  VKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             ++DLE+FLK + YYH+L RVWR ++LLYGP+
Sbjct  69   DRADLESFLKGRAYYHRLSRVWRHNYLLYGPT  100



>ref|XP_010257525.1| PREDICTED: uncharacterized protein LOC104597594 [Nelumbo nucifera]
Length=516

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 115/217 (53%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S L+  L  + + + D    + +F++P+ N       N LYR V +Y+NS+         
Sbjct  23   SQLLSLLHSFYESLQDFFSPYSYFEIPEFNGYCGVDVNDLYRHVNLYLNSIDPSATCRRL  82

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdk  379
             L  S    SN I   +  N  V D F G RVSW   ++ V D     RS  L++ K+ +
Sbjct  83   TLTRSKT--SNCISFTVAPNHTVHDSFNGHRVSWTHHVDTVQDSLEEKRSFSLKLPKRHR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            + +L  YL+ + + ++  E+  RE +L+ N    S +S    W SVPF HPSTFET+ +E
Sbjct  141  QALLSSYLEFVSSRAEEFERVSRERRLYTNNGHGSYESG---WVSVPFRHPSTFETLALE  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +LK ++  DL  F   + +YH++GR W+R +LLYGP
Sbjct  198  PELKEQLTEDLTAFANGRDFYHRVGRSWKRGYLLYGP  234



>ref|XP_008354934.1| PREDICTED: uncharacterized protein LOC103418605 [Malus domestica]
Length=556

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 115/212 (54%), Gaps = 20/212 (9%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSL----------SSLEDSDFTNLVNS  229
            D L  + +F VP+ N       N LYR V +Y+NSL          +S   S  + L  S
Sbjct  38   DMLTPYSYFDVPEFNGYCGVHLNHLYRHVNLYLNSLVNANASASSATSSSSSFNSRLTLS  97

Query  230  AAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdkrrilr  394
             +  SN I   +  N  V D F G  +SW   ++ V D     RS VL++ K+ +  +L+
Sbjct  98   RSNSSNRISFTVAPNHSVHDSFRGLTLSWTHHVDTVQDSLEEKRSFVLKLPKRHRHALLQ  157

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            PYL H+   ++  E+  RE +LF N   AS DS    W SVPF HPSTFET+  E  LKN
Sbjct  158  PYLHHLTARAEEFERVSRERRLFTNNGHASYDSG---WVSVPFRHPSTFETLAXEPQLKN  214

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            ++  DL  F + +++YH++GR W+R +LLYGP
Sbjct  215  QLTGDLTAFAEGKEFYHRVGRAWKRGYLLYGP  246



>emb|CBI23057.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   114 bits (284),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 5/91 (5%)
 Frame = +2

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            PYLQHI       E+  +ELKL++N    S   + GRWRSVPFTH +T ETV M+SDLK+
Sbjct  368  PYLQHILA---KYEEFEKELKLYIN--CESRRLSDGRWRSVPFTHQATMETVAMDSDLKS  422

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYG  667
            +VKSDLE FLKS+QYY +LGRVW+RS+LL+G
Sbjct  423  KVKSDLELFLKSKQYYQRLGRVWKRSYLLHG  453



>ref|XP_002267624.1| PREDICTED: uncharacterized protein LOC100263212 [Vitis vinifera]
Length=516

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/217 (33%), Positives = 114/217 (53%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S ++  L  + + + D      +F++P+ N       N LYR V +Y+NS++        
Sbjct  23   SQILSLLHSFYESLQDFFSPFAYFEIPEFNDYCGVDVNDLYRHVNLYLNSVNPATTCRRF  82

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdk  379
             L  S +  SN I   +  N  V D F G  +SW + V          RS  L++ K+ +
Sbjct  83   TLSRSKS--SNRISFTVAPNHTVHDSFNGHTLSWTHHVETVQDSLDERRSFSLKLPKRHR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
            + +L PYL+ + + ++  E+  RE +LF N    S +S    W SVPF HPSTFET+ +E
Sbjct  141  QALLSPYLELVTSRAEEFERVSRERRLFTNNGHGSYESG---WVSVPFRHPSTFETLALE  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              L+ ++  DL  F   +++YH++GR W+R +LLYGP
Sbjct  198  PQLRQQITDDLTAFANGKEFYHRVGRAWKRGYLLYGP  234



>ref|XP_009365053.1| PREDICTED: uncharacterized protein LOC103954926 [Pyrus x bretschneideri]
Length=556

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 116/212 (55%), Gaps = 20/212 (9%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSL----------SSLEDSDFTNLVNS  229
            D L  + +F VP+ N       N LYR V +Y+NSL          +S   S  + L  S
Sbjct  38   DMLTPYSYFDVPEFNGYCGVHLNHLYRHVNLYLNSLVNANASASSATSSSSSFNSRLTLS  97

Query  230  AAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdkrrilr  394
             +  SN I   +  N  V D F G  +SW   ++ V D     RS VL++ K+ +  +L+
Sbjct  98   RSNSSNRISFTVAPNYSVHDSFRGLTLSWTHHVDTVQDSLEEKRSFVLKLPKRHRHALLQ  157

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            PYL H+   ++  E+  RE +LF N   AS +S    W SVPF HPSTFET+ +E  LKN
Sbjct  158  PYLHHLTARAEEFERVSRERRLFTNNGHASYESG---WVSVPFRHPSTFETLALEPQLKN  214

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            ++  DL  F + +++YH++GR W+R +LLYGP
Sbjct  215  QLTGDLTAFAEGKEFYHRVGRAWKRGYLLYGP  246



>ref|XP_010098650.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXB75451.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=538

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 112/213 (53%), Gaps = 21/213 (10%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDS--DFTNLVNSAAVKS---  244
            D L  + + ++P+ N       N LYR V +Y+N++     S    T L++ +       
Sbjct  38   DLLSPYSYLEIPEFNGYCGVDVNDLYRHVNLYLNAVDPSASSCRRLTALLSRSNSSINNN  97

Query  245  ------NDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrril  391
                  +     +  N  V+D F G  ++W + V          RS VL++ K+ ++ +L
Sbjct  98   NNTNNRHGFSFAVAPNHSVRDAFCGHTLTWTHHVEAVPESLEERRSFVLKLPKRHRQTLL  157

Query  392  rPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLK  571
             PYL H+ + S+  E+  RE +LF N    S DS    W SVPF HPSTFET+ +E+ LK
Sbjct  158  SPYLDHVISRSEEFERVSRERRLFTNNGHGSYDSG---WVSVPFRHPSTFETLALETQLK  214

Query  572  NRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            N++  DL +F   + +YH++GR W+R +LLYGP
Sbjct  215  NQITQDLTSFANGKDFYHRVGRAWKRGYLLYGP  247



>gb|AFW73657.1| hypothetical protein ZEAMMB73_137926 [Zea mays]
Length=340

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 69/92 (75%), Gaps = 5/92 (5%)
 Frame = +2

Query  404  QHIHTVSDNIEQRRRELKLFMNRSLASDDSAAG--RWRSVPFTHPSTFETVVMESDLKNR  577
            +H+ +V++ +EQRRREL+LF N  +   D+A G  RW S PFTHP+T +TV M+ DLK  
Sbjct  12   KHVESVAEEMEQRRRELRLFANTGV---DAATGTPRWVSAPFTHPATLDTVAMDPDLKVC  68

Query  578  VKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
             ++DLE+FLK + YYH+L RVWR ++LLYGP+
Sbjct  69   DRADLESFLKGRAYYHRLSRVWRHNYLLYGPT  100



>emb|CBI38680.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = +2

Query  26   LFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  205
            L L    +  AL+KWS  + D    +Q FKVP+ N+N Q+N LYRKV VY+NSL +LEDS
Sbjct  25   LALVLGLVAVALKKWSR-VGDWFQAYQLFKVPEFNENMQDNYLYRKVSVYINSLVALEDS  83

Query  206  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  322
            DFTNL +    K+N+IVL LD NQ V D FLGARVSW N
Sbjct  84   DFTNLFSGK--KANEIVLALDPNQTVHDTFLGARVSWTN  120



>ref|XP_004151742.1| PREDICTED: probable mitochondrial chaperone BCS1-A-like [Cucumis 
sativus]
 ref|XP_004172622.1| PREDICTED: probable mitochondrial chaperone BCS1-A-like [Cucumis 
sativus]
 gb|KGN58634.1| ATP binding protein [Cucumis sativus]
Length=503

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 110/196 (56%), Gaps = 13/196 (7%)
 Frame = +2

Query  107  FFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQV  280
            +F +P+ N   +   N+LYR V +Y+NSL +   +    L  S +  SN I   +  NQ 
Sbjct  45   YFDIPEFNGYCSVDLNELYRHVTLYLNSLHN--SAACRRLSLSRSKSSNRISFTVAPNQS  102

Query  281  VQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRR  445
            V   F G R+SW ++V          RS  L+I K+ ++ +L  YL HI   +   E+  
Sbjct  103  VHVTFNGQRISWTHQVETVQDSLDEKRSFSLKIPKRHRQALLPLYLDHITATAAEFERTS  162

Query  446  RELKLFMNRSLASD-DSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYY  622
            RE +LF N   AS  DS    W SVPF HPSTFET+ +E++LK ++ +DL  F   +++Y
Sbjct  163  RERRLFTNNGNASSYDSG---WVSVPFRHPSTFETLALETELKKQIMNDLMAFAAGREFY  219

Query  623  HKLGRVWRRSFLLYGP  670
             ++GR W+R +LLYGP
Sbjct  220  SRVGRAWKRGYLLYGP  235



>ref|XP_008346741.1| PREDICTED: probable mitochondrial chaperone bcs1 [Malus domestica]
Length=247

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 79/119 (66%), Gaps = 16/119 (13%)
 Frame = +2

Query  317  MNKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA  496
            + K    G RS VL+I + DKRR+   Y QHI TV+D IEQR RE+KL++N S     S 
Sbjct  50   LQKSQSDGIRSFVLKINRSDKRRVFHQYFQHILTVADEIEQRNREIKLYINLS-----SE  104

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
              RWRSVPFTHP+TF+TVVM ++LKN+++SDLE F            VW+RSFLLY PS
Sbjct  105  NERWRSVPFTHPATFDTVVMNTELKNKIRSDLENF-----------HVWKRSFLLYDPS  152



>ref|XP_006290651.1| hypothetical protein CARUB_v10016743mg [Capsella rubella]
 gb|EOA23549.1| hypothetical protein CARUB_v10016743mg [Capsella rubella]
Length=725

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 70/201 (35%), Positives = 106/201 (53%), Gaps = 15/201 (7%)
 Frame = +2

Query  98   VHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQ  277
            VH  F     ++  +++Q Y  +    N LSS   +    L  + +  S  +VL LDD++
Sbjct  266  VHIRFTEYTEDKGLKKSQAYDSI---RNYLSSKSTARAQRLKANESKNSKSLVLSLDDHE  322

Query  278  VVQDQFLGARVSWM-------NKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIE  436
             V+D F G +V W        N+ +    R L L    +D+  I   YL H+  V   I 
Sbjct  323  AVEDVFQGVKVVWSLSVRKSDNESNSTEKRYLTLSFHNRDRDMITTTYLDHVMRVGKEIG  382

Query  437  QRRRELKLFMNRSLASDDSAA---GRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLK  607
             + RE KL+ N S  S D ++   GRW +VPF HP+TFET+ M+ + K+ +K DL  F K
Sbjct  383  LKNRERKLYTNNS--SQDYSSWREGRWSNVPFEHPATFETLAMDLEKKDEIKKDLIKFTK  440

Query  608  SQQYYHKLGRVWRRSFLLYGP  670
             + YY K+G+ W+R +LL+GP
Sbjct  441  GKDYYMKVGKPWKRGYLLFGP  461



>ref|XP_008461752.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis melo]
Length=503

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 109/196 (56%), Gaps = 13/196 (7%)
 Frame = +2

Query  107  FFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQV  280
            +F +P+ N   +   N+LYR V +Y+NSL +   +    L  S +  SN I   +  N  
Sbjct  45   YFDIPEFNGYCSVDLNELYRHVTLYLNSLHN--SAACRRLSLSRSKSSNRISFTVAPNHS  102

Query  281  VQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRR  445
            V   F G R+SW ++V          RS  L+I K+ ++ +L  YL HI   +   E+  
Sbjct  103  VHVTFNGQRLSWTHQVETVQDSLDEKRSFSLKIPKRHRQALLPLYLDHITATAAEFERTS  162

Query  446  RELKLFMNRSLASD-DSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYY  622
            RE +LF N   AS  DS    W SVPF HPSTFET+ +E++LK ++  DL+ F   +++Y
Sbjct  163  RERRLFTNNGNASSYDSG---WVSVPFRHPSTFETLALETELKKQIMDDLKAFSAGREFY  219

Query  623  HKLGRVWRRSFLLYGP  670
             ++GR W+R +LLYGP
Sbjct  220  SRVGRAWKRGYLLYGP  235



>ref|XP_006849577.1| hypothetical protein AMTR_s00024p00191310 [Amborella trichopoda]
 gb|ERN11158.1| hypothetical protein AMTR_s00024p00191310 [Amborella trichopoda]
Length=498

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 113/217 (52%), Gaps = 12/217 (6%)
 Frame = +2

Query  41   SALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSLEDSDFT  214
            S ++  +  W + + D +  + +F++P+ N   + + N+LYR++ +Y+ SL +  +S   
Sbjct  23   SQILTLILSWYESLQDLISPYSYFEIPEFNGYCSVEPNELYRQIQLYLQSLGTCLNS--R  80

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdk  379
             +  + A  S  I   +  NQ   D + G +  W + V          RS  L+I K+D+
Sbjct  81   RVTATRAKNSRQISFMVAPNQSFDDTWNGRKFLWTHHVETVQESLEERRSFGLKISKRDR  140

Query  380  rrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVME  559
               L  Y + I  +++  E   R+ +LF N      +S    W SVPF HP+TFET+  +
Sbjct  141  EFGLNRYFERIAKIAEEFENSSRDRRLFTNNGHGGFESG---WASVPFRHPATFETLAFD  197

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              LK  + SDL  F K++ +Y ++GR W+R +LLYGP
Sbjct  198  PKLKAEITSDLTAFSKARDFYSRVGRSWKRGYLLYGP  234



>ref|XP_008363437.1| PREDICTED: probable mitochondrial chaperone bcs1 [Malus domestica]
Length=245

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 79/119 (66%), Gaps = 16/119 (13%)
 Frame = +2

Query  317  MNKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA  496
            + K    G RS VL+I + DKRR+ R Y QHI T++D IEQR RE+KL++N S     S 
Sbjct  48   LQKSQSDGIRSFVLKINRSDKRRVFRQYFQHILTIADEIEQRNREIKLYINLS-----SE  102

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
              RWR VPFTHP+TF+TVVM ++LKN+++SDLE F           RVW+ SFLLY PS
Sbjct  103  NERWRLVPFTHPATFDTVVMNAELKNKIRSDLENF-----------RVWKWSFLLYDPS  150



>emb|CDY61725.1| BnaA04g27140D [Brassica napus]
Length=99

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  503  RWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            RWRS+PF HPSTF+ + M +DLK++VKSDLE+FLK +QYY +LGRVW++S+LLYGP
Sbjct  10   RWRSIPFNHPSTFDNIAMGTDLKSKVKSDLESFLKGKQYYSRLGRVWKQSYLLYGP  65



>ref|XP_008231398.1| PREDICTED: uncharacterized protein LOC103330578 [Prunus mume]
Length=561

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 112/212 (53%), Gaps = 20/212 (9%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVN---------SLSSLEDSDF-TNLVNS  229
            D L  + +F VP+ N       N LYR V +Y+N         + ++   S F   L  S
Sbjct  38   DMLCPYSYFDVPEFNGYCGVHLNDLYRHVNLYLNSLVNVNVNVTATNPSSSSFNARLTLS  97

Query  230  AAVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdkrrilr  394
             +  SN I   +  N  V D F G  +SW   ++ V D     RS VL++ K+ +  +L 
Sbjct  98   RSNSSNRISFTVAPNHSVSDSFGGHILSWTHHVDTVQDSLDEKRSFVLKLPKRHRHALLH  157

Query  395  PYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKN  574
            PYL H+   ++  E+  RE +LF N   AS DS    W SVPF HPSTF+T+ +E  LK+
Sbjct  158  PYLHHLTARAEEFERVSRERRLFTNNGHASYDSG---WVSVPFRHPSTFDTLALEPQLKS  214

Query  575  RVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            ++  DL+ F   + +YH++GR W+R + LYGP
Sbjct  215  QLTGDLKAFANGKDFYHRVGRAWKRGYFLYGP  246



>ref|XP_009785900.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
sylvestris]
Length=499

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 101/195 (52%), Gaps = 20/195 (10%)
 Frame = +2

Query  134  NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVS  313
            N + N +Y +V  Y+ + S  +D+ +     S   KS    + LD+ + + DQFLGA++S
Sbjct  59   NGKSNDIYTQVNSYLGTKSINKDAKYLKAEKSKNSKS--FAVSLDEGEEIIDQFLGAKLS  116

Query  314  WMNKVH----DGGGR---------SLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRREL  454
            W + +     +  GR         S  +   ++ K  ++  YL+H+      IE + R+ 
Sbjct  117  WRSHIETFNENSSGRNNSRPIEKKSYTITFNQRYKEMVIEKYLKHVMEEGKAIEFKNRKQ  176

Query  455  KLFMNRSLASDD---SAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYH  625
            K++ N    S+D      G WR + F HP+TF+T+ M+   K  + SDL  F K + YY 
Sbjct  177  KIYTNN--CSEDWYWYGKGMWRDINFEHPATFDTLAMDPKKKEEIVSDLVAFSKGKDYYS  234

Query  626  KLGRVWRRSFLLYGP  670
            K+G+ W+R +LLYGP
Sbjct  235  KVGKAWKRGYLLYGP  249



>ref|XP_007218964.1| hypothetical protein PRUPE_ppa003630mg [Prunus persica]
 gb|EMJ20163.1| hypothetical protein PRUPE_ppa003630mg [Prunus persica]
Length=560

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 113/211 (54%), Gaps = 19/211 (9%)
 Frame = +2

Query  86   DKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSL--------EDSDF-TNLVNSA  232
            D L  + +F VP+ N       N LYR V +Y+NSL ++          S F   L  S 
Sbjct  38   DMLCPYSYFDVPEFNGYCGVHLNDLYRHVNLYLNSLVNVNVNVTSNPSSSSFNARLTLSR  97

Query  233  AVKSNDIVLCLDDNQVVQDQFLGARVSW---MNKVHDG--GGRSLVlrikkkdkrrilrP  397
            +  SN I   +  N  V D F G  +SW   ++ V D     RS VL++ K+ +  +L P
Sbjct  98   SNSSNRISFTVAPNHSVSDSFGGHILSWTHHVDTVQDSLDEKRSFVLKLPKRHRHALLHP  157

Query  398  YLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNR  577
            YL H+   ++  E+  RE +LF N   AS DS    W SVPF HPSTF+T+ +E  LK++
Sbjct  158  YLHHLTARAEEFERVSRERRLFTNNGHASYDSG---WVSVPFRHPSTFDTLALEPQLKSQ  214

Query  578  VKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +  DL+ F   + +YH++GR W+R + LYGP
Sbjct  215  LTGDLKAFANGKDFYHRVGRAWKRGYFLYGP  245



>gb|KFK33168.1| hypothetical protein AALP_AA6G339300 [Arabis alpina]
Length=656

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 96/185 (52%), Gaps = 16/185 (9%)
 Frame = +2

Query  155  YRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD  334
            Y  +  Y+N  SS   S   NL  +    S  +VL LDD++ + D+F G +V W +K H 
Sbjct  210  YANIQSYLNKDSS---SRAKNLRANTIKGSKSVVLSLDDHEEITDEFRGVKVWWQSKTHQ  266

Query  335  GGGRS------------LVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSL  478
               RS             +L+   +D++ I   Y+ H+      +E ++RE KL+ N   
Sbjct  267  IESRSNPYQPKTEESRFYILKCHIRDRKVITNEYIDHVKEEGKKMELKKRERKLYSNNPS  326

Query  479  AS-DDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSF  655
             S       +W  V F HP+TFET+ M++ +K  +K+DL  F  SQ YY K+G+ W+R +
Sbjct  327  HSWSGYKQTKWSHVTFEHPATFETLAMDNKMKEDIKNDLTKFRNSQDYYKKIGKAWKRGY  386

Query  656  LLYGP  670
            LLYGP
Sbjct  387  LLYGP  391



>gb|KCW46602.1| hypothetical protein EUGRSUZ_K00412 [Eucalyptus grandis]
Length=323

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  503  RWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGPS  673
            RW SVPFTHP+T +TVVM+ +LK +VKSDLE+FLKS+QYYH+LGRVW+RS+LL+G S
Sbjct  15   RWLSVPFTHPATIDTVVMDPELKGKVKSDLESFLKSKQYYHRLGRVWKRSYLLHGAS  71



>ref|XP_008811298.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811299.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811300.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811301.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811303.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811304.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811305.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008811306.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
Length=523

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/238 (32%), Positives = 119/238 (50%), Gaps = 19/238 (8%)
 Frame = +2

Query  2    VSVFAAVRLFL---YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFV  172
            + VFA  +  L   +   L FA  K  + + +    + +F + +++     N+LY  V V
Sbjct  12   MGVFAFCQSLLHAVFPPELRFATAKLFNRLFNCFSSYCYFDITEID-GVNTNELYNAVQV  70

Query  173  YVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG---  343
            Y++S +S+  S    L  + A+ S+     L +N  + D F GA  +W + V        
Sbjct  71   YLSSSASVAGS---RLSLTRALNSSAFTFGLSNNDRLVDTFRGATATWEHVVTQRQAQTF  127

Query  344  ---------RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA  496
                     R   LRI+KKDK  IL+ YL HI   +++I +R ++  L+ N    + DS 
Sbjct  128  SWRPLPDEKRGFTLRIEKKDKPLILQAYLDHIMDTANDIRRRNQDRLLYTNSRGGAMDSR  187

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
               W SVPF HPSTF+T+ M+   K  + +DL  F +   +Y K GR W+R +LLYGP
Sbjct  188  GHPWESVPFKHPSTFDTLAMDPSKKEEIMADLRDFAEGNAFYQKTGRAWKRGYLLYGP  245



>ref|XP_009594242.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
tomentosiformis]
Length=499

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 101/195 (52%), Gaps = 20/195 (10%)
 Frame = +2

Query  134  NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVS  313
            N + N +Y +V  Y+ + S  +D+ +     S   KS  + + LD+ + + DQFLGA++S
Sbjct  59   NGKSNDIYTQVNSYLGTKSINKDAKYLKAEKSKNSKS--VAVSLDEGEEITDQFLGAKLS  116

Query  314  WMNKVH----DGGGR---------SLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRREL  454
            W + +     +  GR         S  +   ++ K  ++  YL+H+      IE + R+ 
Sbjct  117  WRSHIETFNENSSGRKNSRPIEKKSYTITFNQRYKEMVIGKYLKHVMEEGKVIEFKNRKQ  176

Query  455  KLFMNRSLASDD---SAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYH  625
            K++ N    S+D      G WR + F HP+TF+T+ M+   K  +  DL  F K + YY 
Sbjct  177  KIYSNN--CSEDWYWYEKGMWRDINFEHPATFDTLAMDPKKKEEIVIDLIAFSKGKDYYS  234

Query  626  KLGRVWRRSFLLYGP  670
            K+G+ W+R +LLYGP
Sbjct  235  KVGKAWKRGYLLYGP  249



>ref|NP_001030789.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 gb|AEE77458.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=508

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 104/200 (52%), Gaps = 13/200 (7%)
 Frame = +2

Query  98   VHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQ  277
            VH  F     ++  +++Q Y  +  Y++S S+   +    L  + +  S  +VL LD+++
Sbjct  52   VHIKFTEYTEDKGLKKSQAYDLIRNYLSSKST---ARAQRLKANESKNSKSLVLSLDNHE  108

Query  278  VVQDQFLGARVSWM-------NKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIE  436
             V+D F G +V W        ++      R L L    + +  I   YL H+      I 
Sbjct  109  AVEDVFQGVKVVWSLSVWKSNDQADSSEKRYLTLSFHNRYREMITTTYLDHVLREGKEIG  168

Query  437  QRRRELKLFMNRSLASDDSA--AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKS  610
             + RE KL+ N S + D SA   GRW +VPF HP+TFET+ M+ + K  +K DL  F K 
Sbjct  169  LKNRERKLYTNNS-SQDYSAWREGRWSNVPFDHPATFETLAMDLEKKEGMKKDLIKFTKG  227

Query  611  QQYYHKLGRVWRRSFLLYGP  670
            + YY K+G+ W+R +LL+GP
Sbjct  228  KDYYRKVGKPWKRGYLLFGP  247



>ref|XP_009403322.1| PREDICTED: cell division cycle protein 48-like [Musa acuminata 
subsp. malaccensis]
Length=518

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 116/232 (50%), Gaps = 30/232 (13%)
 Frame = +2

Query  11   FAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLS  190
            FA ++LF +R  L F+              + +F + +++     N+LY  V +Y++  +
Sbjct  32   FAVLKLF-HRVFLCFS-------------TYCYFDITEID-GVNTNELYHAVQLYLSRSA  76

Query  191  SLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------  334
            S+  S    L  S  + S+     L  N  + D F GA  +W + V              
Sbjct  77   SVAAS---RLSLSRGLNSSAFTFGLTSNDCLVDTFCGATATWEHVVTQRQSQTFSWRPLP  133

Query  335  GGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRS  514
            G  RS  LRIKKKDK  IL  YL HI   + ++ +R ++  L+ N    S +S    W S
Sbjct  134  GEKRSFTLRIKKKDKPLILPAYLDHIMETATDLRRRNQDRLLYTNSRGGSIESRVVPWES  193

Query  515  VPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            VPF HPSTF+T+ M+S  K  + +DL+ F + + +Y K GR W+R +LLYGP
Sbjct  194  VPFKHPSTFDTLAMDSSRKELIMADLKDFAEGKAFYEKTGRAWKRGYLLYGP  245



>ref|NP_189495.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 dbj|BAB01955.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77457.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=510

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 104/200 (52%), Gaps = 13/200 (7%)
 Frame = +2

Query  98   VHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQ  277
            VH  F     ++  +++Q Y  +  Y++S S+   +    L  + +  S  +VL LD+++
Sbjct  52   VHIKFTEYTEDKGLKKSQAYDLIRNYLSSKST---ARAQRLKANESKNSKSLVLSLDNHE  108

Query  278  VVQDQFLGARVSWM-------NKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIE  436
             V+D F G +V W        ++      R L L    + +  I   YL H+      I 
Sbjct  109  AVEDVFQGVKVVWSLSVWKSNDQADSSEKRYLTLSFHNRYREMITTTYLDHVLREGKEIG  168

Query  437  QRRRELKLFMNRSLASDDSA--AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKS  610
             + RE KL+ N S + D SA   GRW +VPF HP+TFET+ M+ + K  +K DL  F K 
Sbjct  169  LKNRERKLYTNNS-SQDYSAWREGRWSNVPFDHPATFETLAMDLEKKEGMKKDLIKFTKG  227

Query  611  QQYYHKLGRVWRRSFLLYGP  670
            + YY K+G+ W+R +LL+GP
Sbjct  228  KDYYRKVGKPWKRGYLLFGP  247



>ref|XP_010048616.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW80929.1| hypothetical protein EUGRSUZ_C02288 [Eucalyptus grandis]
Length=517

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 95/189 (50%), Gaps = 19/189 (10%)
 Frame = +2

Query  146  NQLYRKVFVYVNSLSSLEDS--DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM  319
            N+LY  V +Y++S  S   S    T  VNS+A         L +N  + D F G  V W 
Sbjct  62   NELYNAVQLYLSSFVSASGSRLSLTRAVNSSAT-----TFGLSNNDCINDDFKGVAVQWE  116

Query  320  NKVHD------------GGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLF  463
            + V                 R   LRI+K+DK  IL  YL +I   +++I ++ +E  L+
Sbjct  117  HVVTQRQSQSFSWRPLPDEKRGFTLRIRKRDKDIILDSYLDYIMEKANDIRRKSQERLLY  176

Query  464  MNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVW  643
             N    S DS    W SVPF HPSTFET+ M+ + K  +K DL  F   Q +Y + GR W
Sbjct  177  TNSRGGSLDSRGHPWESVPFKHPSTFETLAMDPERKREIKEDLRDFAAGQAFYQRTGRAW  236

Query  644  RRSFLLYGP  670
            +R +LLYGP
Sbjct  237  KRGYLLYGP  245



>emb|CDY00129.1| BnaC09g01720D [Brassica napus]
Length=375

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 94/177 (53%), Gaps = 13/177 (7%)
 Frame = +2

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKV-----HDGGG  343
            N LS+   +    L  + +  S  +VL +DD++ V+D+F G +V W + V         G
Sbjct  75   NYLSTNSAARAQRLKANESKNSKSLVLSMDDHEEVEDEFNGVKVKWYSNVKVTQTQSNYG  134

Query  344  RS-------LVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAA  499
            R+         L   ++ +  I+  YL H+      I  R RE KL+ N S +      +
Sbjct  135  RTSSDERRFFTLTFHRRHRGMIIETYLNHVIDEGKAIGLRNRERKLYTNNSSSEWYPWRS  194

Query  500  GRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            G+W +VPF HP+TFET+ M+ + K R+K DL  F K + YY K+G+ W+R +LL+GP
Sbjct  195  GKWSNVPFHHPATFETLAMDPEKKERIKKDLIKFSKGKDYYKKVGKPWKRGYLLFGP  251



>ref|XP_010914133.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
 ref|XP_010914134.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
 ref|XP_010914135.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
 ref|XP_010914136.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
 ref|XP_010914137.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
Length=514

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 119/238 (50%), Gaps = 19/238 (8%)
 Frame = +2

Query  2    VSVFAAVRLFL---YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFV  172
            + VFA  +  L   + + L FA  K  + + +    + +F + +++     N+LY  V V
Sbjct  12   MGVFAFCQSILHAVFPAELRFATAKLFNRLFNCFSSYCYFDITEID-GVNTNELYNAVQV  70

Query  173  YVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG---  343
            Y++S +S+  S    L  + A+ S+     L +N  + D F GA  +W + V        
Sbjct  71   YLSSSASVAGS---RLSLTRALNSSAFTFGLSNNDRLVDTFRGATATWEHVVTQRQAQTF  127

Query  344  ---------RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA  496
                     R   LRIKKKDK  IL  YL HI   +++I +R ++  L+ N    + DS 
Sbjct  128  SWRPLPDEKRGFTLRIKKKDKPLILPAYLDHIMDTANDIRRRNQDRLLYTNSRGGAMDSR  187

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
               W SVPF HPSTF+T+ M+   K  + +DL  F +   +Y K GR W+R +LLYGP
Sbjct  188  GHPWESVPFKHPSTFDTLAMDPFKKEEIMADLRDFAEGNTFYQKTGRAWKRGYLLYGP  245



>ref|XP_010430825.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 2 [Camelina 
sativa]
Length=304

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 80/165 (48%), Gaps = 19/165 (12%)
 Frame = +2

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVl  358
            N LSS   +    L  + +  S  +VL LDD+Q V+D F G +V W   V     +S   
Sbjct  62   NYLSSKSTARAQRLKANESKNSKSLVLSLDDHQAVEDVFQGVKVVWSLSVWKSDNKS---  118

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHPS  535
                                +   I    RE KL+ N S         GRW +VPF HP+
Sbjct  119  ---------------DSTEKIGKEIGLNNRERKLYTNNSSQEWYPWREGRWSNVPFDHPA  163

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+ D K+R+K DL  F K + YY K+G+ W+R +LL+GP
Sbjct  164  TFETLAMDLDKKDRIKKDLIKFTKGKDYYKKVGKPWKRGYLLFGP  208



>ref|XP_006662517.1| PREDICTED: probable mitochondrial chaperone bcs1-like, partial 
[Oryza brachyantha]
Length=260

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  503  RWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            RW S PFTHP+T ETV M+ +LK RV++DLE+FLK + YYH+LGR WRRS+LLYGP
Sbjct  5    RWASAPFTHPATLETVAMDPELKARVRADLESFLKGRAYYHRLGRAWRRSYLLYGP  60



>ref|XP_009614445.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
tomentosiformis]
Length=499

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 100/195 (51%), Gaps = 20/195 (10%)
 Frame = +2

Query  134  NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVS  313
            N + N +Y +V  Y+ + S  +D+ +     S   KS    + LD+ + + DQFLGA++S
Sbjct  59   NGKSNDIYTQVNSYLGTKSINKDAKYLKAEKSKNSKS--FAVSLDEGEEIIDQFLGAKLS  116

Query  314  WMNKVH----DGGGR---------SLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRREL  454
            W + +     +  GR         S  +   ++ K  ++  YL+H+      IE + R+ 
Sbjct  117  WRSHIETFNENSSGRNNSRPIEKKSYTITFNQRYKEMVIGKYLKHVMEEGKVIEFKNRKQ  176

Query  455  KLFMNRSLASDD---SAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYH  625
            K++ N    S+D      G WR + F HP+TF+T+ M+   K  +  DL  F K + YY 
Sbjct  177  KIYTNN--CSEDWYWYGKGMWRDINFEHPATFDTLAMDPKKKEEIIIDLIAFSKGKDYYS  234

Query  626  KLGRVWRRSFLLYGP  670
            K+G+ W+R +LLYGP
Sbjct  235  KVGKAWKRGYLLYGP  249



>ref|NP_189499.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 dbj|BAB02174.1| mitochondrial protein-like [Arabidopsis thaliana]
 gb|AAL59899.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77462.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=500

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 86/155 (55%), Gaps = 13/155 (8%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSL------------Vlrikkkdkrr  385
            S  IVL +DD + + D F G RV W +K      +S             +LR  ++D+  
Sbjct  95   SKSIVLSMDDKEEITDDFEGIRVWWQSKKEGATRQSFSFYPEANEKRYYMLRFHRRDREV  154

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            I+  YL+H+      IEQ+ RE KL+ N    S  + + +W  V F HP+TF+T+ ME +
Sbjct  155  IIERYLEHVMREGKTIEQKNRERKLYSNTPGQSHGNNS-KWSHVTFEHPATFDTLAMEEN  213

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             K  +KSDL  F KS+ YY K+G+ W+R +LL+GP
Sbjct  214  KKEEIKSDLIKFSKSKDYYKKIGKAWKRGYLLFGP  248



>ref|XP_007014284.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY31903.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=538

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 111/225 (49%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K+ +WI      + +F + +++     N+LY  V +Y++S  S+  S  
Sbjct  53   IFPPELRFACLKFFNWIFHLFSSYCYFDITEID-GVNTNELYNAVQLYLSSSVSINGS--  109

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG------------RSLV  355
              L  + A+ S+ I   L +N  + D F G  V W + V                 R   
Sbjct  110  -RLSLTRALNSSAITFGLSNNDCIIDTFNGVTVLWEHVVTQRQSQTFSWRPLPEEKRGFT  168

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKK+DK  IL  YL +I   +  I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  169  LRIKKRDKSLILDSYLDYIMEKAIEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  228

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TF+T+ M+   K  +  DL+ F   Q +Y K GR W+R +LLYGP
Sbjct  229  TFDTLAMDPVKKQEIMDDLKDFANGQSFYQKTGRAWKRGYLLYGP  273



>emb|CDX82999.1| BnaA01g19990D [Brassica napus]
Length=420

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 91/177 (51%), Gaps = 13/177 (7%)
 Frame = +2

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSL--  352
            N LS    S    L  + +  S  IVL +DD++ + D+F G +V W +K H    RS+  
Sbjct  75   NYLSKDSSSRAKKLRANTSKGSKSIVLSMDDHEEITDEFKGVKVWWQSKKHQTDSRSISY  134

Query  353  ----------VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAA  499
                      +L+   +D+  I   YL HI      +E + RE KL+ N    +      
Sbjct  135  FPKTEESRFYILKFHVRDRHVITNRYLDHIRKEGKKMEVKNRERKLYSNNPSQNWSGYNQ  194

Query  500  GRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +W  V F HP+TF+T+ ME++ K  +K+DL  F  SQ YY ++G+ W+R +LL+GP
Sbjct  195  TKWSHVTFEHPATFDTLAMENEKKEEIKNDLTKFSNSQDYYKRIGKAWKRGYLLHGP  251



>ref|XP_006290273.1| hypothetical protein CARUB_v10017055mg [Capsella rubella]
 gb|EOA23171.1| hypothetical protein CARUB_v10017055mg [Capsella rubella]
Length=505

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 84/149 (56%), Gaps = 10/149 (7%)
 Frame = +2

Query  251  IVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRS-------LVlrikkkdkrrilrPYLQH  409
            +VL +DD++ VQD F G +V W + V   G ++         L   ++ +  I+  Y++H
Sbjct  97   LVLSMDDHEEVQDVFEGVKVKWYSSVEKSGTKTKMRERRYFTLSFHRRHRGMIVDRYMEH  156

Query  410  IHTVSDNIEQRRRELKLFMNRSLASDDS--AAGRWRSVPFTHPSTFETVVMESDLKNRVK  583
            +      I  R RE KL+ N S + D S    GRW +VPF HP+TFET+ M+   K  +K
Sbjct  157  VLREGKVIGLRNRERKLYTNNS-SGDWSYYVEGRWGNVPFHHPATFETLAMDPVKKEEIK  215

Query  584  SDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             DL  F K + YY K+G+ W+R +LL+GP
Sbjct  216  KDLIKFSKGKDYYKKVGKPWKRGYLLFGP  244



>gb|EMT28622.1| Putative mitochondrial chaperone bcs1 [Aegilops tauschii]
Length=193

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 5/80 (6%)
 Frame = +2

Query  431  IEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKS  610
            +E  RREL+L+ N       + A RW S  FTH +T + V M+ +LK RV+SDLE+FLK 
Sbjct  1    MELCRRELRLYANTG-----ALAPRWASALFTHLATLDAVAMDPELKTRVRSDLESFLKG  55

Query  611  QQYYHKLGRVWRRSFLLYGP  670
            + YYH LGRVWRRS+LLYGP
Sbjct  56   RAYYHCLGRVWRRSYLLYGP  75



>ref|XP_010265413.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nelumbo nucifera]
Length=521

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 101/191 (53%), Gaps = 19/191 (10%)
 Frame = +2

Query  134  NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVS  313
            N+  N +Y  V +Y++S      +    L  S    S ++   +D NQ +++ F   +V 
Sbjct  60   NSYNNDIYDAVQLYLSS-KCFSSAQVLKLAKSR--NSKNLTFSMDANQKLEETFEDIKVK  116

Query  314  W----MNKVHDGGG-------RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKL  460
            W    + K   G G       R   L   +K K R+   Y+ HI  V++ I+ + RE KL
Sbjct  117  WSFHCVEKKSSGLGYARPHENRYFELSFHRKYKHRVQSSYIPHIMEVAEVIKFKTRERKL  176

Query  461  FMNRSLASDDSAAGR-WRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGR  637
            + NRS   D    GR W SVPF+HPSTF+TV ++  LK  +K DL  F+  +++Y ++GR
Sbjct  177  YTNRSADED----GRLWSSVPFSHPSTFDTVAIDPALKKEIKEDLMKFVNRREFYSRVGR  232

Query  638  VWRRSFLLYGP  670
             W+R +LLYGP
Sbjct  233  AWKRGYLLYGP  243



>gb|KFK33745.1| hypothetical protein AALP_AA5G054400 [Arabis alpina]
Length=512

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 92/178 (52%), Gaps = 14/178 (8%)
 Frame = +2

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM-------NKVHDG  337
            N LSS   +    L  +    S  +VL LDD++ V+D+F G  V W        N+    
Sbjct  75   NYLSSKSTACAKRLKANETKNSKALVLSLDDHEAVEDEFEGVMVKWSSCVSKNENQSSTS  134

Query  338  GG------RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSA  496
            GG      R   L   ++ +  ++  YL+H+      I  R RE KL+ N S        
Sbjct  135  GGKGSQERRYFTLSFHREHREMMIESYLEHVLREGKEIGLRNRERKLYTNNSSQEWYPWR  194

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +G+W +VPF HP+TF+T+ M+ + K  +K DL  F K++ YY K+G+ W+R +LL+GP
Sbjct  195  SGKWSNVPFHHPATFDTLAMDPEKKEGIKKDLIKFSKAKDYYKKVGKAWKRGYLLFGP  252



>emb|CDY63216.1| BnaAnng18700D [Brassica napus]
Length=452

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 86/156 (55%), Gaps = 13/156 (8%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKV-----HDGGGRS-------LVlrikkkdkrr  385
            S  +VL +DD++ V+D+F G +V W + V         GR+         L   ++ +  
Sbjct  47   SKSLVLSMDDHEEVEDEFNGVKVKWYSNVKVTQTQSNYGRTSSDERRFFTLTFHRRHRGM  106

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHPSTFETVVMES  562
            I+  YL H+      I  R RE KL+ N S +      +G+W +VPF HP+TFET+ M+ 
Sbjct  107  IIETYLNHVIDEGKAIGLRNRERKLYTNNSSSEWYPWRSGKWSNVPFHHPATFETLAMDP  166

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + K R+K DL  F K + YY K+G+ W+R +LL+GP
Sbjct  167  EKKERIKKDLIKFSKGKDYYKKVGKPWKRGYLLFGP  202



>ref|XP_002534483.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF27900.1| ATP binding protein, putative [Ricinus communis]
Length=518

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/225 (34%), Positives = 112/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K  +WI +    + +F + +++     N+LY  V +Y   LSS      
Sbjct  25   IFPPELRFASLKLFNWIFNSFSAYCYFDITEID-GVNTNELYNAVQLY---LSSSVSISG  80

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG------------RSLV  355
            + L  + A+ S+ I   L +N  + D F GA V W + V                 R   
Sbjct  81   SRLSLTRALNSSAITFGLTNNDSIFDTFNGATVHWEHVVTQRQSQTFSWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  +L  YL +I   +++I +R ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKSLVLDSYLDYIMDRANDIRRRNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TF+T+ M+   K  +  DL+ F   Q +Y K GR W+R +LLYGP
Sbjct  201  TFDTLAMDPVKKQEILQDLKDFANGQSFYQKTGRAWKRGYLLYGP  245



>ref|XP_010425634.1| PREDICTED: probable mitochondrial chaperone BCS1-B, partial [Camelina 
sativa]
Length=497

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 112/227 (49%), Gaps = 19/227 (8%)
 Frame = +2

Query  20   VRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYV-NSLSSL  196
            VRL+L R    + L KW  + +D   VH  F  P+      E     + F  + N LS+ 
Sbjct  33   VRLYLERYFYKY-LNKW--FGEDMKSVHIIF--PEY---TGEGLTKSRAFDEIRNYLSTR  84

Query  197  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM-------NKVHDGGGRSLV  355
              +    L  + +  S  +VL LDDN+ + D F   +V W        N+     GR L 
Sbjct  85   STATARRLKANESENSKSVVLSLDDNEDIVDVFQDVKVVWSLSLVNKENQSVSKEGRHLT  144

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA--AGRWRSVPFTH  529
            +    + +  I + YL H+      I  + RE KL+ N S ++D S+   GRW +VPF H
Sbjct  145  MSFDNQYRDMITKTYLDHVLREGKEIGLKNRERKLYTNNS-STDFSSWRDGRWSNVPFNH  203

Query  530  PSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            P+TFET+ M+ + K  +K DL  F   + YY K+ + W+R +LL+GP
Sbjct  204  PATFETLAMDHEKKEEIKKDLIKFSNGKDYYRKVAKPWKRGYLLFGP  250



>ref|XP_009111599.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Brassica rapa]
Length=523

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 86/156 (55%), Gaps = 13/156 (8%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKV-----HDGGGRS-------LVlrikkkdkrr  385
            S  +VL +DD++ V+D+F G +V W + V         GR+         L   ++ +  
Sbjct  96   SKSLVLSMDDHEEVEDEFNGVKVKWYSNVKVTQTQSNYGRTSSDERRFFTLTFHRRHRGM  155

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHPSTFETVVMES  562
            I+  YL H+      I  R RE KL+ N S +      +G+W +VPF HP+TFET+ M+ 
Sbjct  156  IIETYLNHVIDEGKAIGLRNRERKLYTNNSSSEWYPWRSGKWSNVPFHHPATFETLAMDP  215

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + K R+K DL  F K + YY K+G+ W+R +LL+GP
Sbjct  216  EKKERIKKDLIKFSKGKDYYKKVGKPWKRGYLLFGP  251



>ref|XP_008437741.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Cucumis melo]
Length=516

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 116/233 (50%), Gaps = 16/233 (7%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V+A ++ +  ++ L F  + W   ++   + H + ++  +++ A E     + F+ + S 
Sbjct  49   VWAMIQQYCPQAVLRFFKKYWRRLMN---YFHPYIQI-SIHEFAGERLKRSEAFIAIESY  104

Query  188  SSLEDSDFTNLVNSAAVK-SNDIVLCLDDNQVVQDQFLGARVSWM-----------NKVH  331
             S   S+    + +   K S ++V  +DD++ V D+F G +V W+           N   
Sbjct  105  LSKNSSNTAKRLKAEIGKDSTNLVFSMDDHEKVTDEFQGVKVWWVLNRTGSSTKPDNSYP  164

Query  332  DGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWR  511
                R   L   KK +  I  PYL+++ +    I  R R+ KLF N S      +   W 
Sbjct  165  SPDKRYYTLTFHKKHRSLITEPYLKYVLSEGKEIRVRNRQRKLFTNGSGGRWSYSHTMWS  224

Query  512  SVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             + F HP+TF+T+ ME++ K  +  DL+TF  S+ +Y ++G+ W+R +LLYGP
Sbjct  225  HIVFEHPATFDTLAMEAEKKQEIMDDLQTFTSSKDFYARIGKAWKRGYLLYGP  277



>gb|KJB23471.1| hypothetical protein B456_004G100300 [Gossypium raimondii]
Length=503

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 109/226 (48%), Gaps = 16/226 (7%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  208
             ++   L F   K+ + I      + +F + +++     N+LY  V +Y++S  S+  S 
Sbjct  24   LIFPPQLRFLCLKFFNRIFHLFSSYCYFDITEID-GVNTNELYNAVQLYLSSFVSINGS-  81

Query  209  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG------------RSL  352
               L  + A+ S+ I   L +N  + D F G  V W + V                 R  
Sbjct  82   --RLSLTRALNSSAITFGLSNNDCIVDTFSGVTVLWEHVVIQRQSQTFSWRPLPEEKRGF  139

Query  353  VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHP  532
             LRIKKK+K  IL  YL +I   S+ I ++ ++  L+ N    S DS    W SVPF HP
Sbjct  140  TLRIKKKNKSLILDSYLDYIMERSNEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHP  199

Query  533  STFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            STF+T+ M    K  +  DLE F   Q +Y K GR W+R +LLYGP
Sbjct  200  STFDTLAMHPQKKQEIMDDLEDFANGQSFYQKTGRAWKRGYLLYGP  245



>ref|XP_006401201.1| hypothetical protein EUTSA_v10013277mg [Eutrema salsugineum]
 gb|ESQ42654.1| hypothetical protein EUTSA_v10013277mg [Eutrema salsugineum]
Length=515

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 113/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K+ + I      + +F + +++     N+LY  V +Y++S  S+  +  
Sbjct  25   IFPPELRFAFLKFFNRIFHLFSTYCYFDITEID-GVNTNELYNAVQLYLSSSVSIAGN--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGRSLV  355
              L  + AV S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRAVNSSSITFGLSNNDSIVDTFNGVTVLWEHVVTQRQTQTFAWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL +I   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKTLILNSYLDYIMERANEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K ++  DL+ F + Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPIKKQQIMDDLKDFAEGQLFYQKTGRAWKRGYLLYGP  245



>ref|NP_200556.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 dbj|BAB08783.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96906.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=520

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 113/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K+ + I      + +F + +++     N+LY  V +Y++S  S+  +  
Sbjct  25   IFPPELRFAFLKFFNRIFHVFSSYCYFDITEID-GVNTNELYNAVQLYLSSSVSIAGN--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGRSLV  355
              L  + AV S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRAVNSSSITFGLSNNDSIVDTFNGVTVLWEHVVTQRQTQTFAWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL +I   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKTLILNSYLDYIMERANEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K ++  DL+ F + Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPRKKQQIMDDLKDFAEGQVFYQKTGRAWKRGYLLYGP  245



>ref|XP_010548314.1| PREDICTED: uncharacterized protein LOC104819774 [Tarenaya hassleriana]
Length=878

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 62/179 (35%), Positives = 99/179 (55%), Gaps = 10/179 (6%)
 Frame = +2

Query  146  NQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM--  319
            NQL+     Y+ +  S   SD   +  S      ++++  D+ Q + D F G  + W+  
Sbjct  571  NQLFEAAETYLRTRMS---SDTKRVRASKTPGQKEVLVSFDEGQEILDYFEGMELRWVEL  627

Query  320  --NKVHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDS  493
               +  D  GR   L  +K  + R+L+ YL  + + S+ I+QR + L+L+ +RSL  +  
Sbjct  628  KTTQARDDDGRHFELTFEKSCRDRVLQVYLPRLISASEEIKQREKTLRLY-SRSLRYN--  684

Query  494  AAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +G W SV   HPSTF+T+ M+SDLK  +  DLE FLK +  Y ++G+ W+R +LLYGP
Sbjct  685  CSGGWGSVYLEHPSTFDTLAMDSDLKKMIIGDLERFLKRKDLYKRVGKAWKRGYLLYGP  743


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = +2

Query  398  YLQHIHTVSDNIEQRRRELKLFMNRSLASDDS---AAGRWRSVPFTHPSTFETVVMESDL  568
            YL H+ + S+ I +  R +KL+     ++DD    A G W  V   HPSTFET+ M+ + 
Sbjct  158  YLDHVVSESEEIRRNLRTVKLYSRDVYSNDDDDNCAGGNWGCVNLEHPSTFETLAMDPEA  217

Query  569  KNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            K ++ +DL+ FL+ +++Y ++G+ W+R +LLYGP
Sbjct  218  KKKIIADLDRFLRRREFYKRVGKAWKRGYLLYGP  251



>gb|KFK29244.1| hypothetical protein AALP_AA7G108000 [Arabis alpina]
Length=435

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 106/216 (49%), Gaps = 29/216 (13%)
 Frame = +2

Query  77   WIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYV-NSLSSLEDSDFTNLVNSAAVKSNDI  253
            W+ + +H++        N+   E       ++ + N LS+   +    L  +       +
Sbjct  7    WVSNSVHIN-------FNEFTGEGLKRSGAYISIRNYLSTKSTACAKTLQANETTNRKAL  59

Query  254  VLCLDDNQVVQDQFLGARVSWMNKV---------HDGGG-----RSLVlrikkkdkrril  391
            VL LDD + V+D+F G +V W + V         H G       R L L I +K +  I 
Sbjct  60   VLSLDDQETVEDEFEGVKVKWSSNVAKSVNQYNHHSGNNNSSERRCLTLSIHEKHREMIT  119

Query  392  rPYLQHIHTVSDNIEQRRRELKLFMNRS--LASDDSAAGR-WRSVPFTHPSTFETVVMES  562
            + YL ++      I    RE KL+ N S  + +D    GR W +VPF HP+TFET+ M+ 
Sbjct  120  KTYLDYVLREGKKIGLENRERKLYTNNSQYVLTD----GRLWSNVPFNHPATFETLAMDP  175

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + K  +K DL  F K + YY+K+G+ W+R +LL+GP
Sbjct  176  EKKEGIKKDLIKFSKGKDYYNKVGKPWKRGYLLFGP  211



>ref|XP_010483268.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Camelina sativa]
 ref|XP_010483269.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X2 
[Camelina sativa]
Length=524

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 113/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K+ + +      + +F + +++     N+LY  V +Y++S  S+  +  
Sbjct  25   IFPPELRFAFLKFFNRVFHLFSSYCYFDITEID-GVNTNELYNAVQLYLSSSVSIAGN--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGRSLV  355
              L  + AV S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRAVNSSSITFGLSNNDSIVDTFNGVTVLWEHVVTQRQTQTFAWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL +I   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKTLILNSYLDYIMERANEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K ++  DL+ F K Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPLKKQQIMDDLKDFAKGQVFYQKTGRAWKRGYLLYGP  245



>ref|XP_010452147.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=526

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 113/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K+ + +      + +F + +++     N+LY  V +Y++S  S+  +  
Sbjct  25   IFPPELRFAFLKFFNRVFHLFSSYCYFDITEID-GVNTNELYNAVQLYLSSSVSIAGN--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGRSLV  355
              L  + AV S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRAVNSSSITFGLSNNDSIVDTFNGVTVLWEHVVTQRQTQTFAWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL +I   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKTLILNSYLDYIMERANEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K ++  DL+ F K Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPLKKQQIMDDLKDFAKGQVFYQKTGRAWKRGYLLYGP  245



>ref|XP_006292204.1| hypothetical protein CARUB_v10018409mg [Capsella rubella]
 gb|EOA25102.1| hypothetical protein CARUB_v10018409mg [Capsella rubella]
Length=479

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 105/216 (49%), Gaps = 25/216 (12%)
 Frame = +2

Query  77   WIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYV-NSLSSLEDSDFTNLVNSAAVKSNDI  253
            W+   +H+       + N+ ++E     + +  + N LS+   +    L  + +  S  +
Sbjct  47   WVSSSVHI-------KFNEYSEEGLEKSEAYDSIHNYLSTKSTALAKRLKANKSRNSRSL  99

Query  254  VLCLDDNQVVQDQFLGARVSWMNKVHDGGG---------------RSLVlrikkkdkrri  388
            VL LDD++ V+D F G +V W + V +                  R + L    + +  I
Sbjct  100  VLSLDDHEEVEDVFEGVKVKWSSSVSENENLNQSSMNRHKVYVERRYMTLSFHSRHREMI  159

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDS--AAGRWRSVPFTHPSTFETVVMES  562
             + YL H+      I  ++RE KL+ N+S     S    G+W +V F HP+TFET+ M+ 
Sbjct  160  TKTYLDHVLREGKEIGLKKRERKLYTNKSSNEWCSWRLGGKWSNVSFDHPATFETLAMDP  219

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + K  +K DL  F K + YY K+G+ W+R +LLYGP
Sbjct  220  EKKEEIKKDLVKFSKGKDYYRKVGKPWKRGYLLYGP  255



>gb|EPS73892.1| hypothetical protein M569_00859, partial [Genlisea aurea]
Length=509

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 102/203 (50%), Gaps = 16/203 (8%)
 Frame = +2

Query  98   VHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQ  277
             H ++ + +++     N+LY  V +Y++S +S+     T L  +  + S+ I   L +N 
Sbjct  47   AHCYYDITEID-GVNTNELYNAVQMYLSSSASIAG---TRLSLTRGLNSSSITFGLSNND  102

Query  278  VVQDQFLGARVSWMNKVHDGGG------------RSLVlrikkkdkrrilrPYLQHIHTV  421
             + D F G  V W + V                 R  +LR++K  +  +L  YL  +   
Sbjct  103  RIVDTFRGITVEWEHIVAQRQSPTFSWRPLPEEKRGFILRVRKIHRHIVLTAYLDFVMET  162

Query  422  SDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETF  601
            ++ + ++ ++  L+ N    S DS    W SVPF HPSTFET+ M+ + K+ + +DL  F
Sbjct  163  ANELRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPSTFETLAMDPEKKSELMADLRDF  222

Query  602  LKSQQYYHKLGRVWRRSFLLYGP  670
               + +Y K GR W+R +LLYGP
Sbjct  223  ANGESFYQKTGRAWKRGYLLYGP  245



>ref|XP_006845620.1| hypothetical protein AMTR_s00019p00215810 [Amborella trichopoda]
 gb|ERN07295.1| hypothetical protein AMTR_s00019p00215810 [Amborella trichopoda]
Length=496

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 98/189 (52%), Gaps = 19/189 (10%)
 Frame = +2

Query  146  NQLYRKVFVYVN-SLSSLED-SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM  319
            N LY  V +Y++ S S+L   +  + L NS+A         L  N +++D F GA   W 
Sbjct  62   NDLYSSVQLYLSRSASTLASRASLSRLSNSSA-----FTFSLSSNHILKDSFNGAIPVWE  116

Query  320  NKVHDGGGRSL------------VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLF  463
            + +     +++            VL++ KKD++ ++  YL H+  V+  I +R R+  L+
Sbjct  117  HIISQRQAQTISWRPMPEEKRMFVLKMHKKDRQVLIPAYLDHVMAVAAEIRRRNRDRLLY  176

Query  464  MNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVW  643
             N    S D     W SVPF HPSTF+T+ M    K  +K DL+ F K + +Y K GR W
Sbjct  177  TNTRGGSMDGRGLPWESVPFKHPSTFDTLAMNPAKKAEIKGDLDDFAKGEDFYKKTGRAW  236

Query  644  RRSFLLYGP  670
            +R +LLYGP
Sbjct  237  KRGYLLYGP  245



>ref|XP_009150457.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brassica 
rapa]
Length=502

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 91/177 (51%), Gaps = 13/177 (7%)
 Frame = +2

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSL--  352
            N LS    S    L  + +  S  IVL +DD++ + D+F G +V W +K H    RS+  
Sbjct  75   NYLSKDSSSRAKKLRANTSKGSKSIVLSMDDHEEITDEFKGVKVWWQSKKHQTDSRSISY  134

Query  353  ----------VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAA  499
                      +L+   +D++ I   YL HI      +E + RE KL+ N    +      
Sbjct  135  FPKTEESRFYILKFHVRDRQVITNRYLDHIRKEGKKMEVKNRERKLYSNNPSQNWSGYNQ  194

Query  500  GRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             +W  V F HP+TF+T+ MES+ K  +K+DL  F  SQ  Y ++G+ W+R +LL+GP
Sbjct  195  TKWSHVTFEHPATFDTLAMESEKKEEIKNDLTKFSNSQDCYKRIGKAWKRGYLLHGP  251



>ref|XP_004296428.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Fragaria 
vesca subsp. vesca]
Length=518

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 111/225 (49%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K +  I      + +F + +++     N+LY  V +Y+++  S+     
Sbjct  25   VFPPELRFAFLKLASKIFHWFSSYYYFDITEID-GVNTNELYNAVQLYLSATVSVTG---  80

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG------------RSLV  355
            T L  + A+ S+ I   L +N  + D F G  V W + V                 R   
Sbjct  81   TRLSLTRALNSSAITFGLSNNDCMVDTFNGVTVLWEHVVTQRQSQTFSWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL  I   +++I +R ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKFLILNSYLDFIMDKANDIRRRNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TF+T+ M+  +K  +  DL+ F   Q +Y K GR W+R +LLYGP
Sbjct  201  TFDTLAMDPKVKKEIMEDLQDFANGQSFYQKTGRAWKRGYLLYGP  245



>ref|XP_011009528.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Populus euphratica]
Length=516

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 76/225 (34%), Positives = 110/225 (49%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            L+   L FA  K  + I +    + +F + +++     N+LY  V +Y++S  S   S  
Sbjct  25   LFPPELRFATLKLFNRIFNMFTSYCYFDITEID-GVNTNELYNAVQLYLSSCVSTSGS--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG------------RSLV  355
              L  + A+ S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRALNSSAITFGLTNNDTLFDTFNGVTVLWEHIVTQRQAQTFSWRPLPDEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL +I   +++I ++  +  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKPLILDSYLDYIMEKANDIRRKNEDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K  +  DL+ F   Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPVKKAEIIEDLKDFANGQSFYQKTGRAWKRGYLLYGP  245



>gb|KJB53790.1| hypothetical protein B456_009G005100 [Gossypium raimondii]
Length=592

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 112/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K S+ + +    + +F + +++     N+LY  V +Y   LSS   ++ 
Sbjct  103  IFPPELRFACLKVSNRVFNLFSSYCYFDITEID-GVNTNELYNAVQLY---LSSSVSTNG  158

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG------------RSLV  355
            + L  + A+ S+ I   L +N  + D F G  V W + V                 R   
Sbjct  159  SRLSLTRALNSSAITFGLSNNDCIIDTFNGVSVVWEHVVTQRQAQTFSWRPLPEEKRGFT  218

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRI+K+DK  IL  YL ++   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  219  LRIRKRDKSLILDSYLDYVMEKANEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  278

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TF+T+ M+   K  +  DL+ F   Q +Y K GR W+R +LLYGP
Sbjct  279  TFDTLAMDPVKKREIMGDLKDFANGQSFYQKTGRAWKRGYLLYGP  323



>ref|XP_006281485.1| hypothetical protein CARUB_v10027577mg [Capsella rubella]
 gb|EOA14383.1| hypothetical protein CARUB_v10027577mg [Capsella rubella]
Length=521

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 113/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K+ + +      + +F + +++     N+LY  V +Y++S  S+  +  
Sbjct  25   IFPPELRFAFLKFFNRVFHLFSSYCYFDITEID-GVNTNELYNAVQLYLSSSVSIAGN--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGRSLV  355
              L  + AV S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRAVNSSSITFGLSNNDSIVDTFNGVTVLWEHVVTQRQTQTFAWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL +I   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKTLILNSYLDYIMERANEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K ++  DL+ F + Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPIKKQQIMDDLKDFAEGQVFYQKTGRAWKRGYLLYGP  245



>ref|XP_003610132.1| Mitochondrial chaperone BCS1 [Medicago truncatula]
 gb|AES92329.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=521

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/234 (32%), Positives = 115/234 (49%), Gaps = 20/234 (9%)
 Frame = +2

Query  11   FAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLS  190
            F  +   ++   L FA  K  + + +    + +F++ +++     N+LY  V +Y++S  
Sbjct  18   FQTILQTVFPPELRFASAKLFNKLFNCFSSYCYFEITEID-GVNTNELYNAVQLYLSSSV  76

Query  191  SLEDS--DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG-------  343
            S+  +    T  VNS+A         L +N  + D F G  V W + V            
Sbjct  77   SITGNRLSLTRAVNSSA-----FTFGLANNDSIIDTFNGVNVVWEHVVTQRNSQTFSWRP  131

Query  344  -----RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRW  508
                 R   LRIKKKDK+ +L  YL +I   + +I ++ ++  L+ N    S DS    W
Sbjct  132  LPDEKRGFTLRIKKKDKQLLLNSYLDYIMEKASDIRRKNQDRLLYTNSRGGSLDSRGHPW  191

Query  509  RSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             SVPF HPSTF+T+ M+   K  +  DL+ F   Q +YHK GR W+R +LLYGP
Sbjct  192  ESVPFKHPSTFDTLAMDPMKKKEIMEDLQDFANGQGFYHKTGRAWKRGYLLYGP  245



>ref|XP_009419133.1| PREDICTED: uncharacterized protein LOC103999190 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 108/213 (51%), Gaps = 24/213 (11%)
 Frame = +2

Query  80   IDDKLHVHQFFKVPQ-LNQNAQE-NQLYRKVFVYVN---------SLSSLEDSDFTNLVN  226
            + D +  + +F VP+ L  +A E N LYR V +Y++         S+S+      +    
Sbjct  36   LQDSITPYSYFDVPEFLGSSAVEPNDLYRHVHLYLHQSLLSSAAVSVSAPPRLTLSLPRG  95

Query  227  SAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-----GGGRSLVlrikkkdkrril  391
            SAA  S    L L  NQ ++D F G R+ W ++           RS  LR+ K+    +L
Sbjct  96   SAAAPS----LSLSPNQSLEDSFAGHRLLWTHQADTLQDSLEERRSFSLRLPKRAAAALL  151

Query  392  rPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLK  571
              YL H+   +D++E+  R  +L+ N       S    W SVPF HP+TF T+ ++  +K
Sbjct  152  GSYLSHLSDKADHLERSSRPRRLYTNSPRGGPPS----WSSVPFRHPATFATLALDPPVK  207

Query  572  NRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              + +DL+ F   +++Y + GR W+R +LL+GP
Sbjct  208  TSLLADLDAFAAGREFYRRTGRAWKRGYLLHGP  240



>emb|CDY04025.1| BnaC02g37400D [Brassica napus]
Length=486

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 85/156 (54%), Gaps = 13/156 (8%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKV-----HDGGGRS-------LVlrikkkdkrr  385
            S  +VL +DD++ V+D F G +V W + V         GR+         L   ++ +  
Sbjct  93   SKSLVLSMDDHEEVEDVFNGVKVKWYSNVKVTQTQSNYGRNNSYERRFFTLTFHRRHRGM  152

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHPSTFETVVMES  562
            I+  Y+ H+      I  R RE KL+ N S +      +G+W +VPF HP+TFET+ M+ 
Sbjct  153  IIDTYITHVLREGKAIGVRNRERKLYTNNSSSEWYPWMSGKWSNVPFHHPATFETLAMDP  212

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + K R+K DL  F K + YY K+G+ W+R +LL+GP
Sbjct  213  EKKERIKKDLVKFSKGKDYYKKVGKAWKRGYLLFGP  248



>ref|XP_009129368.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X2 [Brassica 
rapa]
Length=500

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 85/156 (54%), Gaps = 13/156 (8%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKV-----HDGGGRS-------LVlrikkkdkrr  385
            S  +VL +DD++ V+D F G +V W + V         GR+         L   ++ +  
Sbjct  83   SKSLVLSMDDHEEVEDVFNGVKVKWYSNVKVTETQSNYGRNNSYERRFFTLTFHRRHRGM  142

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHPSTFETVVMES  562
            I+  Y+ H+      I  R RE KL+ N S +      +G+W +VPF HP+TFET+ M+ 
Sbjct  143  IIDTYITHVLREGKAIGVRNRERKLYTNNSSSEWYPWMSGKWSNVPFHHPATFETLAMDP  202

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + K R+K DL  F K + YY K+G+ W+R +LL+GP
Sbjct  203  EKKERIKKDLVKFSKGKDYYKKVGKAWKRGYLLFGP  238



>ref|XP_006381812.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|ERP59609.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=501

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 111/225 (49%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            L+   L FA  K  + + +    + +F + +++     N+LY  V +Y++S  ++  S  
Sbjct  25   LFPPELRFATLKLFNRVFNMFTSYCYFDITEID-GVNTNELYNAVQLYLSSCVTISGS--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG------------RSLV  355
              L  + A+ S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRALNSSAITFGLTNNDTIFDTFNGVTVLWEHIVTQRQAQTFSWRPLPDEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL +I   ++++ ++  +  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKSLILDSYLDYIMEKANDMRRKNEDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K  +  DL+ F   Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPVKKAEIIEDLKDFANGQSFYQKTGRAWKRGYLLYGP  245



>ref|XP_007154771.1| hypothetical protein PHAVU_003G146400g [Phaseolus vulgaris]
 gb|ESW26765.1| hypothetical protein PHAVU_003G146400g [Phaseolus vulgaris]
Length=514

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 76/238 (32%), Positives = 115/238 (48%), Gaps = 19/238 (8%)
 Frame = +2

Query  2    VSVFAAVRLFL---YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFV  172
            + VFA  +  L   +   L FA  K  + I      + ++ + +++     N+LY  V +
Sbjct  12   LGVFAFCQTILQAVFPPELRFASVKLFNRIFHCFSSYCYYDITEID-GVNTNELYNAVQL  70

Query  173  YVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG---  343
            Y++S  S+  +    L  + AV S+     L +N  + D F G  V W + V        
Sbjct  71   YLSSSVSITGN---RLSLTRAVNSSGFTFGLANNDSIVDTFNGVNVLWEHVVTQRQAQTF  127

Query  344  ---------RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA  496
                     R   LRIKKKDK  +L  YL +I   + +I ++ ++  L+ N    S DS 
Sbjct  128  SWRPLPDEKRGFTLRIKKKDKSLVLNSYLDYIMEKASDIRRKNQDRLLYTNSRGGSLDSR  187

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
               W SVPF HPSTF+T+ M+   K  +  DL+ F   Q +YHK GR W+R +LLYGP
Sbjct  188  GHPWESVPFKHPSTFDTLAMDPQKKKEIMEDLQDFANGQSFYHKTGRAWKRGYLLYGP  245



>ref|XP_003549478.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Glycine 
max]
 gb|KHN17592.1| Putative mitochondrial chaperone BCS1-B [Glycine soja]
Length=512

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 115/238 (48%), Gaps = 19/238 (8%)
 Frame = +2

Query  2    VSVFAAVRLFL---YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFV  172
            + VFA  +  L   +   L FA  K    +      + +F + +++     N+LY  V +
Sbjct  12   LGVFAFCQTILQAVFPPELRFASVKLFHRVFHCFSTYCYFDITEID-GVNTNELYNAVQL  70

Query  173  YVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGG---  343
            Y++S  S+  +    L  + AV S+     L +N  + D F G  V W + V        
Sbjct  71   YLSSSVSITGN---RLSLTRAVNSSGFTFGLANNDSIVDTFNGVNVLWEHVVTQRQAQTF  127

Query  344  ---------RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA  496
                     R   LRIKKKDK  IL  YL +I   + +I ++ ++  L+ N    S DS 
Sbjct  128  SWRPLPDEKRGFTLRIKKKDKSFILNSYLDYIMEKASDIRRKNQDRLLYTNSRGGSLDSR  187

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
               W SVPF HPSTF+T+ M+   K ++  DL+ F   Q +YHK GR W+R +LLYGP
Sbjct  188  GHPWESVPFKHPSTFDTLAMDPHKKKQIMEDLQDFANGQSFYHKTGRAWKRGYLLYGP  245



>ref|XP_009129367.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X1 [Brassica 
rapa]
Length=513

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 85/156 (54%), Gaps = 13/156 (8%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKV-----HDGGGRS-------LVlrikkkdkrr  385
            S  +VL +DD++ V+D F G +V W + V         GR+         L   ++ +  
Sbjct  96   SKSLVLSMDDHEEVEDVFNGVKVKWYSNVKVTETQSNYGRNNSYERRFFTLTFHRRHRGM  155

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHPSTFETVVMES  562
            I+  Y+ H+      I  R RE KL+ N S +      +G+W +VPF HP+TFET+ M+ 
Sbjct  156  IIDTYITHVLREGKAIGVRNRERKLYTNNSSSEWYPWMSGKWSNVPFHHPATFETLAMDP  215

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + K R+K DL  F K + YY K+G+ W+R +LL+GP
Sbjct  216  EKKERIKKDLVKFSKGKDYYKKVGKAWKRGYLLFGP  251



>ref|XP_006290910.1| hypothetical protein CARUB_v10017023mg [Capsella rubella]
 gb|EOA23808.1| hypothetical protein CARUB_v10017023mg [Capsella rubella]
Length=519

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 110/213 (52%), Gaps = 23/213 (11%)
 Frame = +2

Query  77   WIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIV  256
            WI   +H+ +F      ++  + +Q Y  +  Y++S S+   +    L  + +  S  +V
Sbjct  47   WISPNVHI-KF--TEYTDEGLKRSQAYNTIRNYLSSKST---ALAKRLKANESKNSKSLV  100

Query  257  LCLDDNQVVQDQFLGARVSWMNKV-----HDGGGRSL-------VlrikkkdkrrilrPY  400
            L +DD+Q ++D+F G +V W + V         GRS+        L   ++ +  ++  Y
Sbjct  101  LSMDDHQEIEDEFEGVKVKWYSNVKVTQTQSNYGRSISDERRYFTLTFHRQHRGMVIETY  160

Query  401  LQHIHTVSDNIEQRRRELKLFMNRSLASDDSAA---GRWRSVPFTHPSTFETVVMESDLK  571
            L H+      I  + RE KL+ N S  S D  +    +W +VPF HP+TFET+ M+   K
Sbjct  161  LDHVLREGKAIGLKNRERKLYTNNS--SQDWYSWRTAKWSNVPFHHPATFETLAMDPLKK  218

Query  572  NRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              +K DL  F K ++YY K+G+ W+R +LL+GP
Sbjct  219  EGIKKDLIKFSKGEEYYRKVGKPWKRGYLLFGP  251



>gb|KFK29246.1| hypothetical protein AALP_AA7G108200 [Arabis alpina]
Length=513

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 92/178 (52%), Gaps = 14/178 (8%)
 Frame = +2

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD--------  334
            N LSS   +    L  +    S  +VL LDD++ V+D+F G  V W + V          
Sbjct  75   NYLSSKSTACAKRLKANETKNSKSLVLSLDDDEAVEDEFEGVMVKWSSSVSKNANQSNTS  134

Query  335  -GGG----RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA-  496
             G G    R L L   ++ +R I+  YL H+      I  R RE KL+ N S     S  
Sbjct  135  RGNGSDERRYLTLSFHREHRRMIIETYLAHVLREGKEIGLRNRERKLYTNNSSQEWYSRR  194

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +G+W +V F HP+TFET+ M+   K  +K DL  F K++ YY K+G+ W+R +LL+GP
Sbjct  195  SGKWSNVLFHHPATFETLAMDPVKKEGIKKDLIKFSKAKDYYKKVGKAWKRGYLLFGP  252



>ref|XP_008362379.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Malus domestica]
Length=526

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 101/202 (50%), Gaps = 16/202 (8%)
 Frame = +2

Query  101  HQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQV  280
            + +F + +++     N+LY  V +Y++S  S+     T L  + A+ S+ I   L +N  
Sbjct  48   YYYFDITEID-GVNTNELYNAVQLYLSSTVSITG---TRLSLTRALNSSAITFGLSNNDC  103

Query  281  VQDQFLGARVSWMNKVHDGGG------------RSLVlrikkkdkrrilrPYLQHIHTVS  424
            + D F G  V W + V                 R   LRIKKKDK  IL  YL +I   +
Sbjct  104  MVDNFNGVTVLWEHVVTQRQNQTFSWRPLPEEKRGFTLRIKKKDKLLILNNYLDYIMEKA  163

Query  425  DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFL  604
            + I ++ ++  L+ N    S DS    W SVPF HPSTFET+ M+   K  +  DL  F 
Sbjct  164  NEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPSTFETLAMDPKTKREIMDDLMDFA  223

Query  605  KSQQYYHKLGRVWRRSFLLYGP  670
              Q +Y K GR W+R +LLYGP
Sbjct  224  NGQNFYQKTGRAWKRGYLLYGP  245



>ref|XP_010528302.1| PREDICTED: mitochondrial chaperone BCS1-like [Tarenaya hassleriana]
Length=523

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 87/157 (55%), Gaps = 16/157 (10%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGG-----GRS------LVlrikkkdkrri  388
            S  +VL LDD++ ++++F G +V W++ V         GRS        L   +  ++ I
Sbjct  94   SKSVVLSLDDHEEIEEEFGGVKVKWISNVRTRDNESRWGRSSDERRFFTLTFHRNHRKMI  153

Query  389  lrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGR---WRSVPFTHPSTFETVVME  559
               Y++H+      IE R RE KLF N S  S D  + R   W +VPF HP+TF+T+ M+
Sbjct  154  TESYIEHVLREGKAIEVRNRERKLFTNNS--SQDWFSWRERKWSNVPFEHPATFDTLAMD  211

Query  560  SDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
               K  +K DL  F + ++YY K+G+ W+R +LL+GP
Sbjct  212  PAKKEEIKKDLIKFSRGKEYYKKVGKPWKRGYLLHGP  248



>ref|XP_006292928.1| hypothetical protein CARUB_v10019198mg [Capsella rubella]
 gb|EOA25826.1| hypothetical protein CARUB_v10019198mg [Capsella rubella]
Length=510

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 83/155 (54%), Gaps = 13/155 (8%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSL------------Vlrikkkdkrr  385
            S  +VL +DD + + D F G RV W +K   G  +S             +LR  ++D+  
Sbjct  95   SKSLVLSMDDKEEITDDFEGVRVWWQSKKEKGTRQSFSFYPEADEKRFYMLRFHRRDREV  154

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESD  565
            I+  YL H+      IE + RE KL+ N    S  +   +W  V F HP+TF+T+ ME  
Sbjct  155  IIDRYLDHVMREGKTIELKNRERKLYSNTPGQSHGNNT-KWSHVSFEHPATFDTLAMEET  213

Query  566  LKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             K  +KSDL  F KS+ YY K+G+ W+R +LL+GP
Sbjct  214  KKEEIKSDLVKFSKSKDYYKKIGKAWKRGYLLFGP  248



>ref|XP_009795973.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Nicotiana sylvestris]
 ref|XP_009795974.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X2 
[Nicotiana sylvestris]
Length=500

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 98/195 (50%), Gaps = 20/195 (10%)
 Frame = +2

Query  134  NAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVS  313
            N + N +Y +V  Y+ + S  +D+ +     S   KS    + LD+ + + DQFLGA++S
Sbjct  59   NGKSNDIYTQVHSYLGTKSINKDAKYLKAEKSKNSKS--FAVSLDEGEEIIDQFLGAKLS  116

Query  314  W------MNKVHDGGG-------RSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRREL  454
            W       N+   G         +S  +   ++ K  ++  YL+H+      IE   R+ 
Sbjct  117  WRSHKETFNENSTGRNNSRPIEKKSYTITFNQRYKEMVIGKYLKHVMEEGKVIEFNNRKQ  176

Query  455  KLFMNRSLASDD---SAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYH  625
            K++ N    S+D      G WR + F HP+TF+T+ M+   K  +  DL  F K + YY 
Sbjct  177  KIYTNN--CSEDWYWYDKGMWRDINFEHPATFDTLAMDPKKKEEIVIDLVAFSKGKDYYS  234

Query  626  KLGRVWRRSFLLYGP  670
            K+G+ W+R +LLYGP
Sbjct  235  KVGKAWKRGYLLYGP  249



>ref|XP_004152449.1| PREDICTED: uncharacterized protein LOC101216763 [Cucumis sativus]
 ref|XP_004157806.1| PREDICTED: uncharacterized LOC101216763 [Cucumis sativus]
 gb|KGN64269.1| hypothetical protein Csa_1G045670 [Cucumis sativus]
Length=521

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/233 (27%), Positives = 115/233 (49%), Gaps = 16/233 (7%)
 Frame = +2

Query  8    VFAAVRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSL  187
            V+A ++ +  ++ L F  + W   ++   + H + ++  +++ A E     + F+ + S 
Sbjct  49   VWAMIQQYCPQAVLRFFKKYWRRLMN---YFHPYIQI-SIHEFAGERLKRSEAFIAIESY  104

Query  188  SSLEDSDFTNLVNSAAVK-SNDIVLCLDDNQVVQDQFLGARVSWM-----------NKVH  331
             S   S+    + +   K S ++V  +DD++ V D+F G +V W+           N   
Sbjct  105  LSKNSSNTAKRLKAEIGKDSTNLVFSMDDHEKVTDEFQGVKVWWVLNRTGSSTNPDNSYP  164

Query  332  DGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWR  511
            +   R   L   K  +  I  PYL+++ +    I  R R+ KL+ N S      +   W 
Sbjct  165  NPDKRYYTLTFHKNHRSLITEPYLKYVLSEGKEIRVRNRQRKLYTNGSGGRWSYSHTMWS  224

Query  512  SVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
             + F HP+TF+T+ ME+  K  +  DL+TF  S+ +Y ++G+ W+R +LLYGP
Sbjct  225  HIVFEHPATFDTIGMEAKKKQEIIDDLQTFTSSKDFYARIGKAWKRGYLLYGP  277



>ref|XP_004173444.1| PREDICTED: uncharacterized protein LOC101232752, partial [Cucumis 
sativus]
Length=311

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 89/178 (50%), Gaps = 17/178 (10%)
 Frame = +2

Query  179  NSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK-----------  325
            N LSS        L   A   S  +VL +DDN+ V D+F G ++ W ++           
Sbjct  77   NYLSSRTSIRAKRLKAEAVKDSKSLVLSMDDNEEVIDEFQGVKIWWTSRKTVPKTKNISY  136

Query  326  -VHDGGGRSLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS--DDSA  496
                   RS  L   ++ +  IL  ++ HI      +E + R+ KL+MN S  +  D S+
Sbjct  137  FPASDERRSYKLTFHRRHRETILDSFINHIMEEGKTVELKNRQRKLYMNNSSTNWWDKSS  196

Query  497  AGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
               WR VPF HP+ F T+ M+   K  + +DL  F K ++YY K+G+ W+R +LLYGP
Sbjct  197  ---WRHVPFEHPANFRTLAMDPKKKQEIVNDLVKFKKGKEYYEKVGKAWKRGYLLYGP  251



>emb|CDX85203.1| BnaC07g25140D [Brassica napus]
Length=523

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 88/158 (56%), Gaps = 16/158 (10%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKVHD-------------GGGRSLVlrikkkdkr  382
            S  +VL +DD++ V+D F G +V W + + +             G  R   L   ++ + 
Sbjct  96   SKALVLSMDDHEEVEDAFDGVKVKWYSSLKEIQTQSSGYGRSSSGERRFFTLTFHRRHRG  155

Query  383  rilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSA--AGRWRSVPFTHPSTFETVVM  556
             I+  Y+ H+      I  R RE KLF N S +S+  A  +G+W +VPF HP+TFET+ M
Sbjct  156  MIIESYITHVLREGREIGLRNRERKLFTNNS-SSEWYAWRSGKWSNVPFHHPATFETLAM  214

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            + + K R+K DL  F K + YY K+G+ W+R +LL+GP
Sbjct  215  DPEKKERIKKDLIKFSKGKDYYKKVGKPWKRGYLLFGP  252



>ref|NP_198817.1| AAA-ATPase 1 [Arabidopsis thaliana]
 dbj|BAB10225.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94501.1| AAA-ATPase 1 [Arabidopsis thaliana]
Length=514

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 96/183 (52%), Gaps = 14/183 (8%)
 Frame = +2

Query  164  VFVYVNSLSSLEDSDFTNLVNSAAVKSN-DIVLCLDDNQVVQDQFLGARVSWMNKVHDGG  340
            V+  + S  S + S     + +  +K N  I+L +DD++ + D+F G +V W +K H   
Sbjct  69   VYDAIQSYLSKDSSSRAKKLTANTIKGNKSIILSMDDHEEITDEFQGVKVWWQSKKHQSE  128

Query  341  GRSL------------VlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS  484
             R++            +L+  ++D+  I + YL H+ +    IE + RE KL+ N    +
Sbjct  129  SRAISFYPKADESRFYMLKFHRRDREVITKKYLNHVISEGKTIEVKNRERKLYSNNPSQN  188

Query  485  -DDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLL  661
                   +W  V F HP+TF+T+ ME   K  +K+DL  F  S+ YY K+G+ W+R +LL
Sbjct  189  WSGYKQTKWSHVTFEHPATFDTLAMEYKKKEEIKNDLIKFSNSKDYYKKIGKAWKRGYLL  248

Query  662  YGP  670
            +GP
Sbjct  249  FGP  251



>ref|XP_010443434.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=519

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 112/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K+ + +      + +F + +++     N+LY  V +Y++S  S+  +  
Sbjct  25   IFPPELRFAFLKFFNRVFHLFSSYCYFDITEID-GVNTNELYNAVQLYLSSSVSIAGN--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGRSLV  355
              L  + AV S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRAVNSSSITFGLSNNDSIVDTFNGVTVLWEHVVTQRQTQTFAWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKKKDK  IL  YL +I   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKKDKTLILNSYLDYIMERANEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K ++  DL+ F   Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPLKKQQIMDDLKDFANGQVFYQKTGRAWKRGYLLYGP  245



>ref|XP_006290856.1| hypothetical protein CARUB_v10016966mg [Capsella rubella]
 gb|EOA23754.1| hypothetical protein CARUB_v10016966mg [Capsella rubella]
Length=544

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 87/156 (56%), Gaps = 13/156 (8%)
 Frame = +2

Query  242  SNDIVLCLDDNQVVQDQFLGARVSWMNKV-----HDGGGRSL-------Vlrikkkdkrr  385
            S  +V  +DD++ ++D+F G +V W + V         GRS+        L   ++ +  
Sbjct  96   SKSLVFSMDDHEEIEDEFEGVKVKWYSNVKVSQPQHSYGRSISDERRYFTLTFHRRHRGM  155

Query  386  ilrPYLQHIHTVSDNIEQRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHPSTFETVVMES  562
            I+  YL H+     +I  ++RE KL+ N S       +AG+W +VPF HP+TFET+ M+ 
Sbjct  156  IIETYLDHVLREGKDIGLKKRERKLYTNNSSREWYPWSAGKWSNVPFHHPATFETLAMDP  215

Query  563  DLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
              K  +K DL  F K + YY+K+G+ W+R +LL+GP
Sbjct  216  VKKEGIKKDLIKFSKGKDYYNKVGKPWKRGYLLFGP  251



>emb|CDY68365.1| BnaCnng58650D [Brassica napus]
Length=512

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 112/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA  K+ + I      + +F + +++     N+LY  V +Y++S  S+  +  
Sbjct  25   IFPPELRFAFLKFFNRIFHLFSSYCYFDITEID-GVNTNELYNAVQLYLSSYVSIAGN--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGRSLV  355
              L  + AV S+ I   L +N  + D F    V W + V                 R   
Sbjct  82   -RLSLTRAVNSSSITFGLSNNDSIVDTFNNVTVLWEHVVTQRQTQTFAWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRIKK+DK  IL  YL +I   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIKKRDKALILSSYLDYIMERANEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TFET+ M+   K ++  DL+ F + Q +Y K GR W+R +LLYGP
Sbjct  201  TFETLAMDPVKKQQIMDDLKDFAEGQMFYQKTGRAWKRGYLLYGP  245



>ref|XP_007222808.1| hypothetical protein PRUPE_ppa004191mg [Prunus persica]
 gb|EMJ24007.1| hypothetical protein PRUPE_ppa004191mg [Prunus persica]
Length=524

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 103/202 (51%), Gaps = 16/202 (8%)
 Frame = +2

Query  101  HQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQV  280
            + +F + +++     N+LY  V +Y++S  S+  S    L  + A+ S+ I   L +N  
Sbjct  48   YYYFDITEID-GVNTNELYNAVQLYLSSTVSISGS---RLSLTRALNSSAITFGLSNNDC  103

Query  281  VQDQFLGARVSWMNKVHDGGG------------RSLVlrikkkdkrrilrPYLQHIHTVS  424
            + D F G  V W + V                 R   LRIKKKDK  IL  YL  I   +
Sbjct  104  MVDAFNGVTVLWEHVVTQRQSQTFSWRPLPEEKRGFTLRIKKKDKYLILNSYLDFIMDKA  163

Query  425  DNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFL  604
            + I ++ ++  L+ N    S DS    W SVPF HPSTF+T+ M+  +K  + +DL+ F 
Sbjct  164  NEIRRKNQDRLLYTNSRGGSLDSRGHPWESVPFKHPSTFDTLAMDPKVKKEIMNDLKDFA  223

Query  605  KSQQYYHKLGRVWRRSFLLYGP  670
              Q +Y K GR W+R +LLYGP
Sbjct  224  NGQAFYQKTGRAWKRGYLLYGP  245



>ref|XP_010435957.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Camelina 
sativa]
Length=513

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 102/199 (51%), Gaps = 16/199 (8%)
 Frame = +2

Query  122  QLNQNAQENQLYRKVFVY--VNSLSSLEDSDFTNLVNSAAVKSND-IVLCLDDNQVVQDQ  292
            Q+  +    Q +++  VY  + S  S + S     + +  VK N+ IVL +DD++ + D+
Sbjct  54   QITFHEYSGQRFKRSDVYDAIQSYLSKDSSSRAKKLTANRVKGNNSIVLSMDDHEEITDE  113

Query  293  FLGARVSWMNKVHDGGGRSL------------VlrikkkdkrrilrPYLQHIHTVSDNIE  436
            F G +V W  K H    RS+            +L+  + D++ I   YL H+ +    +E
Sbjct  114  FEGVKVWWQAKKHQSESRSISFYPKAEESRFYMLKFHRCDRQVITERYLDHVMSEGKIVE  173

Query  437  QRRRELKLFMNRSLAS-DDSAAGRWRSVPFTHPSTFETVVMESDLKNRVKSDLETFLKSQ  613
             + RE KL+ N    +       +W  V F HP+TF+T+ ME   K  +K+DL  F  S+
Sbjct  174  VKNRERKLYSNNPSENWSGYKETKWSHVTFEHPATFDTLAMEDKKKEEIKNDLIKFSNSK  233

Query  614  QYYHKLGRVWRRSFLLYGP  670
             YY K+G+ W+R +LL+GP
Sbjct  234  DYYKKIGKAWKRGYLLFGP  252



>ref|XP_010514563.1| PREDICTED: mitochondrial chaperone BCS1-like [Camelina sativa]
Length=512

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 85/164 (52%), Gaps = 13/164 (8%)
 Frame = +2

Query  215  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSL------------Vl  358
             L  S    S  +VL +DD + + D F G RV W +K      +S             +L
Sbjct  86   KLKASTTKGSKSLVLSMDDKEEITDDFEGVRVWWQSKKEGASRQSFSFYPEADEKRFYML  145

Query  359  rikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPST  538
            R  ++D+  I++ YL H+      IE + RE KL+ N    S  +   +W  V F HP+T
Sbjct  146  RFHRRDREVIIKKYLDHVMREGKTIELKNRERKLYSNTPGQSHGNNT-KWSHVTFEHPAT  204

Query  539  FETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            F+T+ ME   K  +KSDL  F KS+ YY K+G+ W+R +LL+GP
Sbjct  205  FDTLAMEETKKEEIKSDLVKFSKSKDYYKKIGKAWKRGYLLFGP  248



>ref|XP_010536912.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Tarenaya 
hassleriana]
Length=511

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 113/225 (50%), Gaps = 16/225 (7%)
 Frame = +2

Query  32   LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  211
            ++   L FA+ K+ + +      + +F + +++     N+LY  V +Y++S  S+  +  
Sbjct  25   IFPPELRFAVLKFFNRVFHLFSSYCYFDITEID-GVNTNELYNAVQLYLSSSVSITGN--  81

Query  212  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGRSLV  355
              L  + AV S+ I   L +N  + D F G  V W + V                 R   
Sbjct  82   -RLSLTRAVNSSSITFGLSNNDSIVDTFNGVTVLWEHVVTQRQTQTFAWRPLPEEKRGFT  140

Query  356  lrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPS  535
            LRI+KKDK  IL  YL +I   ++ I ++ ++  L+ N    S DS    W SVPF HPS
Sbjct  141  LRIQKKDKTLILNSYLDYIMEKANEIRRKNQDRLLYTNSRGGSLDSRGYPWESVPFKHPS  200

Query  536  TFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            TF+T+ M+   K ++  DL  F + Q +Y K GR W+R +LLYGP
Sbjct  201  TFDTLAMDPVKKQQIMEDLRDFAEGQSFYQKTGRAWKRGYLLYGP  245



>ref|XP_010425637.1| PREDICTED: mitochondrial chaperone BCS1-like [Camelina sativa]
Length=512

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 85/163 (52%), Gaps = 13/163 (8%)
 Frame = +2

Query  218  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSL------------Vlr  361
            L  S    S  +VL +DD + + D F G RV W +K      +S             +LR
Sbjct  87   LKASTTKGSKSLVLSMDDKEEITDDFEGVRVWWQSKKEGASRQSFSFYPEADEKRFYMLR  146

Query  362  ikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTF  541
              ++D+  I++ YL H+      IE + RE KL+ N    S  +   +W  V F HP+TF
Sbjct  147  FHRRDREVIIKKYLDHVMREGKTIELKNRERKLYSNTPGQSHGNNT-KWSHVTFEHPATF  205

Query  542  ETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            +T+ ME   K  +KSDL  F KS+ YY K+G+ W+R +LL+GP
Sbjct  206  DTLAMEETKKEEIKSDLVKFSKSKDYYKKIGKAWKRGYLLFGP  248



>gb|KJB40801.1| hypothetical protein B456_007G078300 [Gossypium raimondii]
Length=468

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 84/158 (53%), Gaps = 21/158 (13%)
 Frame = +2

Query  236  VKSN-DIVLCLDDNQVVQDQFLGARVSWMNKVHDGGGRSLVlrikkkdkr----------  382
            VK+N  +VL +DD++ V D+F G ++ W +  H G  +S        +KR          
Sbjct  87   VKNNRSLVLSMDDHEEVADEFQGVKLWWASGKHVGKTQSFAFYPVTDEKRFYKLTFHKKH  146

Query  383  --rilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFTHPSTFETVVM  556
               I+ PYL+H+      I+ R R+ KL+ N            W  V F HP+TF+T+ M
Sbjct  147  RDLIIGPYLKHVLKEGKAIKVRNRQRKLYTNN--------GPNWSHVVFEHPATFQTLAM  198

Query  557  ESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            E D K  +  DL TF +++++Y ++GR W+R +LLYGP
Sbjct  199  EQDKKEEIMEDLVTFSQAEEFYSRIGRAWKRGYLLYGP  236



>ref|XP_010048623.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW80940.1| hypothetical protein EUGRSUZ_C02301 [Eucalyptus grandis]
Length=518

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 114/228 (50%), Gaps = 20/228 (9%)
 Frame = +2

Query  29   FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS-  205
             ++   L FA  K+ + + +    + ++ + +++     N+LY  V +Y++S  S   S 
Sbjct  24   MVFPPELRFASLKFLNRLFNCFSFYCYYDITEID-GVNTNELYNAVQLYLSSFVSASGSR  82

Query  206  -DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNKVHD------------GGGR  346
               T  +NS+A         L +N  + D F G  V W + V                 R
Sbjct  83   LSLTRAINSSAT-----TFGLSNNDCINDVFDGVAVQWEHVVTQRQSQTYSWPPLPDEKR  137

Query  347  SLVlrikkkdkrrilrPYLQHIHTVSDNIEQRRRELKLFMNRSLASDDSAAGRWRSVPFT  526
              +LRI+K+DK  IL  YL +I   +++I ++ +E  L+ N    S DS    W SVPF 
Sbjct  138  GFMLRIRKRDKDIILDFYLNYIMEKANDIRRKNQERLLYTNSRGGSLDSRRHPWESVPFK  197

Query  527  HPSTFETVVMESDLKNRVKSDLETFLKSQQYYHKLGRVWRRSFLLYGP  670
            HPSTF+T+ M+ + K+ ++ DL  F   Q +Y + GR W+R +LLYGP
Sbjct  198  HPSTFDTLAMDPERKSNIEEDLRDFAAGQAFYQRTGRAWKRGYLLYGP  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420