BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040J07

Length=662
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006348346.1|  PREDICTED: fatty-acid-binding protein 3-like       220   3e-67   Solanum tuberosum [potatoes]
emb|CDP06071.1|  unnamed protein product                                219   9e-67   Coffea canephora [robusta coffee]
ref|XP_004244307.1|  PREDICTED: fatty-acid-binding protein 3            213   1e-64   Solanum lycopersicum
ref|XP_008226205.1|  PREDICTED: fatty-acid-binding protein 3            208   1e-62   Prunus mume [ume]
ref|XP_011098156.1|  PREDICTED: fatty-acid-binding protein 3            207   2e-62   Sesamum indicum [beniseed]
ref|XP_009769181.1|  PREDICTED: fatty-acid-binding protein 3            205   2e-61   Nicotiana sylvestris
ref|XP_009339359.1|  PREDICTED: fatty-acid-binding protein 3-like...    204   3e-61   
ref|XP_009625508.1|  PREDICTED: fatty-acid-binding protein 3            204   5e-61   Nicotiana tomentosiformis
ref|XP_011009097.1|  PREDICTED: fatty-acid-binding protein 3            203   1e-60   Populus euphratica
ref|XP_007212009.1|  hypothetical protein PRUPE_ppa011189mg             200   3e-60   
ref|XP_004146009.1|  PREDICTED: chalcone--flavonone isomerase 2-like    200   1e-59   Cucumis sativus [cucumbers]
gb|KJB82093.1|  hypothetical protein B456_013G176000                    200   2e-59   Gossypium raimondii
ref|XP_008452432.1|  PREDICTED: fatty-acid-binding protein 3 isof...    201   2e-59   
ref|XP_006377696.1|  hypothetical protein POPTR_0011s10330g             199   2e-59   
ref|XP_007022087.1|  Chalcone-flavanone isomerase family protein ...    194   4e-58   
gb|KJB82094.1|  hypothetical protein B456_013G176000                    196   4e-58   Gossypium raimondii
ref|XP_008346589.1|  PREDICTED: LOW QUALITY PROTEIN: fatty-acid-b...    194   1e-57   
ref|XP_006477800.1|  PREDICTED: fatty-acid-binding protein 3-like...    195   1e-57   Citrus sinensis [apfelsine]
gb|KDO52113.1|  hypothetical protein CISIN_1g023649mg                   195   1e-57   Citrus sinensis [apfelsine]
ref|XP_006442319.1|  hypothetical protein CICLE_v10021578mg             195   1e-57   Citrus clementina [clementine]
ref|NP_001238390.1|  chalcone isomerase 3-like                          195   2e-57   Glycine max [soybeans]
gb|ACU19407.1|  unknown                                                 194   2e-57   Glycine max [soybeans]
gb|EYU26287.1|  hypothetical protein MIMGU_mgv1a0115041mg               190   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_006593488.1|  PREDICTED: chalcone isomerase 3-like isoform X1    194   4e-57   Glycine max [soybeans]
ref|XP_002283758.2|  PREDICTED: fatty-acid-binding protein 3            193   7e-57   Vitis vinifera
ref|XP_010694734.1|  PREDICTED: fatty-acid-binding protein 3 isof...    193   9e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU26288.1|  hypothetical protein MIMGU_mgv1a0115041mg               191   9e-57   Erythranthe guttata [common monkey flower]
gb|KJB82095.1|  hypothetical protein B456_013G176000                    191   5e-56   Gossypium raimondii
gb|KEH38484.1|  chalcone-flavanone isomerase family protein             191   7e-56   Medicago truncatula
ref|XP_009339358.1|  PREDICTED: fatty-acid-binding protein 3-like...    190   9e-56   
gb|AFK39093.1|  unknown                                                 190   1e-55   Medicago truncatula
ref|XP_008452433.1|  PREDICTED: fatty-acid-binding protein 3 isof...    191   2e-55   
emb|CDY24090.1|  BnaA06g00880D                                          190   2e-55   Brassica napus [oilseed rape]
ref|XP_010479918.1|  PREDICTED: fatty-acid-binding protein 3-like...    189   6e-55   Camelina sativa [gold-of-pleasure]
emb|CAN75399.1|  hypothetical protein VITISV_004495                     187   6e-55   Vitis vinifera
ref|XP_010462251.1|  PREDICTED: fatty-acid-binding protein 3-like       188   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_007022085.1|  Chalcone-flavanone isomerase family protein ...    188   7e-55   
ref|XP_009147594.1|  PREDICTED: fatty-acid-binding protein 3            187   1e-54   Brassica rapa
ref|XP_010501004.1|  PREDICTED: fatty-acid-binding protein 3-like       188   1e-54   Camelina sativa [gold-of-pleasure]
emb|CDY45118.1|  BnaC06g06390D                                          187   1e-54   Brassica napus [oilseed rape]
ref|XP_010535016.1|  PREDICTED: fatty-acid-binding protein 3            187   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010479919.1|  PREDICTED: fatty-acid-binding protein 3-like...    187   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008366525.1|  PREDICTED: fatty-acid-binding protein 3-like       185   4e-54   
ref|XP_008363648.1|  PREDICTED: fatty-acid-binding protein 3-like       186   4e-54   
ref|XP_003546743.1|  PREDICTED: fatty-acid-binding protein 3-like       186   4e-54   
ref|XP_004294183.1|  PREDICTED: fatty-acid-binding protein 3            186   4e-54   Fragaria vesca subsp. vesca
ref|XP_009344622.1|  PREDICTED: fatty-acid-binding protein 3-like       186   5e-54   Pyrus x bretschneideri [bai li]
ref|XP_002894446.1|  hypothetical protein ARALYDRAFT_474480             186   5e-54   
gb|KFK35722.1|  hypothetical protein AALP_AA4G028300                    185   9e-54   Arabis alpina [alpine rockcress]
pdb|4DOL|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Fa...    183   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KCW67632.1|  hypothetical protein EUGRSUZ_F01378                     184   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010060770.1|  PREDICTED: fatty-acid-binding protein 3 isof...    185   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010241349.1|  PREDICTED: fatty-acid-binding protein 3            184   2e-53   Nelumbo nucifera [Indian lotus]
gb|AAM61303.1|  chalcone isomerase, putative                            184   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488681.1|  PREDICTED: chalcone--flavonone isomerase-like      184   2e-53   Cicer arietinum [garbanzo]
gb|AAF78437.1|AC018748_16  Contains a weak similarity to chalcone...    184   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175757.1|  fatty-acid-binding protein 3                          183   6e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007149369.1|  hypothetical protein PHAVU_005G0645000g            182   1e-52   Phaseolus vulgaris [French bean]
ref|XP_008368445.1|  PREDICTED: fatty-acid-binding protein 3            182   2e-52   
gb|KDP39780.1|  hypothetical protein JCGZ_04939                         181   2e-52   Jatropha curcas
ref|XP_006305475.1|  hypothetical protein CARUB_v10009906mg             181   7e-52   Capsella rubella
ref|XP_008784378.1|  PREDICTED: fatty-acid-binding protein 3 isof...    179   9e-52   Phoenix dactylifera
ref|XP_006392782.1|  hypothetical protein EUTSA_v10011696mg             179   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_010060771.1|  PREDICTED: fatty-acid-binding protein 3 isof...    177   8e-51   Eucalyptus grandis [rose gum]
ref|XP_007149370.1|  hypothetical protein PHAVU_005G064600g             173   5e-49   Phaseolus vulgaris [French bean]
ref|XP_008784382.1|  PREDICTED: fatty-acid-binding protein 3 isof...    171   5e-49   
ref|XP_009413396.1|  PREDICTED: fatty-acid-binding protein 3            172   8e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006370052.1|  hypothetical protein POPTR_0001s38970g             169   9e-49   
ref|XP_010106740.1|  Chalcone--flavonone isomerase                      171   4e-48   Morus notabilis
ref|XP_010916104.1|  PREDICTED: fatty-acid-binding protein 3 isof...    167   3e-47   Elaeis guineensis
ref|XP_007149371.1|  hypothetical protein PHAVU_005G064600g             154   3e-42   Phaseolus vulgaris [French bean]
gb|ADE76284.1|  unknown                                                 148   2e-39   Picea sitchensis
ref|XP_008386421.1|  PREDICTED: fatty-acid-binding protein 3-like       139   1e-37   
gb|AFQ92050.1|  chalcone isomerase                                      135   2e-36   Pyrus pyrifolia [sha li]
gb|KCW67630.1|  hypothetical protein EUGRSUZ_F01378                     139   3e-36   Eucalyptus grandis [rose gum]
ref|XP_010694735.1|  PREDICTED: fatty-acid-binding protein 3 isof...    134   3e-35   
ref|XP_008784381.1|  PREDICTED: fatty-acid-binding protein 3 isof...    126   9e-32   
ref|XP_010916109.1|  PREDICTED: fatty-acid-binding protein 3 isof...    125   3e-31   
ref|XP_001764300.1|  predicted protein                                  119   5e-29   
ref|NP_001046684.1|  Os02g0320300                                       116   1e-27   
ref|XP_010234161.1|  PREDICTED: fatty-acid-binding protein 3            116   2e-27   Brachypodium distachyon [annual false brome]
gb|EEE56854.1|  hypothetical protein OsJ_06472                          108   1e-24   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85871.1|  predicted protein                                      107   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002451868.1|  hypothetical protein SORBIDRAFT_04g008910          108   3e-24   Sorghum bicolor [broomcorn]
emb|CDP12481.1|  unnamed protein product                                103   1e-23   Coffea canephora [robusta coffee]
gb|EMT25778.1|  Chalcone--flavonone isomerase 1B-1                      105   2e-23   
gb|EMS65822.1|  Chalcone--flavonone isomerase 1B-1                      103   3e-23   Triticum urartu
gb|AFW71098.1|  hypothetical protein ZEAMMB73_950090                    100   7e-22   
gb|AFW71097.1|  hypothetical protein ZEAMMB73_950090                  98.2    3e-21   
ref|XP_007022086.1|  Chalcone-flavanone isomerase family protein ...  83.6    6e-16   
ref|XP_006665045.1|  PREDICTED: fatty-acid-binding protein 3-like     81.6    3e-15   Oryza brachyantha
gb|AIE16842.1|  chalcone isomerase                                    79.0    3e-15   Glycine max [soybeans]
gb|AIE16850.1|  chalcone isomerase                                    79.0    3e-15   Glycine soja [wild soybean]
gb|AIE16846.1|  chalcone isomerase                                    78.6    5e-15   Glycine max [soybeans]
gb|AIE16847.1|  chalcone isomerase                                    76.6    3e-14   Glycine soja [wild soybean]
ref|XP_002504118.1|  predicted protein                                77.8    7e-14   Micromonas commoda
ref|XP_010481171.1|  PREDICTED: fatty-acid-binding protein 3-like     73.2    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_003059642.1|  predicted protein                                71.2    1e-11   Micromonas pusilla CCMP1545
emb|CBJ30273.1|  Chalcone Isomerase                                   70.9    1e-11   Ectocarpus siliculosus
ref|XP_011084819.1|  PREDICTED: probable chalcone--flavonone isom...  69.7    3e-11   Sesamum indicum [beniseed]
ref|XP_005855968.1|  hypothetical protein NGA_0361402                 68.2    7e-11   Nannochloropsis gaditana CCMP526
gb|EWM23313.1|  Chalcone isomerase, subgroup                          68.2    1e-10   Nannochloropsis gaditana
gb|KEH35546.1|  chalcone-flavanone isomerase family protein           66.6    2e-10   Medicago truncatula
ref|NP_001151850.1|  LOC100285485                                     67.4    3e-10   Zea mays [maize]
gb|KGN50734.1|  hypothetical protein Csa_5G221960                     67.0    3e-10   Cucumis sativus [cucumbers]
ref|XP_004171055.1|  PREDICTED: chalcone--flavonone isomerase-like    66.2    4e-10   
gb|AFK36813.1|  unknown                                               66.2    4e-10   Medicago truncatula
dbj|BAJ10401.1|  enhancer of flavonoid production                     66.2    4e-10   Torenia hybrid cultivar
ref|XP_004146474.1|  PREDICTED: chalcone--flavonone isomerase-like    66.6    7e-10   
ref|XP_004502829.1|  PREDICTED: chalcone--flavonone isomerase-like    65.1    1e-09   Cicer arietinum [garbanzo]
ref|XP_002503292.1|  predicted protein                                65.9    1e-09   Micromonas commoda
gb|KEH35544.1|  chalcone-flavanone isomerase family protein           65.1    1e-09   Medicago truncatula
gb|ACU16129.1|  unknown                                               64.7    1e-09   Glycine max [soybeans]
gb|AHA61355.1|  chalcone isomerase                                    64.7    1e-09   Phyllanthus emblica [amla]
ref|XP_008456952.1|  PREDICTED: probable chalcone--flavonone isom...  65.1    2e-09   Cucumis melo [Oriental melon]
ref|XP_007509430.1|  predicted protein                                65.1    2e-09   Bathycoccus prasinos
emb|CCM80406.1|  chalcone isomerase 2                                 64.3    2e-09   Lupinus angustifolius
ref|NP_001236782.1|  chalcone isomerase 4-like                        63.9    3e-09   Glycine max [soybeans]
gb|AFK33841.1|  unknown                                               63.9    3e-09   Medicago truncatula
gb|AHY20030.1|  chalcone isomerase                                    63.5    3e-09   Tulipa fosteriana
ref|XP_010253088.1|  PREDICTED: probable chalcone--flavonone isom...  63.5    4e-09   Nelumbo nucifera [Indian lotus]
gb|AHL83555.1|  chalcone isomerase type 4                             63.2    5e-09   Iris x hollandica [Dutch iris]
gb|AGE10598.1|  chalcone isomerase                                    63.2    5e-09   Lonicera japonica [Japanese honeysuckle]
emb|CDP13908.1|  unnamed protein product                              63.5    5e-09   Coffea canephora [robusta coffee]
dbj|BAJ10402.1|  enhancer of flavonoid production                     62.8    7e-09   Torenia hybrid cultivar
gb|AFK43525.1|  unknown                                               62.8    7e-09   Lotus japonicus
gb|AIU39024.1|  chalcone isomerase 2                                  62.8    8e-09   Narcissus tazetta subsp. chinensis
ref|XP_009627241.1|  PREDICTED: probable chalcone--flavonone isom...  62.8    8e-09   Nicotiana tomentosiformis
gb|KHN25809.1|  Chalcone--flavonone isomerase                         63.2    8e-09   Glycine soja [wild soybean]
emb|CCM80407.1|  chalcone isomerase 1                                 62.4    9e-09   Lupinus angustifolius
gb|AGV53050.1|  chalcone isomerase                                    62.4    1e-08   Actinidia chinensis
gb|AHL83557.1|  chalcone isomerase type 4                             62.4    1e-08   Iris x hollandica [Dutch iris]
gb|AIY53017.1|  chalcone isomerase                                    62.0    1e-08   Actinidia chrysantha
ref|XP_008792229.1|  PREDICTED: probable chalcone--flavonone isom...  62.0    1e-08   
ref|XP_011084820.1|  PREDICTED: probable chalcone--flavonone isom...  62.0    2e-08   Sesamum indicum [beniseed]
ref|XP_005837532.1|  hypothetical protein GUITHDRAFT_151184           61.6    2e-08   Guillardia theta CCMP2712
gb|EYU35208.1|  hypothetical protein MIMGU_mgv1a024098mg              63.5    2e-08   Erythranthe guttata [common monkey flower]
gb|AHZ08832.1|  CHI-ACAD                                              61.6    2e-08   Allium cepa
gb|AIS35913.1|  chalcone isomerase                                    61.6    2e-08   Phalaenopsis equestris
ref|XP_010922741.1|  PREDICTED: probable chalcone--flavonone isom...  61.2    2e-08   Elaeis guineensis
ref|XP_009363797.1|  PREDICTED: probable chalcone--flavonone isom...  61.2    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_009384767.1|  PREDICTED: probable chalcone--flavonone isom...  61.2    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384766.1|  PREDICTED: probable chalcone--flavonone isom...  61.2    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009349075.1|  PREDICTED: probable chalcone--flavonone isom...  61.6    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_009349076.1|  PREDICTED: probable chalcone--flavonone isom...  61.6    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_006435919.1|  hypothetical protein CICLE_v10032749mg           60.8    3e-08   Citrus clementina [clementine]
ref|XP_009804396.1|  PREDICTED: probable chalcone--flavonone isom...  60.8    3e-08   Nicotiana sylvestris
dbj|BAJ10400.1|  enhancer of flavonoid production                     60.8    3e-08   Petunia x hybrida [garden petunia]
ref|XP_010321455.1|  PREDICTED: probable chalcone--flavonone isom...  60.8    3e-08   Solanum lycopersicum
ref|XP_010931364.1|  PREDICTED: probable chalcone--flavonone isom...  60.8    3e-08   Elaeis guineensis
gb|AAT94363.1|  chalcone isomerase 4B                                 59.7    4e-08   Glycine max [soybeans]
dbj|BAO58581.1|  chalcone-flavanone isomerase family protein          60.5    4e-08   Ipomoea nil [qian niu]
dbj|BAO58577.1|  chalcone-flavanone isomerase family protein          60.8    4e-08   Ipomoea nil [qian niu]
dbj|BAO32071.1|  chalcone isomerase Type4                             60.8    4e-08   Antirrhinum majus [garden snapdragon]
gb|ACM62743.1|  chalcone isomerase                                    60.5    5e-08   Garcinia mangostana [mangosteen]
ref|XP_001420321.1|  predicted protein                                61.6    6e-08   Ostreococcus lucimarinus CCE9901
emb|CEF99654.1|  Chalcone isomerase                                   60.8    6e-08   Ostreococcus tauri
ref|XP_001700277.1|  predicted protein                                60.8    6e-08   Chlamydomonas reinhardtii
gb|ACN40662.1|  unknown                                               60.1    6e-08   Picea sitchensis
ref|XP_008369367.1|  PREDICTED: probable chalcone--flavonone isom...  60.1    7e-08   Malus domestica [apple tree]
gb|KDP21650.1|  hypothetical protein JCGZ_03321                       60.1    7e-08   Jatropha curcas
gb|ABK23299.1|  unknown                                               60.1    7e-08   Picea sitchensis
ref|XP_002520870.1|  Chalcone--flavonone isomerase, putative          59.7    8e-08   
ref|XP_006577878.1|  PREDICTED: chalcone isomerase 4B isoform X1      59.7    9e-08   
ref|XP_006365329.1|  PREDICTED: probable chalcone--flavonone isom...  59.7    9e-08   Solanum tuberosum [potatoes]
ref|XP_008366803.1|  PREDICTED: probable chalcone--flavonone isom...  59.7    1e-07   Malus domestica [apple tree]
ref|XP_007218407.1|  hypothetical protein PRUPE_ppa011476mg           59.7    1e-07   Prunus persica
ref|XP_010103648.1|  Chalcone--flavonone isomerase                    59.7    1e-07   
ref|XP_007137637.1|  hypothetical protein PHAVU_009G143100g           59.3    1e-07   Phaseolus vulgaris [French bean]
gb|AHC07954.1|  CHI                                                   59.3    1e-07   Indosasa hispida
ref|NP_001242041.1|  chalcone isomerase 4B                            59.3    2e-07   
emb|CBI25366.3|  unnamed protein product                              58.9    2e-07   Vitis vinifera
ref|XP_006371287.1|  hypothetical protein POPTR_0019s08610g           57.8    2e-07   
ref|XP_002280158.1|  PREDICTED: probable chalcone--flavonone isom...  58.5    2e-07   Vitis vinifera
emb|CAN70349.1|  hypothetical protein VITISV_012581                   58.5    2e-07   Vitis vinifera
ref|XP_006435917.1|  hypothetical protein CICLE_v10032749mg           58.2    2e-07   
gb|KCW65781.1|  hypothetical protein EUGRSUZ_G03138                   57.8    3e-07   Eucalyptus grandis [rose gum]
gb|AFQ92051.1|  chalcone isomerase                                    58.5    3e-07   Pyrus pyrifolia [sha li]
gb|AIC33515.1|  CHI                                                   58.2    3e-07   Lycium chinense [Chinese boxthorn]
ref|XP_008233882.1|  PREDICTED: probable chalcone--flavonone isom...  58.2    3e-07   Prunus mume [ume]
ref|XP_011001399.1|  PREDICTED: probable chalcone--flavonone isom...  58.2    4e-07   Populus euphratica
gb|ADG27840.1|  chalcone isomerase                                    58.2    4e-07   Gossypium hirsutum [American cotton]
gb|EEC73031.1|  hypothetical protein OsI_06969                        56.2    4e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_006663745.1|  PREDICTED: probable chalcone--flavonone isom...  58.2    4e-07   Oryza brachyantha
gb|KJB74930.1|  hypothetical protein B456_012G014600                  57.8    5e-07   Gossypium raimondii
gb|KJB74932.1|  hypothetical protein B456_012G014600                  57.8    5e-07   Gossypium raimondii
ref|XP_010252061.1|  PREDICTED: probable chalcone--flavonone isom...  57.8    5e-07   Nelumbo nucifera [Indian lotus]
ref|XP_005854048.1|  chalcone isomerase-like protein                  58.2    5e-07   Nannochloropsis gaditana CCMP526
ref|XP_002325926.1|  hypothetical protein POPTR_0019s08610g           57.8    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006842472.1|  hypothetical protein AMTR_s00077p00075600        57.8    6e-07   
ref|XP_006662673.1|  PREDICTED: probable chalcone--flavonone isom...  57.8    6e-07   Oryza brachyantha
ref|XP_006662674.1|  PREDICTED: probable chalcone--flavonone isom...  57.4    7e-07   Oryza brachyantha
ref|NP_001065587.1|  Os11g0116300                                     57.4    7e-07   
ref|XP_010067614.1|  PREDICTED: probable chalcone--flavonone isom...  57.4    7e-07   Eucalyptus grandis [rose gum]
ref|XP_003082012.1|  mRNA splicing factor ATP-dependent RNA helic...  59.3    7e-07   
gb|AGQ53961.1|  chalcone isomerase                                    55.5    7e-07   Dendrobium hybrid cultivar
gb|KCW65779.1|  hypothetical protein EUGRSUZ_G03138                   57.0    8e-07   Eucalyptus grandis [rose gum]
gb|EEC67544.1|  hypothetical protein OsI_34872                        57.4    8e-07   Oryza sativa Indica Group [Indian rice]
gb|AGY46120.1|  chalcone isomerase 1                                  57.0    8e-07   Dendrobium hybrid cultivar
gb|EEE51527.1|  hypothetical protein OsJ_32725                        57.4    8e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977383.1|  PREDICTED: probable chalcone--flavonone isom...  57.4    8e-07   
gb|KEH35545.1|  chalcone-flavanone isomerase family protein           56.6    9e-07   Medicago truncatula
gb|AGY46121.1|  chalcone isomerase 2                                  57.0    1e-06   Dendrobium hybrid cultivar
ref|XP_007011312.1|  Chalcone-flavanone isomerase family protein      57.4    1e-06   
gb|EAY82043.1|  hypothetical protein OsI_37230                        56.2    2e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001065990.1|  Os12g0115700                                     56.2    2e-06   
ref|XP_004307734.1|  PREDICTED: probable chalcone--flavonone isom...  56.2    2e-06   Fragaria vesca subsp. vesca
gb|EAZ19439.1|  hypothetical protein OsJ_35000                        56.2    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002528487.1|  conserved hypothetical protein                   54.7    2e-06   
gb|AIC73814.1|  chalcone isomerase                                    55.5    3e-06   Hibiscus cannabinus [bimli-jute]
ref|XP_008809461.1|  PREDICTED: probable chalcone--flavonone isom...  55.1    3e-06   Phoenix dactylifera
gb|EWM21716.1|  chalcone isomerase-like protein                       56.6    4e-06   Nannochloropsis gaditana
ref|XP_003058444.1|  predicted protein                                54.7    4e-06   Micromonas pusilla CCMP1545
ref|XP_005845734.1|  hypothetical protein CHLNCDRAFT_136326           55.5    4e-06   Chlorella variabilis
pdb|4DOK|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Ch...  54.7    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568154.1|  Chalcone-flavanone isomerase family protein         54.7    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871147.1|  chalcone-flavanone isomerase family protein      54.7    7e-06   Arabidopsis lyrata subsp. lyrata
dbj|BAB09970.1|  unnamed protein product                              54.7    7e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AEO17326.1|  chalcone isomerase                                    54.7    7e-06   Arachis hypogaea [goober]
ref|XP_004497328.1|  PREDICTED: chalcone--flavonone isomerase 2-like  54.3    1e-05   Cicer arietinum [garbanzo]
ref|XP_006398990.1|  hypothetical protein EUTSA_v10014675mg           53.9    1e-05   Eutrema salsugineum [saltwater cress]
ref|XP_006398989.1|  hypothetical protein EUTSA_v10014675mg           53.9    1e-05   Eutrema salsugineum [saltwater cress]
gb|ABS58500.1|  chalcone isomerase                                    53.9    1e-05   Oncidium hybrid cultivar
ref|XP_005644192.1|  chalcone isomerase                               54.3    2e-05   Coccomyxa subellipsoidea C-169
dbj|BAH89258.1|  putative chalcone isomerase fragment                 51.2    2e-05   Diospyros kaki [Japanese persimmon]
ref|XP_004978529.1|  PREDICTED: probable chalcone--flavonone isom...  53.1    2e-05   
ref|XP_001769093.1|  predicted protein                                53.1    3e-05   
ref|XP_010670602.1|  PREDICTED: probable chalcone--flavonone isom...  52.8    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010238805.1|  PREDICTED: probable chalcone--flavonone isom...  52.4    5e-05   Brachypodium distachyon [annual false brome]
ref|XP_009122136.1|  PREDICTED: probable chalcone--flavonone isom...  52.4    5e-05   Brassica rapa
emb|CDX70163.1|  BnaA10g25120D                                        52.4    5e-05   
ref|XP_010543680.1|  PREDICTED: probable chalcone--flavonone isom...  51.6    1e-04   Tarenaya hassleriana [spider flower]
dbj|BAJ95751.1|  predicted protein                                    51.2    1e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001773128.1|  predicted protein                                51.2    1e-04   
emb|CDX98830.1|  BnaC09g50050D                                        50.8    2e-04   
ref|XP_005845646.1|  hypothetical protein CHLNCDRAFT_136673           51.6    2e-04   Chlorella variabilis
ref|XP_006288659.1|  hypothetical protein CARUB_v10001966mg           50.1    3e-04   Capsella rubella
emb|CBJ33403.1|  Similar to Chalcone Isomerase                        49.7    5e-04   Ectocarpus siliculosus
gb|ACN60401.1|  chalcone isomerase                                    49.7    5e-04   Capsicum annuum
sp|Q3Y4F4.1|CFI_CANGE  RecName: Full=Chalcone--flavonone isomeras...  49.7    5e-04   Canna x generalis
gb|ACP30360.1|  chalcone isomerase protein                            49.3    7e-04   Malus hybrid cultivar
ref|XP_002993360.1|  hypothetical protein SELMODRAFT_136990           48.5    7e-04   
gb|AAZ80911.1|  chalcone isomerase                                    49.3    7e-04   Canna x generalis
ref|XP_011027080.1|  PREDICTED: chalcone--flavonone isomerase-like    49.3    7e-04   Populus euphratica



>ref|XP_006348346.1| PREDICTED: fatty-acid-binding protein 3-like [Solanum tuberosum]
Length=274

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 146/191 (76%), Gaps = 11/191 (6%)
 Frame = +2

Query  89   MAAVGSMPSSLWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLGSLDA  268
            MAA G++  S+WIS S PTK  IT+ N KPR S PL  + +     STF  +   G  + 
Sbjct  1    MAAAGAI--SVWISTSTPTK--ITAFNTKPRISYPLKLSRNGIYPLSTFEKN---GQHEQ  53

Query  269  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  448
                 F+ +AA+SSSVG+AEY EEP T VKFQRSLSLPGC TSLSLLGTGYREK+FAIIG
Sbjct  54   N----FTIKAAASSSVGSAEYTEEPATKVKFQRSLSLPGCSTSLSLLGTGYREKIFAIIG  109

Query  449  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  628
            VKVYAAGLYVN+S+ ++LDAWRGRSAA++Q D  LF  IF+A LEKSL IVLVRD+DGKT
Sbjct  110  VKVYAAGLYVNDSVFSRLDAWRGRSAADIQQDPSLFNNIFEANLEKSLLIVLVRDIDGKT  169

Query  629  FWDALDEAISP  661
            FWDALDEAISP
Sbjct  170  FWDALDEAISP  180



>emb|CDP06071.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 137/191 (72%), Gaps = 4/191 (2%)
 Frame = +2

Query  89   MAAVGSMPSSLWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLGSLDA  268
            MAAV ++  +LW    A  K   T C V PR    L + + +  + S F +H S+     
Sbjct  1    MAAVAAIAPNLWRLSPAKIKCDSTPC-VNPRTESALKRENHH--LLSRFCTHLSIQK-HG  56

Query  269  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  448
                 FS +AASSSSV + EY EEP T VKFQ SLS+PGC TS+ L GTGYREKVFA+IG
Sbjct  57   SFHSYFSLKAASSSSVESTEYTEEPATKVKFQTSLSIPGCSTSMPLTGTGYREKVFAVIG  116

Query  449  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  628
            VKVYAAGLYVN+SI  +L+AW+G+SAA+LQ DS  F+TIF+APLEKSL IVLVRDVDGKT
Sbjct  117  VKVYAAGLYVNQSIFARLEAWKGQSAADLQQDSEFFDTIFQAPLEKSLQIVLVRDVDGKT  176

Query  629  FWDALDEAISP  661
            FWDALDEAISP
Sbjct  177  FWDALDEAISP  187



>ref|XP_004244307.1| PREDICTED: fatty-acid-binding protein 3 [Solanum lycopersicum]
Length=274

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 143/191 (75%), Gaps = 11/191 (6%)
 Frame = +2

Query  89   MAAVGSMPSSLWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLGSLDA  268
            MAA G++  S+WIS S PTK  IT+ N  PR   PL  + +     STF  +   G  + 
Sbjct  1    MAAAGAI--SVWISTSTPTK--ITAFNSIPRICYPLKLSRNGIYPLSTFERN---GQYEQ  53

Query  269  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  448
             L    + +AA+SSSVG+AEY EEP T VKFQRSLSLPGC TSLSLLGTGYREK+FAIIG
Sbjct  54   NL----TIKAAASSSVGSAEYTEEPATKVKFQRSLSLPGCSTSLSLLGTGYREKIFAIIG  109

Query  449  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  628
            VKVYAAGLYVN+S+ + LDAWRGRSAA++Q D  LF  IF+A LEKSL IVLVRDVDGKT
Sbjct  110  VKVYAAGLYVNDSVFSSLDAWRGRSAADIQQDPSLFNKIFEADLEKSLLIVLVRDVDGKT  169

Query  629  FWDALDEAISP  661
            FWDALDEAISP
Sbjct  170  FWDALDEAISP  180



>ref|XP_008226205.1| PREDICTED: fatty-acid-binding protein 3 [Prunus mume]
Length=280

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  299  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  478
            ASSSSVG+AEY+EEP T V+FQ SLSLPGC  SLSLLGTGYREKVFAIIGVKVYAAGLYV
Sbjct  66   ASSSSVGSAEYIEEPATKVRFQTSLSLPGCSISLSLLGTGYREKVFAIIGVKVYAAGLYV  125

Query  479  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            N+SILN L+AW+GRSAAE+Q DS LF TIF++PLEKSL IVLVRDVDGKTFWDAL++AIS
Sbjct  126  NQSILNSLNAWKGRSAAEIQEDSSLFSTIFQSPLEKSLQIVLVRDVDGKTFWDALNDAIS  185

Query  659  P  661
            P
Sbjct  186  P  186



>ref|XP_011098156.1| PREDICTED: fatty-acid-binding protein 3 [Sesamum indicum]
Length=289

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  STFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSL  406
            STFP +  +   +A L G  SP+AASSSSV ++EY EEP T VKFQ SLSLPGC +SLSL
Sbjct  52   STFPPNLCIKRRNAGLEGRLSPKAASSSSVVSSEYTEEPETKVKFQTSLSLPGC-SSLSL  110

Query  407  LGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEK  586
            LGTGYREKVFAIIGVKVYAAGLY N+S+ +KLDAW+GRS+ ELQ DS +F+ IF+APLEK
Sbjct  111  LGTGYREKVFAIIGVKVYAAGLYTNQSVFSKLDAWKGRSSVELQQDSSIFDAIFQAPLEK  170

Query  587  SLSIVLVRDVDGKTFWDALDEAISP  661
            SL I+LVRDVDGKTFWDALDEAISP
Sbjct  171  SLHIILVRDVDGKTFWDALDEAISP  195



>ref|XP_009769181.1| PREDICTED: fatty-acid-binding protein 3 [Nicotiana sylvestris]
 ref|XP_009769182.1| PREDICTED: fatty-acid-binding protein 3 [Nicotiana sylvestris]
Length=282

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 140/203 (69%), Gaps = 27/203 (13%)
 Frame = +2

Query  89   MAAVGSMPSSLWISVSAPTKSKITSCNVKPRFSLPL------------SKTHSYFTIFST  232
            MAA  S+P  +WIS S  T +KI + N KPR S PL            +K+HS + +   
Sbjct  1    MAAAISLP--IWISKS--TSTKINAYNAKPRISYPLKTPRNAVGPILFNKSHSLYPL---  53

Query  233  FPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLG  412
                 S+     R    F+P+AASSSS       EEP T VKFQRSLSLPGC TSLSLLG
Sbjct  54   -----SIFERSGRHEHHFTPKAASSSS---VGSAEEPATKVKFQRSLSLPGCSTSLSLLG  105

Query  413  TGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSL  592
            TGYREKVFAIIGVKVYAAGLYVN+S+ ++LDAWRG SAA +Q D+ LF  IF+A LEKSL
Sbjct  106  TGYREKVFAIIGVKVYAAGLYVNDSVFSRLDAWRGHSAAAIQQDTSLFNMIFEANLEKSL  165

Query  593  SIVLVRDVDGKTFWDALDEAISP  661
             IVLVRD+DGKTFWDALDEAISP
Sbjct  166  RIVLVRDIDGKTFWDALDEAISP  188



>ref|XP_009339359.1| PREDICTED: fatty-acid-binding protein 3-like isoform X2 [Pyrus 
x bretschneideri]
Length=278

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 133/185 (72%), Gaps = 17/185 (9%)
 Frame = +2

Query  122  WISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFST---FPSHFSLGSLDARLPGLFSP  292
            W+    PT + I     KPR  LP   ++    I  T   FP H ++ S         +P
Sbjct  12   WLQFPTPTGNSIP----KPRIGLPTGISNPNVLICQTPIHFPPHKNIKSQ--------TP  59

Query  293  RA--ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAA  466
             A  ASS+SVG+AEY+EEP T  KFQ SLSLPGC +SL+LLGTGYREKVFAIIGVKVYAA
Sbjct  60   FAVNASSASVGSAEYIEEPATKEKFQTSLSLPGCSSSLTLLGTGYREKVFAIIGVKVYAA  119

Query  467  GLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALD  646
            GLYVN+S+L  L+AW+GRSAAE+Q DS LF +IF +PLEKSL IVLVRDVDGKTFWDAL+
Sbjct  120  GLYVNQSVLYSLNAWKGRSAAEIQEDSSLFNSIFLSPLEKSLQIVLVRDVDGKTFWDALN  179

Query  647  EAISP  661
            +AISP
Sbjct  180  DAISP  184



>ref|XP_009625508.1| PREDICTED: fatty-acid-binding protein 3 [Nicotiana tomentosiformis]
 ref|XP_009625509.1| PREDICTED: fatty-acid-binding protein 3 [Nicotiana tomentosiformis]
Length=285

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 144/204 (71%), Gaps = 26/204 (13%)
 Frame = +2

Query  89   MAAVGSMPSSLWISVSAPTKSKITSC-NVKPRFSLPL------------SKTHSYFTIFS  229
            M A G++   +WIS S  T +KIT+  NVKPR S PL            +K+HS + + S
Sbjct  1    MVAAGAISLPIWISTS--TSTKITAYYNVKPRISYPLKTPRNAVGPILFNKSHSLYPL-S  57

Query  230  TFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLL  409
            TF         + R    F+P+A SSSS    E  EEP T VKFQRSLSLPGC TSLSLL
Sbjct  58   TFER-------NERHEHHFTPKAVSSSS---VESAEEPATKVKFQRSLSLPGCSTSLSLL  107

Query  410  GTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKS  589
            GTGYREKVFAIIGVKVYAAGLY+N+S+ ++LD WRGRSAAE+Q D+ LF  IF+A LEKS
Sbjct  108  GTGYREKVFAIIGVKVYAAGLYINDSVFSRLDTWRGRSAAEIQQDTSLFNMIFEANLEKS  167

Query  590  LSIVLVRDVDGKTFWDALDEAISP  661
            L IVLVRD+DGKTFWDALDEAISP
Sbjct  168  LRIVLVRDIDGKTFWDALDEAISP  191



>ref|XP_011009097.1| PREDICTED: fatty-acid-binding protein 3 [Populus euphratica]
 ref|XP_011009098.1| PREDICTED: fatty-acid-binding protein 3 [Populus euphratica]
 ref|XP_011009099.1| PREDICTED: fatty-acid-binding protein 3 [Populus euphratica]
 ref|XP_011009100.1| PREDICTED: fatty-acid-binding protein 3 [Populus euphratica]
Length=279

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 125/160 (78%), Gaps = 2/160 (1%)
 Frame = +2

Query  185  SLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSS-VGNAEYVEEPTTNVKF  361
            SLP  KTHS F+  STFP H +  S    L    +  ++SSS  VG+AEY EE  T  KF
Sbjct  27   SLPFYKTHSDFSPLSTFP-HLNNNSTPTHLSFKAASSSSSSSFSVGSAEYTEETATKEKF  85

Query  362  QRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQN  541
            QRSLSLPGC TSLSLLGTGYREKVFAIIGVKVYAAGLYVN SIL+ L  W+G+SA+E+Q 
Sbjct  86   QRSLSLPGCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNPSILSTLSTWKGQSASEIQE  145

Query  542  DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            +S LF +IF+APLEKSL IVLVRD+DGKTFWDALD+AISP
Sbjct  146  NSALFSSIFQAPLEKSLQIVLVRDIDGKTFWDALDDAISP  185



>ref|XP_007212009.1| hypothetical protein PRUPE_ppa011189mg [Prunus persica]
 gb|EMJ13208.1| hypothetical protein PRUPE_ppa011189mg [Prunus persica]
Length=220

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  308  SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNES  487
            ++VG+AEY+EEP T V+FQ SLSLPGC  SLSLLGTGYREKVFAIIGVKVYAAGLYVN+S
Sbjct  9    TTVGSAEYIEEPATKVRFQTSLSLPGCSISLSLLGTGYREKVFAIIGVKVYAAGLYVNQS  68

Query  488  ILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            ILN L+AW+GRSAAE+Q DS LF TIF++PLEKSL IVLVRDV+GKTFWDAL++AISP
Sbjct  69   ILNSLNAWKGRSAAEIQEDSSLFSTIFQSPLEKSLQIVLVRDVEGKTFWDALNDAISP  126



>ref|XP_004146009.1| PREDICTED: chalcone--flavonone isomerase 2-like [Cucumis sativus]
 ref|XP_004168303.1| PREDICTED: chalcone--flavonone isomerase 2-like [Cucumis sativus]
 gb|KGN55017.1| hypothetical protein Csa_4G622760 [Cucumis sativus]
Length=278

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 139/196 (71%), Gaps = 23/196 (12%)
 Frame = +2

Query  95   AVGSMPSSLWISV------SAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLG  256
            AV S P SL +S+      S+PT   +T    KP  S+P    HS           FSL 
Sbjct  5    AVNSTPLSLPLSIPTGKLNSSPTICLLT----KP--SIPTLSIHS----------TFSLS  48

Query  257  SLDARLPGLFSPRAASS-SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKV  433
            + + R    FS R +SS +SVGNA +VEEP+TNVKF  SL+LPGC TSLSLLGTGYREKV
Sbjct  49   NNNFRFYSNFSLRPSSSLASVGNAGFVEEPSTNVKFPTSLTLPGCSTSLSLLGTGYREKV  108

Query  434  FAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRD  613
            FAIIGVKVYAAGLY+N S+ N+L+AWRGRSAA +Q DS LF+ IF++  EKSL IVLVRD
Sbjct  109  FAIIGVKVYAAGLYINSSVSNELNAWRGRSAAAIQEDSSLFDIIFQSRSEKSLQIVLVRD  168

Query  614  VDGKTFWDALDEAISP  661
            VDGKTFWDALD+AISP
Sbjct  169  VDGKTFWDALDDAISP  184



>gb|KJB82093.1| hypothetical protein B456_013G176000 [Gossypium raimondii]
Length=278

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +2

Query  305  SSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNE  484
            +SSVG A+Y EEP T VKF+ SLS+P C TSLSLLGTGYREKVFAIIGVKVYAAGLYVN 
Sbjct  66   ASSVGTADYTEEPATKVKFRTSLSVPDCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNP  125

Query  485  SILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            SIL+KLDAW+GRSAA++Q+D PLF++ F+ P+EKSL IVLVRDVDGKTFWDALDEAISP
Sbjct  126  SILSKLDAWKGRSAAQIQDDMPLFKSFFEDPMEKSLQIVLVRDVDGKTFWDALDEAISP  184



>ref|XP_008452432.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Cucumis melo]
Length=316

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 140/198 (71%), Gaps = 21/198 (11%)
 Frame = +2

Query  89   MAAVGSMPSSLWISVSAPT---KSKITSCNV-KPRFSLPLSKTHSYFTI---FSTFPSHF  247
            MAA    P+ L + +S PT    S  T C + KP  S+P    HS F++   F  F S+F
Sbjct  39   MAANVVNPTPLSLPLSVPTGKLNSNPTICLLTKP--SIPTLSIHSTFSLNNNFFRFSSNF  96

Query  248  SLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYRE  427
            SL              ++S +SVGNA +VEEP+TNVKF  SL+LPGC TSLSLLGTGYRE
Sbjct  97   SLKP------------SSSLASVGNAGFVEEPSTNVKFPTSLTLPGCSTSLSLLGTGYRE  144

Query  428  KVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLV  607
            KVFAIIGVKVYAAGLY+N S+ N+L+AWRGRSAA +Q DS LF+ IF++  EKSL IVLV
Sbjct  145  KVFAIIGVKVYAAGLYINSSVSNELNAWRGRSAAAIQEDSSLFDIIFQSCSEKSLQIVLV  204

Query  608  RDVDGKTFWDALDEAISP  661
            RDVDGKTFWDALD+AISP
Sbjct  205  RDVDGKTFWDALDDAISP  222



>ref|XP_006377696.1| hypothetical protein POPTR_0011s10330g [Populus trichocarpa]
 gb|ERP55493.1| hypothetical protein POPTR_0011s10330g [Populus trichocarpa]
Length=282

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 125/163 (77%), Gaps = 5/163 (3%)
 Frame = +2

Query  185  SLPLSKTHSYFTIFSTFPSHFSLGS----LDARLPGLFSPRAASSSSVGNAEYVEEPTTN  352
            SLP  KTHS F+  ST P H +  S    L  +     S  ++SS SVG+AEY EE  T 
Sbjct  27   SLPFYKTHSDFSPLSTIP-HLNNNSTPTHLSFKASSSSSSSSSSSFSVGSAEYTEETATK  85

Query  353  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAE  532
             KFQRSLSLPGC TSLSLLGTGYREKVFAIIGVKVYAAGLYVN SIL+ L  W+G+SA+E
Sbjct  86   EKFQRSLSLPGCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNPSILSTLSTWKGQSASE  145

Query  533  LQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            +Q +S LF +IF+APLEKSL IVLVRD+DGKTFWDALD+AISP
Sbjct  146  IQENSALFSSIFQAPLEKSLQIVLVRDIDGKTFWDALDDAISP  188



>ref|XP_007022087.1| Chalcone-flavanone isomerase family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY13612.1| Chalcone-flavanone isomerase family protein isoform 3, partial 
[Theobroma cacao]
Length=210

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  314  VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESIL  493
            VG A+Y EEP T VKFQ SLSLPGC +SLSLLGTGYREKVFAIIGVKVYAAGLYVN+SIL
Sbjct  1    VGAADYTEEPATKVKFQTSLSLPGCSSSLSLLGTGYREKVFAIIGVKVYAAGLYVNQSIL  60

Query  494  NKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            +KLDAW+G  A+++Q+D  LF++IF+ PLEKSL IVLVRDVDGKTFWDALDEAISP
Sbjct  61   SKLDAWKGWLASQIQDDLSLFKSIFEVPLEKSLQIVLVRDVDGKTFWDALDEAISP  116



>gb|KJB82094.1| hypothetical protein B456_013G176000 [Gossypium raimondii]
Length=277

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  308  SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNES  487
            +S G A+Y EEP T VKF+ SLS+P C TSLSLLGTGYREKVFAIIGVKVYAAGLYVN S
Sbjct  66   ASSGTADYTEEPATKVKFRTSLSVPDCSTSLSLLGTGYREKVFAIIGVKVYAAGLYVNPS  125

Query  488  ILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            IL+KLDAW+GRSAA++Q+D PLF++ F+ P+EKSL IVLVRDVDGKTFWDALDEAISP
Sbjct  126  ILSKLDAWKGRSAAQIQDDMPLFKSFFEDPMEKSLQIVLVRDVDGKTFWDALDEAISP  183



>ref|XP_008346589.1| PREDICTED: LOW QUALITY PROTEIN: fatty-acid-binding protein 3-like, 
partial [Malus domestica]
Length=234

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 119/144 (83%), Gaps = 6/144 (4%)
 Frame = +2

Query  233  FPSHFSLGSLDARLPGLFSPRAASSSS-VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLL  409
            FP H ++ S   + P  F+  A+S+S+ VGNAE +EEP T  KFQ SLSLPGC +SL+LL
Sbjct  2    FPPHKNIKS---QTP--FAVNASSTSAAVGNAEXIEEPATKEKFQTSLSLPGCSSSLTLL  56

Query  410  GTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKS  589
            GTGYREKVFAIIGV+VYAAGLYVN+S+LN L+AW+GRSAAE+Q DS LF +IF +P EKS
Sbjct  57   GTGYREKVFAIIGVEVYAAGLYVNQSVLNSLNAWKGRSAAEIQEDSSLFNSIFLSPSEKS  116

Query  590  LSIVLVRDVDGKTFWDALDEAISP  661
            + IVLVRDVDGKTFWDAL++AISP
Sbjct  117  IQIVLVRDVDGKTFWDALNDAISP  140



>ref|XP_006477800.1| PREDICTED: fatty-acid-binding protein 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477801.1| PREDICTED: fatty-acid-binding protein 3-like isoform X2 [Citrus 
sinensis]
Length=279

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  269  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  448
            R+   F+ +A+SSSSVG+AEY EEP T VKFQ+SLSLPG  + LSLLGTGYREKVFAIIG
Sbjct  55   RIQPHFTVKASSSSSVGSAEYTEEPATKVKFQKSLSLPGYSSPLSLLGTGYREKVFAIIG  114

Query  449  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  628
            VKVYAAGLY+N+SIL+KL+AW+G+ AA +Q DS LF+TI++AP EKSL IVLVRDVDGKT
Sbjct  115  VKVYAAGLYINQSILSKLNAWKGKGAANIQEDSSLFDTIYQAPSEKSLKIVLVRDVDGKT  174

Query  629  FWDALDEAISP  661
            FWDALD+AISP
Sbjct  175  FWDALDDAISP  185



>gb|KDO52113.1| hypothetical protein CISIN_1g023649mg [Citrus sinensis]
Length=279

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  269  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  448
            R+   F+ +A+SSSSVG+AEY EEP T VKFQ+SLSLPG  + LSLLGTGYREKVFAIIG
Sbjct  55   RIQPHFTVKASSSSSVGSAEYTEEPATKVKFQKSLSLPGYSSPLSLLGTGYREKVFAIIG  114

Query  449  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  628
            VKVYAAGLY+N+SIL+KL+AW+G+ AA +Q DS LF+TI++AP EKSL IVLVRDVDGKT
Sbjct  115  VKVYAAGLYINQSILSKLNAWKGKGAANIQEDSSLFDTIYQAPSEKSLKIVLVRDVDGKT  174

Query  629  FWDALDEAISP  661
            FWDALD+AISP
Sbjct  175  FWDALDDAISP  185



>ref|XP_006442319.1| hypothetical protein CICLE_v10021578mg [Citrus clementina]
 gb|ESR55559.1| hypothetical protein CICLE_v10021578mg [Citrus clementina]
Length=279

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  269  RLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  448
            R+   F+ +A+SSSSVG+AEY EEP T VKFQ+SLSLPG  + LSLLGTGYREKVFAIIG
Sbjct  55   RIQPHFTVKASSSSSVGSAEYTEEPVTKVKFQKSLSLPGYSSPLSLLGTGYREKVFAIIG  114

Query  449  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  628
            VKVYAAGLY+N+SIL+KL+AW+G+ AA +Q DS LF+TI++AP EKSL IVLVRDVDGKT
Sbjct  115  VKVYAAGLYINQSILSKLNAWKGKGAANIQEDSSLFDTIYQAPSEKSLKIVLVRDVDGKT  174

Query  629  FWDALDEAISP  661
            FWDALD+AISP
Sbjct  175  FWDALDDAISP  185



>ref|NP_001238390.1| chalcone isomerase 3-like [Glycine max]
 gb|AAT94361.1| putative chalcone isomerase 3 [Glycine max]
 gb|KHN47453.1| Chalcone--flavonone isomerase 2 [Glycine soja]
Length=281

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 121/159 (76%), Gaps = 3/159 (2%)
 Frame = +2

Query  185  SLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQ  364
            +L L+  HS F + S  P HFS      R P  F  +AA+SS+V NAEYVEEP TNVKFQ
Sbjct  32   TLALNNGHS-FLLLSAKPMHFSSHKSSRRQPH-FLAQAAASSAV-NAEYVEEPATNVKFQ  88

Query  365  RSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQND  544
             SLS PGC  SL+L GTGYREKVFAIIGVKVYAAGLY+++SI  +L+AW+G+S   +Q +
Sbjct  89   TSLSFPGCSNSLTLFGTGYREKVFAIIGVKVYAAGLYLDQSIALELNAWKGQSKEAIQGN  148

Query  545  SPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            S LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISP
Sbjct  149  SSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISP  187



>gb|ACU19407.1| unknown [Glycine max]
Length=281

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 121/159 (76%), Gaps = 3/159 (2%)
 Frame = +2

Query  185  SLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQ  364
            +L L+  HS F + S  P HFS      R P  F  +AA+SS+V NAEYVEEP TNVKFQ
Sbjct  32   TLALNNGHS-FLLLSAKPMHFSSHKSSRRQPH-FLAQAAASSAV-NAEYVEEPATNVKFQ  88

Query  365  RSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQND  544
             SLS PGC  SL+L GTGYREKVFAIIGVKVYAAGLY+++SI  +L+AW+G+S   +Q +
Sbjct  89   TSLSFPGCSNSLTLFGTGYREKVFAIIGVKVYAAGLYLDQSIALELNAWKGQSKEAIQGN  148

Query  545  SPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            S LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISP
Sbjct  149  SSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISP  187



>gb|EYU26287.1| hypothetical protein MIMGU_mgv1a0115041mg, partial [Erythranthe 
guttata]
Length=161

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  320  NAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK  499
            N+++ EEP T VKFQ SLSLPGC ++LSLLGTGYREKVFAIIGVKVYAAGLY N+S+  K
Sbjct  2    NSDFAEEPATKVKFQTSLSLPGCSSTLSLLGTGYREKVFAIIGVKVYAAGLYANQSVFTK  61

Query  500  LDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            LDAW G S+AELQ DS LF+ IF+AP+EKSL+IVLVRD+DGKTFWDALDEA+SP
Sbjct  62   LDAWSGLSSAELQKDSSLFDAIFQAPVEKSLNIVLVRDIDGKTFWDALDEAVSP  115



>ref|XP_006593488.1| PREDICTED: chalcone isomerase 3-like isoform X1 [Glycine max]
Length=280

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 117/159 (74%), Gaps = 4/159 (3%)
 Frame = +2

Query  185  SLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQ  364
            +L L+  HS F + S  P HFS      R P   +  AASS    NAEYVEEP TNVKFQ
Sbjct  32   TLALNNGHS-FLLLSAKPMHFSSHKSSRRQPHFLAQAAASSV---NAEYVEEPATNVKFQ  87

Query  365  RSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQND  544
             SLS PGC  SL+L GTGYREKVFAIIGVKVYAAGLY+++SI  +L+AW+G+S   +Q +
Sbjct  88   TSLSFPGCSNSLTLFGTGYREKVFAIIGVKVYAAGLYLDQSIALELNAWKGQSKEAIQGN  147

Query  545  SPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            S LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISP
Sbjct  148  SSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISP  186



>ref|XP_002283758.2| PREDICTED: fatty-acid-binding protein 3 [Vitis vinifera]
 emb|CBI20088.3| unnamed protein product [Vitis vinifera]
Length=283

 Score =   193 bits (491),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 130/183 (71%), Gaps = 6/183 (3%)
 Frame = +2

Query  119  LWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRA  298
            +W+  S PT   I      P   +   K H+  ++ STF  HFSL   D     +    +
Sbjct  11   IWLPSSKPT---ICFPGKLPNSGVTRYKIHTC-SLLSTFAHHFSLQRKDRFQTHVSPNAS  66

Query  299  ASSSSVGNA--EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGL  472
            +SSSS      EY+EEP+TNVKFQ SL+LP C + LSLLGTGYREKVFAIIGVKVYAAGL
Sbjct  67   SSSSSASVGSAEYIEEPSTNVKFQTSLTLPECSSPLSLLGTGYREKVFAIIGVKVYAAGL  126

Query  473  YVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEA  652
            Y+N+SI NKL+AW+GRSA E+Q DS LF++IF+ P EKSL IVLVRDVDGKTFWDALDEA
Sbjct  127  YLNQSISNKLNAWKGRSATEIQGDSSLFDSIFQIPQEKSLQIVLVRDVDGKTFWDALDEA  186

Query  653  ISP  661
            ISP
Sbjct  187  ISP  189



>ref|XP_010694734.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score =   193 bits (491),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 125/168 (74%), Gaps = 7/168 (4%)
 Frame = +2

Query  170  VKPRFSLPLS---KTHSYFTIFSTFPSHFSLGSLDARLPGLFSP-RAASSSSVGNAEYVE  337
            V P+F    S   KTH + +  ST  S FSL   + R  G   P +  +SSSVGN+EY E
Sbjct  33   VLPQFHQSFSSTQKTH-FLSHLSTTSSRFSLQ--NGRNFGTHFPSKVYASSSVGNSEYAE  89

Query  338  EPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  517
            EP T+VKF +S  LPGC +SLSLLGTGYREKVFAIIGVKVYAAGLYVN S+LN+L  W+G
Sbjct  90   EPATSVKFLKSAYLPGCSSSLSLLGTGYREKVFAIIGVKVYAAGLYVNPSLLNELSPWKG  149

Query  518  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            +S  E++ D  LF++I+++PLEKSL I LVRDVDGKTFWDALDEA+SP
Sbjct  150  KSKPEVEQDLALFQSIYQSPLEKSLQIALVRDVDGKTFWDALDEAVSP  197



>gb|EYU26288.1| hypothetical protein MIMGU_mgv1a0115041mg, partial [Erythranthe 
guttata]
Length=209

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  320  NAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK  499
            N+++ EEP T VKFQ SLSLPGC ++LSLLGTGYREKVFAIIGVKVYAAGLY N+S+  K
Sbjct  2    NSDFAEEPATKVKFQTSLSLPGCSSTLSLLGTGYREKVFAIIGVKVYAAGLYANQSVFTK  61

Query  500  LDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            LDAW G S+AELQ DS LF+ IF+AP+EKSL+IVLVRD+DGKTFWDALDEA+SP
Sbjct  62   LDAWSGLSSAELQKDSSLFDAIFQAPVEKSLNIVLVRDIDGKTFWDALDEAVSP  115



>gb|KJB82095.1| hypothetical protein B456_013G176000 [Gossypium raimondii]
Length=277

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +2

Query  305  SSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNE  484
            +SSVG A+Y EEP T VKF+ SLS+P C TSLSLLGTG +EKVFAIIGVKVYAAGLYVN 
Sbjct  66   ASSVGTADYTEEPATKVKFRTSLSVPDCSTSLSLLGTG-QEKVFAIIGVKVYAAGLYVNP  124

Query  485  SILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            SIL+KLDAW+GRSAA++Q+D PLF++ F+ P+EKSL IVLVRDVDGKTFWDALDEAISP
Sbjct  125  SILSKLDAWKGRSAAQIQDDMPLFKSFFEDPMEKSLQIVLVRDVDGKTFWDALDEAISP  183



>gb|KEH38484.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=277

 Score =   191 bits (484),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = +2

Query  140  PTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVG  319
            P  S  T   +  R S PL+  HS F++F+    HF+        P   S  ++SSS+  
Sbjct  11   PCFSSFTRFYIDKRISKPLNYVHS-FSLFTPPSLHFASKRHPHFFPQAASSSSSSSSAAA  69

Query  320  NAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK  499
            NAEY+EEP TNVKFQ SLS PGC  SL+L GTGYREKVFAIIGVKVYA+GLY+N+SI+N+
Sbjct  70   NAEYLEEPATNVKFQTSLSFPGCSDSLTLFGTGYREKVFAIIGVKVYASGLYLNQSIVNE  129

Query  500  LDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            L+AW+G+S   +Q  S LF+TIF++PLEK L IVLVRDVDGKTFWDAL +AISP
Sbjct  130  LNAWKGQSKDVIQGKSSLFKTIFQSPLEKLLQIVLVRDVDGKTFWDALSDAISP  183



>ref|XP_009339358.1| PREDICTED: fatty-acid-binding protein 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=280

 Score =   190 bits (483),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 133/183 (73%), Gaps = 11/183 (6%)
 Frame = +2

Query  122  WISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFST---FPSHFSLGSLDARLPGLFSP  292
            W+    PT + I     KPR  LP   ++    I  T   FP H    ++ ++ P     
Sbjct  12   WLQFPTPTGNSIP----KPRIGLPTGISNPNVLICQTPIHFPPH---KNIKSQTP-FAVN  63

Query  293  RAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGL  472
             +++S++VG+AEY+EEP T  KFQ SLSLPGC +SL+LLGTGYREKVFAIIGVKVYAAGL
Sbjct  64   ASSASAAVGSAEYIEEPATKEKFQTSLSLPGCSSSLTLLGTGYREKVFAIIGVKVYAAGL  123

Query  473  YVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEA  652
            YVN+S+L  L+AW+GRSAAE+Q DS LF +IF +PLEKSL IVLVRDVDGKTFWDAL++A
Sbjct  124  YVNQSVLYSLNAWKGRSAAEIQEDSSLFNSIFLSPLEKSLQIVLVRDVDGKTFWDALNDA  183

Query  653  ISP  661
            ISP
Sbjct  184  ISP  186



>gb|AFK39093.1| unknown [Medicago truncatula]
Length=277

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = +2

Query  140  PTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVG  319
            P  S  T   +  R S PL+  HS F++F+    HF+        P   S  ++SSS+  
Sbjct  11   PCFSSFTRFCIDKRISKPLNYVHS-FSLFTPPSLHFASERHPHFFPQAASSSSSSSSAAA  69

Query  320  NAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK  499
            NAEY+EEP TNVKFQ SLS PGC  SL+L GTGYREKVFAIIGVKVYA+GLY+N+SI+N+
Sbjct  70   NAEYLEEPATNVKFQTSLSFPGCSDSLTLFGTGYREKVFAIIGVKVYASGLYLNQSIVNE  129

Query  500  LDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            L+AW+G+S   +Q  S LF+TIF++PLEK L IVLVRDVDGKTFWDAL +AISP
Sbjct  130  LNAWKGQSKDVIQGKSSLFKTIFQSPLEKLLQIVLVRDVDGKTFWDALSDAISP  183



>ref|XP_008452433.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Cucumis melo]
Length=312

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 137/198 (69%), Gaps = 25/198 (13%)
 Frame = +2

Query  89   MAAVGSMPSSLWISVSAPT---KSKITSCNV-KPRFSLPLSKTHSYFTI---FSTFPSHF  247
            MAA    P+ L + +S PT    S  T C + KP  S+P    HS F++   F  F S+F
Sbjct  39   MAANVVNPTPLSLPLSVPTGKLNSNPTICLLTKP--SIPTLSIHSTFSLNNNFFRFSSNF  96

Query  248  SLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYRE  427
            SL             + +SS + G   +VEEP+TNVKF  SL+LPGC TSLSLLGTGYRE
Sbjct  97   SL-------------KPSSSLASG---FVEEPSTNVKFPTSLTLPGCSTSLSLLGTGYRE  140

Query  428  KVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLV  607
            KVFAIIGVKVYAAGLY+N S+ N+L+AWRGRSAA +Q DS LF+ IF++  EKSL IVLV
Sbjct  141  KVFAIIGVKVYAAGLYINSSVSNELNAWRGRSAAAIQEDSSLFDIIFQSCSEKSLQIVLV  200

Query  608  RDVDGKTFWDALDEAISP  661
            RDVDGKTFWDALD+AISP
Sbjct  201  RDVDGKTFWDALDDAISP  218



>emb|CDY24090.1| BnaA06g00880D [Brassica napus]
Length=288

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNA E VEEP T+VKFQRS++LPGC T+LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  73   SAASSVGNADENVEEPATSVKFQRSVTLPGCSTTLSLLGTGFREKKFAIIGVKVYAAGLY  132

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL  L AW+G+SAAE+  DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  133  VNESILTGLTAWKGKSAAEIHGDSSLFSSIFQDQAEKSLQIVLVRDVDGKTFWDALDEAI  192

Query  656  SP  661
            SP
Sbjct  193  SP  194



>ref|XP_010479918.1| PREDICTED: fatty-acid-binding protein 3-like isoform X1 [Camelina 
sativa]
Length=291

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  296  AASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGL  472
            AASS  VGNAE Y EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIGVKVYAAG 
Sbjct  75   AASSGKVGNAEDYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGY  134

Query  473  YVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEA  652
            YVNESIL+ L AW+GRSA E+Q+DS LF +IF+A  EK+L IVLVRDVDGKTFWDALDEA
Sbjct  135  YVNESILSGLSAWKGRSADEIQSDSSLFSSIFQAQAEKALQIVLVRDVDGKTFWDALDEA  194

Query  653  ISP  661
            ISP
Sbjct  195  ISP  197



>emb|CAN75399.1| hypothetical protein VITISV_004495 [Vitis vinifera]
Length=234

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 106/135 (79%), Gaps = 19/135 (14%)
 Frame = +2

Query  314  VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGT-------------------GYREKVF  436
            +G+AEY+EEP+TNVKFQ SL+LP C + LSLLGT                   GYREKVF
Sbjct  6    IGSAEYIEEPSTNVKFQTSLTLPECSSPLSLLGTVFEHPKLTKAFIFMVCNNSGYREKVF  65

Query  437  AIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDV  616
            AIIGVKVYAAGLY+N+SI NKL+AW+GRSA E+Q DS LF++IF+ PLEKSL IVLVRDV
Sbjct  66   AIIGVKVYAAGLYLNQSISNKLNAWKGRSATEIQGDSSLFDSIFQIPLEKSLQIVLVRDV  125

Query  617  DGKTFWDALDEAISP  661
            DGKTFWDALDEAISP
Sbjct  126  DGKTFWDALDEAISP  140



>ref|XP_010462251.1| PREDICTED: fatty-acid-binding protein 3-like [Camelina sativa]
Length=287

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNAE Y EE  T+VKFQRS++LPGC +SLSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  72   SAASSVGNAEEYAEETATSVKFQRSVTLPGCSSSLSLLGTGFREKKFAIIGVKVYAAGYY  131

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW+GRSA E+Q DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWKGRSADEIQRDSSLFSSIFQTQAEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  656  SP  661
            SP
Sbjct  192  SP  193



>ref|XP_007022085.1| Chalcone-flavanone isomerase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY13610.1| Chalcone-flavanone isomerase family protein isoform 1 [Theobroma 
cacao]
Length=281

 Score =   188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  326  EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD  505
            +Y EEP T VKFQ SLSLPGC +SLSLLGTGYREKVFAIIGVKVYAAGLYVN+SIL+KLD
Sbjct  76   DYTEEPATKVKFQTSLSLPGCSSSLSLLGTGYREKVFAIIGVKVYAAGLYVNQSILSKLD  135

Query  506  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            AW+G  A+++Q+D  LF++IF+ PLEKSL IVLVRDVDGKTFWDALDEAISP
Sbjct  136  AWKGWLASQIQDDLSLFKSIFEVPLEKSLQIVLVRDVDGKTFWDALDEAISP  187



>ref|XP_009147594.1| PREDICTED: fatty-acid-binding protein 3 [Brassica rapa]
Length=283

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNA E VEEP T+VKFQR+++LPGC T+LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  68   SAASSVGNADEKVEEPATSVKFQRTVALPGCSTALSLLGTGFREKKFAIIGVKVYAAGLY  127

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL  L AW+G+SA E+Q DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  128  VNESILTGLTAWKGKSADEIQRDSSLFSSIFQDQAEKSLEIVLVRDVDGKTFWDALDEAI  187

Query  656  SP  661
            SP
Sbjct  188  SP  189



>ref|XP_010501004.1| PREDICTED: fatty-acid-binding protein 3-like [Camelina sativa]
Length=289

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNAE Y EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  74   SAASSVGNAEDYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  133

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW+GRSA E+Q+DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  134  VNESILSGLSAWKGRSADEIQSDSSLFSSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  193

Query  656  SP  661
            SP
Sbjct  194  SP  195



>emb|CDY45118.1| BnaC06g06390D [Brassica napus]
Length=292

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            A++SSVGNA E VEEP T+VKFQRS++LPGC T+LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  77   AAASSVGNADENVEEPATSVKFQRSVALPGCSTTLSLLGTGFREKKFAIIGVKVYAAGLY  136

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL  L  W+GRSA  +Q DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  137  VNESILTGLTTWKGRSADAIQRDSSLFNSIFQDQAEKSLQIVLVRDVDGKTFWDALDEAI  196

Query  656  SP  661
            SP
Sbjct  197  SP  198



>ref|XP_010535016.1| PREDICTED: fatty-acid-binding protein 3 [Tarenaya hassleriana]
Length=281

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  305  SSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNE  484
            S+S GN +Y+EEP T+V+FQRS++LPGC + L+LLGTGYREK FAIIGVKVYAAG YVNE
Sbjct  72   SASSGNVDYMEEPATSVRFQRSVTLPGCSSPLALLGTGYREKTFAIIGVKVYAAGFYVNE  131

Query  485  SILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            S+L+ L AW+GRSA+E+Q DS +F +IF+A  EKSL IVLVRDVDGKTFWDALDEAI+P
Sbjct  132  SVLSGLSAWKGRSASEIQKDSSVFNSIFQAAGEKSLQIVLVRDVDGKTFWDALDEAITP  190



>ref|XP_010479919.1| PREDICTED: fatty-acid-binding protein 3-like isoform X2 [Camelina 
sativa]
 ref|XP_010479922.1| PREDICTED: fatty-acid-binding protein 3-like [Camelina sativa]
Length=289

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNAE Y EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  74   SAASSVGNAEDYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  133

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW+GRSA E+Q+DS LF +IF+A  EK+L IVLVRDVDGKTFWDALDEAI
Sbjct  134  VNESILSGLSAWKGRSADEIQSDSSLFSSIFQAQAEKALQIVLVRDVDGKTFWDALDEAI  193

Query  656  SP  661
            SP
Sbjct  194  SP  195



>ref|XP_008366525.1| PREDICTED: fatty-acid-binding protein 3-like [Malus domestica]
Length=251

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 129/183 (70%), Gaps = 11/183 (6%)
 Frame = +2

Query  122  WISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFST---FPSHFSLGSLDARLPGLFSP  292
            W+    PT++    C  KPR   P   ++    I  T   FP H ++ S           
Sbjct  24   WLQFPTPTRN----CIPKPRIGFPTGISNPNVLICQTPIHFPPHKNIKSQTP----FAVN  75

Query  293  RAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGL  472
             +++S++VGNAE +EEP T  KFQ SLSLPGC +SL LLGTGYREKVFAIIGV+VYAAGL
Sbjct  76   ASSASAAVGNAEXIEEPATKEKFQTSLSLPGCSSSLXLLGTGYREKVFAIIGVEVYAAGL  135

Query  473  YVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEA  652
            YVN+S+LN L+AW+GRSAAE+Q DS LF +IF +P EKS+ IVLVRDVDGKTFWDAL++A
Sbjct  136  YVNQSVLNSLNAWKGRSAAEIQEDSSLFNSIFLSPSEKSIQIVLVRDVDGKTFWDALNDA  195

Query  653  ISP  661
            ISP
Sbjct  196  ISP  198



>ref|XP_008363648.1| PREDICTED: fatty-acid-binding protein 3-like [Malus domestica]
Length=278

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 128/181 (71%), Gaps = 9/181 (5%)
 Frame = +2

Query  122  WISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLG-SLDARLPGLFSPRA  298
            W+    PT++    C  KPR    L+       +    P HFSL  ++ +R P   +   
Sbjct  12   WLQSPIPTRN----CIPKPRIGF-LTGISKPXVLICQTPIHFSLQKNIKSRTPFAVN---  63

Query  299  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  478
            ASS+SVG AEY+EEP T  KFQ SLSLPGC +SL+LLGTGYREKVFAIIGVKVYAAGLY 
Sbjct  64   ASSTSVGRAEYMEEPVTKEKFQTSLSLPGCSSSLTLLGTGYREKVFAIIGVKVYAAGLYA  123

Query  479  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            N+SILN L+AW GRS AE+Q DS LF +IF +P  KSL IVLVRDVDGKTFWDAL++AIS
Sbjct  124  NQSILNSLNAWXGRSTAEIQEDSSLFSSIFLSPSVKSLQIVLVRDVDGKTFWDALNDAIS  183

Query  659  P  661
            P
Sbjct  184  P  184



>ref|XP_003546743.1| PREDICTED: fatty-acid-binding protein 3-like [Glycine max]
 gb|KHN39751.1| Chalcone--flavonone isomerase 2 [Glycine soja]
Length=281

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 119/159 (75%), Gaps = 3/159 (2%)
 Frame = +2

Query  185  SLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQ  364
            +LP S  HS F++ S  P HFS      R P   +   A+SSS  NAEYVEEP TNVKFQ
Sbjct  32   TLPFSNDHS-FSLLSATPMHFSSHKSSRRQPHFLA--QAASSSAANAEYVEEPATNVKFQ  88

Query  365  RSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQND  544
             SL+ PGC  SL+L GTGYREKVFAIIGVKVYAAGLY+++S+  +L+AW+G+S   +Q +
Sbjct  89   TSLNFPGCSNSLTLFGTGYREKVFAIIGVKVYAAGLYLDQSVTQELNAWKGQSKDAIQGN  148

Query  545  SPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            S LFETIF++  EKSL IVLVRDVDGKTFWDAL +AISP
Sbjct  149  SSLFETIFQSSFEKSLQIVLVRDVDGKTFWDALSDAISP  187



>ref|XP_004294183.1| PREDICTED: fatty-acid-binding protein 3 [Fragaria vesca subsp. 
vesca]
Length=285

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            Y+EEP TNV+FQ S+SLPGC +SL+LLGTGYREKVFAIIGVKVYAAGLYVN+SILN L+A
Sbjct  81   YIEEPATNVRFQTSVSLPGCSSSLALLGTGYREKVFAIIGVKVYAAGLYVNQSILNNLNA  140

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            W+GR AAE+Q D  LF ++F++P EKSL I+LVRDVDGKTFWDAL++AISP
Sbjct  141  WKGRPAAEIQKDPSLFSSMFQSPSEKSLQIILVRDVDGKTFWDALNDAISP  191



>ref|XP_009344622.1| PREDICTED: fatty-acid-binding protein 3-like [Pyrus x bretschneideri]
Length=278

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 130/181 (72%), Gaps = 9/181 (5%)
 Frame = +2

Query  122  WISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFS-LGSLDARLPGLFSPRA  298
            W+    PT++    C  KPR       ++    I  T P HFS   ++ +R P   +   
Sbjct  12   WLQSPIPTRN----CIPKPRIGFLTGISNPNVLICQT-PIHFSPQKNIKSRTPFAVN---  63

Query  299  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  478
            ASS+SVG+AEY+EEP T  KFQ SLSLPGC +SL+LLGTGYREKVFAIIGVKVYAAGLY 
Sbjct  64   ASSTSVGSAEYIEEPATKEKFQTSLSLPGCSSSLTLLGTGYREKVFAIIGVKVYAAGLYA  123

Query  479  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            N+SILN L+AW+GRS A +Q DS LF +IF +P EKSL IVLVRDVDGKTFWDAL++AIS
Sbjct  124  NQSILNSLNAWKGRSTAYIQEDSSLFSSIFLSPSEKSLQIVLVRDVDGKTFWDALNDAIS  183

Query  659  P  661
            P
Sbjct  184  P  184



>ref|XP_002894446.1| hypothetical protein ARALYDRAFT_474480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70705.1| hypothetical protein ARALYDRAFT_474480 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGN  EY EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  73   SAASSVGNVDEYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  132

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW+GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  133  VNESILSGLSAWKGRSADEIQRDSSLFSSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  192

Query  656  SP  661
            SP
Sbjct  193  SP  194



>gb|KFK35722.1| hypothetical protein AALP_AA4G028300 [Arabis alpina]
Length=287

 Score =   185 bits (470),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SS GN E Y EEP T+VKFQRS++LPGC   LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  72   SAASSAGNVEEYTEEPATSVKFQRSVTLPGCSNPLSLLGTGFREKKFAIIGVKVYAAGLY  131

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW+G+S  E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWKGKSTDEIQRDSSLFSSIFQAQEEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  656  SP  661
            SP
Sbjct  192  SP  193



>pdb|4DOL|A Chain A, Crystal Structure Of Arabidopsis Thaliana Fatty-Acid 
Binding Protein At1g53520 (Atfap3)
Length=217

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  2    SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  61

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  62   VNESILSGLSAWTGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  121

Query  656  SP  661
            SP
Sbjct  122  SP  123



>gb|KCW67632.1| hypothetical protein EUGRSUZ_F01378 [Eucalyptus grandis]
Length=248

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            Y EEP T VKFQ  L+LPGC TSL+L+GTGYREKVFAIIGVKVYAAGLY+N SI +KLDA
Sbjct  82   YAEEPATRVKFQTPLTLPGCSTSLTLVGTGYREKVFAIIGVKVYAAGLYINPSIFSKLDA  141

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            W+G+SAA++Q +  LF +IF+APLEKSL IVLVRDVDGKTFWDALD+AISP
Sbjct  142  WKGKSAADIQENRSLFNSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAISP  192



>ref|XP_010060770.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Eucalyptus 
grandis]
 gb|KCW67631.1| hypothetical protein EUGRSUZ_F01378 [Eucalyptus grandis]
Length=286

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            Y EEP T VKFQ  L+LPGC TSL+L+GTGYREKVFAIIGVKVYAAGLY+N SI +KLDA
Sbjct  82   YAEEPATRVKFQTPLTLPGCSTSLTLVGTGYREKVFAIIGVKVYAAGLYINPSIFSKLDA  141

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            W+G+SAA++Q +  LF +IF+APLEKSL IVLVRDVDGKTFWDALD+AISP
Sbjct  142  WKGKSAADIQENRSLFNSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAISP  192



>ref|XP_010241349.1| PREDICTED: fatty-acid-binding protein 3 [Nelumbo nucifera]
Length=281

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  311  SVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESI  490
            SV +AEY  EP TNVKFQ SLSLPGC + L+LLGTGYREKVFAI+GVKVYAAGLY N  I
Sbjct  71   SVESAEYAAEPATNVKFQTSLSLPGCSSELALLGTGYREKVFAIVGVKVYAAGLYANPLI  130

Query  491  LNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            +  L+AW+GRSAAE+Q DS LF ++F+A LEKSL IVLVRDVDGKTFW ALDEAI+P
Sbjct  131  IGTLNAWKGRSAAEIQQDSSLFHSMFQASLEKSLQIVLVRDVDGKTFWGALDEAITP  187



>gb|AAM61303.1| chalcone isomerase, putative [Arabidopsis thaliana]
Length=287

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  72   SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  131

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW+GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWKGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  656  SP  661
            SP
Sbjct  192  SP  193



>ref|XP_004488681.1| PREDICTED: chalcone--flavonone isomerase-like [Cicer arietinum]
Length=274

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +2

Query  248  SLGSLDARLPGLFSPRAASSSSVG-NAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYR  424
            SL +   + P LF P+A SSSS   NAEY+EEP T VKF  SLS PGC  SL+L G GYR
Sbjct  43   SLHNTSKKQP-LFFPQATSSSSPAVNAEYIEEPATTVKFHTSLSFPGCSDSLTLFGAGYR  101

Query  425  EKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVL  604
            EKVFAIIGVKVYAAGLY+N+SI+++L+AW+G+S   +Q +S LF+TIF++PLEK L I+L
Sbjct  102  EKVFAIIGVKVYAAGLYLNQSIISELNAWKGQSKDGIQGNSSLFKTIFQSPLEKLLQIIL  161

Query  605  VRDVDGKTFWDALDEAISP  661
            VRDVDGKTFWDAL +AISP
Sbjct  162  VRDVDGKTFWDALSDAISP  180



>gb|AAF78437.1|AC018748_16 Contains a weak similarity to chalcone--flavonone isomerase from 
Pueraria lobata gi|Q43056 and containes fanconi anaemia 
group C protein PF|02106 domain [Arabidopsis thaliana]
Length=271

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  72   SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  131

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWTGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  656  SP  661
            SP
Sbjct  192  SP  193



>ref|NP_175757.1| fatty-acid-binding protein 3 [Arabidopsis thaliana]
 sp|Q9C8L2.1|FAP3_ARATH RecName: Full=Fatty-acid-binding protein 3; Short=AtFAP3; AltName: 
Full=Chalcone-flavanone isomerase family protein 3 [Arabidopsis 
thaliana]
 gb|AAG51975.1|AC024260_13 chalcone isomerase, putative; 94270-95700 [Arabidopsis thaliana]
 gb|ABF82628.1| At1g53520 [Arabidopsis thaliana]
 gb|AEE32951.1| fatty-acid-binding protein 3 [Arabidopsis thaliana]
Length=287

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  72   SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  131

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  132  VNESILSGLSAWTGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI  191

Query  656  SP  661
            SP
Sbjct  192  SP  193



>ref|XP_007149369.1| hypothetical protein PHAVU_005G0645000g, partial [Phaseolus vulgaris]
 gb|ESW21363.1| hypothetical protein PHAVU_005G0645000g, partial [Phaseolus vulgaris]
Length=278

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +2

Query  185  SLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQ  364
            +LPLS     F++ S+ P HFS     +R   LF  + ASSS   NAEYVEEP TNVKFQ
Sbjct  28   TLPLSSHGQSFSLLSSTPMHFS-SHKSSRNQPLFLAQVASSSD-ANAEYVEEPETNVKFQ  85

Query  365  RSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQND  544
              L+ PGC  SL+LLGTGYREK+FAI+ VKVYAAGLY+++ I  +L+AW+G+S   +Q +
Sbjct  86   TCLNFPGCSNSLTLLGTGYREKIFAIVSVKVYAAGLYLDQHITRELNAWKGQSKDAIQGN  145

Query  545  SPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            S LF+TIF++  EKSL I+L R++DGKTFW+AL +AISP
Sbjct  146  SSLFQTIFQSSFEKSLQIILARNIDGKTFWEALSDAISP  184



>ref|XP_008368445.1| PREDICTED: fatty-acid-binding protein 3 [Malus domestica]
Length=278

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 132/192 (69%), Gaps = 9/192 (5%)
 Frame = +2

Query  89   MAAVGSMPSSLWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLG-SLD  265
            M    ++ S  W+    PT++    C  KPR    L+       +    P HFSL  ++ 
Sbjct  1    MFEAQAICSPKWLQSPIPTRN----CIPKPRIGF-LTGISKPXVLICQTPIHFSLQKNIK  55

Query  266  ARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAII  445
            +R P   +   ASS+SVG AEY+EEP T  KFQ SLSLPGC +SL+LLGTGYREKVFAII
Sbjct  56   SRTPFAVN---ASSTSVGRAEYIEEPATKEKFQTSLSLPGCSSSLTLLGTGYREKVFAII  112

Query  446  GVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGK  625
            GVKVYAAGLY N+SILN L+AW+GRS AE+Q DS LF + F +P  KSL IVLVRDVDGK
Sbjct  113  GVKVYAAGLYANQSILNSLNAWKGRSTAEIQEDSSLFSSXFLSPSXKSLQIVLVRDVDGK  172

Query  626  TFWDALDEAISP  661
            TFWDAL++AISP
Sbjct  173  TFWDALNDAISP  184



>gb|KDP39780.1| hypothetical protein JCGZ_04939 [Jatropha curcas]
Length=268

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            Y EEP TNV+FQ SLSLPGC +SLSLLGTGYREKVFAIIGVKVYAAGLYVN SIL+ LD 
Sbjct  64   YTEEPATNVRFQTSLSLPGCSSSLSLLGTGYREKVFAIIGVKVYAAGLYVNPSILSALDT  123

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            W+G+S AE+  ++  F +IF+A LEKSL IVLVRDVDGKTFWDALD+AISP
Sbjct  124  WKGQSTAEIHGNAAFFSSIFQAALEKSLQIVLVRDVDGKTFWDALDDAISP  174



>ref|XP_006305475.1| hypothetical protein CARUB_v10009906mg [Capsella rubella]
 gb|EOA38373.1| hypothetical protein CARUB_v10009906mg [Capsella rubella]
Length=291

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SSVGNA EY EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct  76   SAASSVGNADEYAEETATSVKFRRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY  135

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL  L AW+GRSA E++ DS LF +IF+   EKSL IVLVRDVDGKTFWDALDEAI
Sbjct  136  VNESILRGLSAWKGRSADEIEKDSSLFSSIFQDQAEKSLQIVLVRDVDGKTFWDALDEAI  195

Query  656  SP  661
            SP
Sbjct  196  SP  197



>ref|XP_008784378.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008784379.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008784380.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Phoenix dactylifera]
Length=265

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 122/182 (67%), Gaps = 18/182 (10%)
 Frame = +2

Query  128  SVSAPTK--SKITSCNVK--PRFSLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPR  295
            +VS P +  S ++ C  K  P F L   +       FSTFP   SL S        F PR
Sbjct  4    AVSHPARPPSLVSRCRTKAAPFFVL---ERRPLLRAFSTFPRLNSLHSP-------FIPR  53

Query  296  AASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            A    SVG++EYV EP TNVKF R L +PGC  SL LLGTGYREKVFAIIG+KVYAAG Y
Sbjct  54   A----SVGSSEYVMEPGTNVKFPRELRVPGCSGSLVLLGTGYREKVFAIIGIKVYAAGFY  109

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
               SI  +LDAW+G+ AAE+ +D  LF +I +APLEKSL+I+LVRDVDGKTFW+ALD+ I
Sbjct  110  AEPSIRERLDAWKGKPAAEILDDCSLFSSILQAPLEKSLNIMLVRDVDGKTFWNALDDVI  169

Query  656  SP  661
            SP
Sbjct  170  SP  171



>ref|XP_006392782.1| hypothetical protein EUTSA_v10011696mg [Eutrema salsugineum]
 gb|ESQ30068.1| hypothetical protein EUTSA_v10011696mg [Eutrema salsugineum]
Length=295

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  ASSSSVGNA-EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            +++SS GN  EY +E  T+VKFQR+++LPGC + LSLLGTG+REK FAIIGVKVYAAGLY
Sbjct  80   SAASSAGNVDEYAQESATSVKFQRTVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGLY  139

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            VNESIL+ L AW+GRS+ E+Q DS LF +IF+A   KSL IVLVRDVDGKTFWDALDEAI
Sbjct  140  VNESILSGLSAWKGRSSDEIQIDSSLFSSIFQAQAAKSLQIVLVRDVDGKTFWDALDEAI  199

Query  656  SP  661
            SP
Sbjct  200  SP  201



>ref|XP_010060771.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Eucalyptus 
grandis]
 gb|KCW67629.1| hypothetical protein EUGRSUZ_F01378 [Eucalyptus grandis]
Length=285

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  341  PTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGR  520
            P T VKFQ  L+LPGC TSL+L+GTGYREKVFAIIGVKVYAAGLY+N SI +KLDAW+G+
Sbjct  85   PATRVKFQTPLTLPGCSTSLTLVGTGYREKVFAIIGVKVYAAGLYINPSIFSKLDAWKGK  144

Query  521  SAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            SAA++Q +  LF +IF+APLEKSL IVLVRDVDGKTFWDALD+AISP
Sbjct  145  SAADIQENRSLFNSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAISP  191



>ref|XP_007149370.1| hypothetical protein PHAVU_005G064600g [Phaseolus vulgaris]
 gb|ESW21364.1| hypothetical protein PHAVU_005G064600g [Phaseolus vulgaris]
Length=282

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +2

Query  185  SLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQ  364
            +LPLS     F++ S+ P HFS      R P LF  + ASSS+  NAEYVEEP TNVK Q
Sbjct  32   TLPLSSHGQSFSLLSSTPMHFSSHKSSRRQP-LFLAQVASSSA-ANAEYVEEPETNVKLQ  89

Query  365  RSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQND  544
              L+ PGC  SL+L GTGYRE VFAI+ VKVY AGLY+++ I  +L+AW+G+S   +Q +
Sbjct  90   TCLNFPGCSNSLTLFGTGYRENVFAIVSVKVYTAGLYLDQHITRELNAWKGQSKDAIQGN  149

Query  545  SPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            S LF+TIF++   KSL I+L R++ GKTFW+AL +AISP
Sbjct  150  SSLFQTIFQSSFGKSLQIILARNIHGKTFWEALSDAISP  188



>ref|XP_008784382.1| PREDICTED: fatty-acid-binding protein 3 isoform X3 [Phoenix dactylifera]
Length=229

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  293  RAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGL  472
            R    ++VG++EYV EP TNVKF R L +PGC  SL LLGTGYREKVFAIIG+KVYAAG 
Sbjct  13   RVVFLAAVGSSEYVMEPGTNVKFPRELRVPGCSGSLVLLGTGYREKVFAIIGIKVYAAGF  72

Query  473  YVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEA  652
            Y   SI  +LDAW+G+ AAE+ +D  LF +I +APLEKSL+I+LVRDVDGKTFW+ALD+ 
Sbjct  73   YAEPSIRERLDAWKGKPAAEILDDCSLFSSILQAPLEKSLNIMLVRDVDGKTFWNALDDV  132

Query  653  ISP  661
            ISP
Sbjct  133  ISP  135



>ref|XP_009413396.1| PREDICTED: fatty-acid-binding protein 3 [Musa acuminata subsp. 
malaccensis]
Length=274

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = +2

Query  227  STFPSHFSLGSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSL  406
            S FPS      L A   G   P +   +SVG+A+YV EP T+VKF + L +PGC +SL L
Sbjct  36   SKFPSTAPAPLLLAHPLGRTRPDSTPRASVGSADYVVEPGTSVKFPKELQVPGCSSSLVL  95

Query  407  LGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEK  586
            LGTGYREKVFAIIGVKVY+AG Y + SI N  D+W+G+S+ EL  DS LF +IF APLEK
Sbjct  96   LGTGYREKVFAIIGVKVYSAGFYADLSIRNTFDSWKGKSSTELLEDSSLFSSIFHAPLEK  155

Query  587  SLSIVLVRDVDGKTFWDALDEAISP  661
            SL+I+LVRDVDGKTFW ALD+ ISP
Sbjct  156  SLNIMLVRDVDGKTFWTALDDVISP  180



>ref|XP_006370052.1| hypothetical protein POPTR_0001s38970g, partial [Populus trichocarpa]
 gb|ERP66621.1| hypothetical protein POPTR_0001s38970g, partial [Populus trichocarpa]
Length=179

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 5/115 (4%)
 Frame = +2

Query  317  GNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILN  496
            G+AEY +EP T  +FQ SLSLPGC TSLSLLGTGY EKVFA+IGVKVYAAG+YVN SIL 
Sbjct  1    GSAEYTQEPATKERFQTSLSLPGCSTSLSLLGTGYTEKVFAVIGVKVYAAGIYVNPSILT  60

Query  497  KLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
             +  W+G+SA+E+Q +S LF +IF+APLEKSL I     VDGKTFWDALDEAISP
Sbjct  61   TVSTWKGQSASEIQENSALFSSIFQAPLEKSLQI-----VDGKTFWDALDEAISP  110



>ref|XP_010106740.1| Chalcone--flavonone isomerase [Morus notabilis]
 gb|EXC11707.1| Chalcone--flavonone isomerase [Morus notabilis]
Length=290

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  299  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  478
            AS++SVG+AEY EEP T V FQ +LSLP C +SLSLLGTG+REKVFAIIGVKVYA GLYV
Sbjct  75   ASAASVGSAEYAEEPATKVAFQTTLSLPSCSSSLSLLGTGFREKVFAIIGVKVYAVGLYV  134

Query  479  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            N S+ +KLD+W GRSAAE+Q DS +F +IF+APLEKSL IVLVRDVDGKTFWDALD+AIS
Sbjct  135  NPSVFSKLDSWNGRSAAEIQEDSSVFSSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAIS  194

Query  659  P  661
            P
Sbjct  195  P  195



>ref|XP_010916104.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010916105.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010916107.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010916108.1| PREDICTED: fatty-acid-binding protein 3 isoform X1 [Elaeis guineensis]
Length=265

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  308  SSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNES  487
            +SVG++EYV E  TNVKF R L +PGC  SL LLGTGYREKVFAIIGVKVYAAG YV  S
Sbjct  54   ASVGSSEYVVETGTNVKFPRELRVPGCSGSLVLLGTGYREKVFAIIGVKVYAAGFYVEPS  113

Query  488  ILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            I  +LDAW+G+ A E+  D  LF  I +APLEKSL+I+LVRDVDGKTFW+ALD+ ISP
Sbjct  114  IRERLDAWKGKPATEVLGDCSLFSLILQAPLEKSLNIMLVRDVDGKTFWNALDDVISP  171



>ref|XP_007149371.1| hypothetical protein PHAVU_005G064600g [Phaseolus vulgaris]
 gb|ESW21365.1| hypothetical protein PHAVU_005G064600g [Phaseolus vulgaris]
Length=236

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = +2

Query  299  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  478
            +S +   NAEYVEEP TNVK Q  L+ PGC  SL+L GTGYRE VFAI+ VKVY AGLY+
Sbjct  22   SSVAKAANAEYVEEPETNVKLQTCLNFPGCSNSLTLFGTGYRENVFAIVSVKVYTAGLYL  81

Query  479  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            ++ I  +L+AW+G+S   +Q +S LF+TIF++   KSL I+L R++ GKTFW+AL +AIS
Sbjct  82   DQHITRELNAWKGQSKDAIQGNSSLFQTIFQSSFGKSLQIILARNIHGKTFWEALSDAIS  141

Query  659  P  661
            P
Sbjct  142  P  142



>gb|ADE76284.1| unknown [Picea sitchensis]
Length=292

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  290  PRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAG  469
            PRA   ++VG  +++ EP TNVKF  SL++PG  +SLSL GTG+REK  AII VKVYAAG
Sbjct  78   PRA--KATVGTEDFIVEPATNVKFLTSLNVPGGSSSLSLAGTGFREKKIAIISVKVYAAG  135

Query  470  LYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  649
            LYV+ +I + L AW G+  ++++ D+  F  +F+AP+EKSL IVLVRD+DG+TFW ALDE
Sbjct  136  LYVDTTIKSYLAAWSGKLGSQIEQDNLFFNAVFEAPVEKSLQIVLVRDIDGETFWGALDE  195

Query  650  AISP  661
            A+SP
Sbjct  196  ALSP  199



>ref|XP_008386421.1| PREDICTED: fatty-acid-binding protein 3-like [Malus domestica]
Length=138

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  416  GYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLS  595
            GYREKVFAIIGV VYAAGLYVN+S+LN L+AW+GRSAAE+Q DS LF +IF +P EKS+ 
Sbjct  4    GYREKVFAIIGVXVYAAGLYVNQSVLNSLNAWKGRSAAEIQEDSSLFNSIFLSPSEKSIQ  63

Query  596  IVLVRDVDGKTFWDALDEAISP  661
            IVLVRDVDGKTFWDAL++AISP
Sbjct  64   IVLVRDVDGKTFWDALNDAISP  85



>gb|AFQ92050.1| chalcone isomerase, partial [Pyrus pyrifolia]
Length=139

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +2

Query  389  CTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIF  568
             +SL+LLGTGYREKVFAIIGVKVYAAGLY N+SILN L+AW+GRS A++Q DS LF +IF
Sbjct  1    SSSLALLGTGYREKVFAIIGVKVYAAGLYANQSILNSLNAWKGRSTADIQEDSSLFSSIF  60

Query  569  KAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
             +P EKSL IVLVRDVDGKTFWDAL++AISP
Sbjct  61   LSPSEKSLQIVLVRDVDGKTFWDALNDAISP  91



>gb|KCW67630.1| hypothetical protein EUGRSUZ_F01378 [Eucalyptus grandis]
Length=269

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 81/111 (73%), Gaps = 17/111 (15%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            Y EEP T VKFQ  L+LPGC TSL+L+GTG                 LY+N SI +KLDA
Sbjct  82   YAEEPATRVKFQTPLTLPGCSTSLTLVGTG-----------------LYINPSIFSKLDA  124

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            W+G+SAA++Q +  LF +IF+APLEKSL IVLVRDVDGKTFWDALD+AISP
Sbjct  125  WKGKSAADIQENRSLFNSIFQAPLEKSLQIVLVRDVDGKTFWDALDDAISP  175



>ref|XP_010694735.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=185

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  407  LGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEK  586
            L  GYREKVFAIIGVKVYAAGLYVN S+LN+L  W+G+S  E++ D  LF++I+++PLEK
Sbjct  6    LKNGYREKVFAIIGVKVYAAGLYVNPSLLNELSPWKGKSKPEVEQDLALFQSIYQSPLEK  65

Query  587  SLSIVLVRDVDGKTFWDALDEAISP  661
            SL I LVRDVDGKTFWDALDEA+SP
Sbjct  66   SLQIALVRDVDGKTFWDALDEAVSP  90



>ref|XP_008784381.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Phoenix dactylifera]
Length=231

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  410  GTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKS  589
             +GYREKVFAIIG+KVYAAG Y   SI  +LDAW+G+ AAE+ +D  LF +I +APLEKS
Sbjct  54   ASGYREKVFAIIGIKVYAAGFYAEPSIRERLDAWKGKPAAEILDDCSLFSSILQAPLEKS  113

Query  590  LSIVLVRDVDGKTFWDALDEAISP  661
            L+I+LVRDVDGKTFW+ALD+ ISP
Sbjct  114  LNIMLVRDVDGKTFWNALDDVISP  137



>ref|XP_010916109.1| PREDICTED: fatty-acid-binding protein 3 isoform X2 [Elaeis guineensis]
Length=231

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  410  GTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKS  589
             +GYREKVFAIIGVKVYAAG YV  SI  +LDAW+G+ A E+  D  LF  I +APLEKS
Sbjct  54   ASGYREKVFAIIGVKVYAAGFYVEPSIRERLDAWKGKPATEVLGDCSLFSLILQAPLEKS  113

Query  590  LSIVLVRDVDGKTFWDALDEAISP  661
            L+I+LVRDVDGKTFW+ALD+ ISP
Sbjct  114  LNIMLVRDVDGKTFWNALDDVISP  137



>ref|XP_001764300.1| predicted protein [Physcomitrella patens]
 gb|EDQ70854.1| predicted protein [Physcomitrella patens]
Length=217

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  311  SVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESI  490
            +VG    V EP T++KF   L++P    +L+ LG G REK  A + VKVYA G+Y    +
Sbjct  5    AVGADNVVTEPATSIKFALLLTVPDSSNTLTFLGAGVREKQIAFLKVKVYAVGVYAQPDV  64

Query  491  LNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
               L +W+G+SAA+L  D  LF+ + +AP+EK+L I L RDVDG TFW ALDEA+ P
Sbjct  65   AASLASWKGKSAADLVKDEALFQELAQAPVEKALQIKLARDVDGATFWGALDEALVP  121



>ref|NP_001046684.1| Os02g0320300 [Oryza sativa Japonica Group]
 dbj|BAD28958.1| chalcone isomerase-like [Oryza sativa Japonica Group]
 dbj|BAF08598.1| Os02g0320300 [Oryza sativa Japonica Group]
 dbj|BAG90517.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 83/123 (67%), Gaps = 5/123 (4%)
 Frame = +2

Query  290  PRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAG  469
            P AA   +VG+A +V E TTNVKF R +++PG    L +LGTGYREK F    +K+YAA 
Sbjct  67   PSAAGGGTVGDA-FVIEDTTNVKFPREIAVPGYTEPLVILGTGYREKFF----LKIYAAA  121

Query  470  LYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  649
             YV+ SI      WR +   E  + S +F++IFKAP+ KSLSI+LVRDVDGKTF  ALD+
Sbjct  122  FYVDCSIGVDTMRWREKVGIETFDASSVFDSIFKAPVVKSLSIILVRDVDGKTFVKALDD  181

Query  650  AIS  658
             I+
Sbjct  182  IIA  184



>ref|XP_010234161.1| PREDICTED: fatty-acid-binding protein 3 [Brachypodium distachyon]
Length=274

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +2

Query  296  AASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            AA  ++VG+A +V E  TNVKF R L+LPG    L +LGTGYREK F    VKVYAA  Y
Sbjct  63   AAGENAVGDA-FVGEGATNVKFPRELTLPGYTEPLVILGTGYREKFF----VKVYAAAFY  117

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            V+ SI    + W+ +   E  + S +F TIFKAP+ KSLSI LVRDVDGKTF  ALD+ I
Sbjct  118  VDYSIGLDTEQWKEKVGIESFDASSVFNTIFKAPVVKSLSITLVRDVDGKTFVKALDDVI  177

Query  656  S  658
            +
Sbjct  178  A  178



>gb|EEE56854.1| hypothetical protein OsJ_06472 [Oryza sativa Japonica Group]
Length=290

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 15/133 (11%)
 Frame = +2

Query  290  PRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGT----------GYREKVFA  439
            P AA   +VG+A +V E TTNVKF R +++PG    L +LGT          GYREK F 
Sbjct  67   PSAAGGGTVGDA-FVIEDTTNVKFPREIAVPGYTEPLVILGTVCNLNFSSLLGYREKFF-  124

Query  440  IIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVD  619
               +K+YAA  YV+ SI      WR +   E  + S +F++IFKAP+ KSLSI+LVRDVD
Sbjct  125  ---LKIYAAAFYVDCSIGVDTMRWREKVGIETFDASSVFDSIFKAPVVKSLSIILVRDVD  181

Query  620  GKTFWDALDEAIS  658
            GKTF  ALD+ I+
Sbjct  182  GKTFVKALDDIIA  194



>dbj|BAJ85871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            YV E  TNVKF R L++PG    L +LGTGYR+K F    VKVYAA  YV+ SI    + 
Sbjct  61   YVVEGATNVKFSRELTVPGHAEPLIILGTGYRDKFF----VKVYAAAFYVDISIGLDTEQ  116

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            WR +   +  + S  F++IFKAP+ KSLSI LVRDVDGKTF  ALD  I+
Sbjct  117  WRRKVGLDTFDASSGFDSIFKAPVVKSLSITLVRDVDGKTFVKALDAVIA  166



>ref|XP_002451868.1| hypothetical protein SORBIDRAFT_04g008910 [Sorghum bicolor]
 gb|EES04844.1| hypothetical protein SORBIDRAFT_04g008910 [Sorghum bicolor]
Length=314

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            +V E TTNVKF R L++PG    L  +GTGYR+K F    VKVYAA  YV+ S+    + 
Sbjct  114  FVTEDTTNVKFPRELTVPGYTYPLVAVGTGYRDKFF----VKVYAAAFYVDYSLRLDTEQ  169

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            W+ +   E  + S +F++IFKAP+ KSLSI+LVRDVDGKTF +AL++ I+
Sbjct  170  WKEKIGIESFDGSSVFDSIFKAPVVKSLSIILVRDVDGKTFVNALNDVIA  219



>emb|CDP12481.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 64/116 (55%), Gaps = 42/116 (36%)
 Frame = +2

Query  314  VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESIL  493
            V + EY EEP T VKF+ SLS+ GC TS+SL GTGYRE+VFAII                
Sbjct  16   VESKEYTEEPATKVKFRTSLSILGCSTSMSLTGTGYRERVFAII----------------  59

Query  494  NKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
                                      APLEKSL IVLVRDVDGKTFWDALDEAISP
Sbjct  60   --------------------------APLEKSLQIVLVRDVDGKTFWDALDEAISP  89



>gb|EMT25778.1| Chalcone--flavonone isomerase 1B-1 [Aegilops tauschii]
Length=269

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            +V E  TNVKF R L++PG    L +LGTGYR+K F    VKVYAA  YV+ SI    + 
Sbjct  68   FVVEGATNVKFSRELTVPGHKEPLIILGTGYRDKFF----VKVYAAAFYVDISIGLDTEQ  123

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            WR +   E  + S  F++IFKAP+ KSL+I LVRDVDGKTF  ALD  I+
Sbjct  124  WRKKVGLETFDASSGFDSIFKAPVVKSLNITLVRDVDGKTFVKALDGVIA  173



>gb|EMS65822.1| Chalcone--flavonone isomerase 1B-1 [Triticum urartu]
Length=244

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 4/115 (3%)
 Frame = +2

Query  314  VGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESIL  493
            V    +V E  TNVKF R L++PG    L +LGTGYR+K F    VKVYAA  YV+ SI 
Sbjct  17   VAGDAFVVEGATNVKFSRELTVPGHKEPLIILGTGYRDKFF----VKVYAAAFYVDISIG  72

Query  494  NKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
               + WR +   E  + S  F++IFKAP+ KSL+I LVRDVDG TF  ALD  I+
Sbjct  73   LDTEQWRKKVGLETFDASSGFDSIFKAPVVKSLNITLVRDVDGNTFVKALDGVIA  127



>gb|AFW71098.1| hypothetical protein ZEAMMB73_950090 [Zea mays]
Length=268

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +2

Query  296  AASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY  475
            AA   +VG+  +V E TTNV F R +++PG    L  +GTGYREK F    VKVYAA  Y
Sbjct  56   AAGGGAVGDT-FVTEDTTNVMFPREVTVPGYTHPLVAVGTGYREKFF----VKVYAAAFY  110

Query  476  VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            V+ S+    + W+ ++  E  + S +F++IFKAP+ KSLSI+LVR VDGKTF +AL++ I
Sbjct  111  VDYSLRLDTEQWKAKTGIESFDSSSVFDSIFKAPVVKSLSIILVRAVDGKTFVNALNDVI  170

Query  656  S  658
            +
Sbjct  171  A  171



>gb|AFW71097.1| hypothetical protein ZEAMMB73_950090 [Zea mays]
Length=212

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            +V E TTNV F R +++PG    L  +GTGYREK F    VKVYAA  YV+ S+    + 
Sbjct  10   FVTEDTTNVMFPREVTVPGYTHPLVAVGTGYREKFF----VKVYAAAFYVDYSLRLDTEQ  65

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            W+ ++  E  + S +F++IFKAP+ KSLSI+LVR VDGKTF +AL++ I+
Sbjct  66   WKAKTGIESFDSSSVFDSIFKAPVVKSLSIILVRAVDGKTFVNALNDVIA  115



>ref|XP_007022086.1| Chalcone-flavanone isomerase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY13611.1| Chalcone-flavanone isomerase family protein isoform 2 [Theobroma 
cacao]
Length=229

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 53/112 (47%), Gaps = 52/112 (46%)
 Frame = +2

Query  326  EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD  505
            +Y EEP T VKFQ SLSLPGC +SLSLLGT                              
Sbjct  76   DYTEEPATKVKFQTSLSLPGCSSSLSLLGT------------------------------  105

Query  506  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
                                   PLEKSL IVLVRDVDGKTFWDALDEAISP
Sbjct  106  ----------------------VPLEKSLQIVLVRDVDGKTFWDALDEAISP  135



>ref|XP_006665045.1| PREDICTED: fatty-acid-binding protein 3-like, partial [Oryza 
brachyantha]
Length=253

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = +2

Query  416  GYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLS  595
            GYREK F    +K+YAA  YV+ SI      WR +   E  + S +F++IFKAP+ KSLS
Sbjct  81   GYREKFF----LKIYAAAFYVDCSIGVDTARWREKVVIETFDASSVFDSIFKAPVVKSLS  136

Query  596  IVLVRDVDGKTFWDALDEAIS  658
            I+LVRDVDGKTF  ALD+ I+
Sbjct  137  IILVRDVDGKTFVKALDDIIT  157



>gb|AIE16842.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16843.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16844.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16845.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16848.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16851.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16854.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16855.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16857.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16858.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16861.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16862.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16864.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16865.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16866.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16867.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16868.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16871.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16873.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16874.1| chalcone isomerase, partial [Glycine max]
Length=114

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  506  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            AW+G+S   +Q +S LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISP
Sbjct  1    AWKGQSKEAIQGNSSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISP  52



>gb|AIE16850.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16853.1| chalcone isomerase, partial [Glycine soja]
Length=114

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  506  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            AW+G+S   +Q +S LFETIF++  EKSL IVLVRDVDGKTFWDAL +AISP
Sbjct  1    AWKGQSKEAIQGNSSLFETIFQSSFEKSLQIVLVRDVDGKTFWDALSDAISP  52



>gb|AIE16846.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16859.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16863.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16869.1| chalcone isomerase, partial [Glycine max]
Length=114

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  506  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            AW+G+S   +Q +S LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISP
Sbjct  1    AWKGQSKEAIQGNSSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISP  52



>gb|AIE16847.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16849.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16852.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16856.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16860.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16870.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16872.1| chalcone isomerase, partial [Glycine max]
Length=114

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  506  AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            AW+G+S   +Q +  LFETIF++  EKSL I+LVRDVDGKTFWDAL +AISP
Sbjct  1    AWKGQSKEAIQGNYSLFETIFQSSFEKSLQIILVRDVDGKTFWDALSDAISP  52



>ref|XP_002504118.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65376.1| predicted protein [Micromonas sp. RCC299]
Length=255

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 68/127 (54%), Gaps = 16/127 (13%)
 Frame = +2

Query  284  FSPRA-ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVY  460
            FS +A  ++  V  A  + EP T V F ++ + P    ++  +G G REK  AII VKVY
Sbjct  31   FSKQARVNNEIVARAFSIVEPATKVSFPKTFN-PHGGDTMQCIGAGVREKKIAIINVKVY  89

Query  461  AAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDA  640
               +YV+ +          +   EL N   L    F    +K+L + LVRDVDGKTFW+A
Sbjct  90   GVAMYVDAA----------KCKEELANGGSLLTGSF----DKALLVQLVRDVDGKTFWEA  135

Query  641  LDEAISP  661
            LDEA+ P
Sbjct  136  LDEAVGP  142



>ref|XP_010481171.1| PREDICTED: fatty-acid-binding protein 3-like [Camelina sativa]
Length=133

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +2

Query  299  ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIG  448
            +++SSVGNAE Y EE  T+VKFQRS++LPGC + LSLLGTG+REK FAIIG
Sbjct  74   SAASSVGNAEDYAEETATSVKFQRSVTLPGCSSPLSLLGTGFREKKFAIIG  124



>ref|XP_003059642.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56774.1| predicted protein [Micromonas pusilla CCMP1545]
Length=261

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 15/109 (14%)
 Frame = +2

Query  338  EPTTNVKFQRSL-SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWR  514
            EP T + F+ +L S      SL+ +G G REK  AII VKVYA  LYV+       DA +
Sbjct  46   EPATKITFEDALPSAVKDGASLTCVGAGVREKKIAIINVKVYAVALYVDA------DACK  99

Query  515  GRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
               AA     +PL         +K+L+I L RDV G+TFWDAL++A++P
Sbjct  100  ---AALTTGATPL-----DGAFDKTLAIELARDVGGETFWDALEDAVTP  140



>emb|CBJ30273.1| Chalcone Isomerase [Ectocarpus siliculosus]
Length=232

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 59/111 (53%), Gaps = 2/111 (2%)
 Frame = +2

Query  332  VEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK-LDA  508
            V E  T + F+  +SLPG   S SL+GTG R K     GVKVYA GLYV+E    K L+ 
Sbjct  33   VTERATKISFREKVSLPGGSGS-SLMGTGVRVKKIGPAGVKVYAVGLYVDEKAAAKELEV  91

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
             +G     L  +   F  + K+  EK++ + + R+V  +    AL E++ P
Sbjct  92   HKGEDGESLGKNDGFFTRVAKSNFEKTMVLKMAREVGTEKMVSALAESVKP  142



>ref|XP_011084819.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Sesamum 
indicum]
Length=213

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +2

Query  374  SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  553
            SL      LSLLG G  +     + +K  A G+Y++  I++ L  W+G+SAAEL  D   
Sbjct  17   SLVNVTKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPQIVSHLHKWKGKSAAELTQDHHF  76

Query  554  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            F+TI  AP++K + +V+++++ G  F   ++ A+
Sbjct  77   FQTIISAPVDKLVRVVVIKEIKGSQFGVQIESAV  110



>ref|XP_005855968.1| hypothetical protein NGA_0361402 [Nannochloropsis gaditana CCMP526]
 gb|EKU20377.1| hypothetical protein NGA_0361402 [Nannochloropsis gaditana CCMP526]
Length=201

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = +2

Query  338  EPTTNVKFQRSLSLPGCCTSLSLLGTGYR-EKVFAIIGVKVYAAGLYVNESI-LNKLDAW  511
            EP T +KF+ ++SLPG    LSL G G R +K+   + VKVY  GLYV++ + + KL  +
Sbjct  3    EPATKIKFEETISLPGSVAGLSLAGVGVRVKKLVGPLAVKVYGVGLYVDKGVAVRKLSKF  62

Query  512  RGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            +G  A        LF+ +     +K + + + R V   T  +AL E++ P
Sbjct  63   KGHKA----GSKALFDALETGNFDKIVLLKMARKVGAATLVNALAESVKP  108



>gb|EWM23313.1| Chalcone isomerase, subgroup [Nannochloropsis gaditana]
Length=221

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = +2

Query  338  EPTTNVKFQRSLSLPGCCTSLSLLGTGYR-EKVFAIIGVKVYAAGLYVNESI-LNKLDAW  511
            EP T +KF+ ++SLPG    LSL G G R +K+   + VKVY  GLYV++ + + KL  +
Sbjct  23   EPATKIKFEETISLPGSVAGLSLAGVGVRVKKLVGPLAVKVYGVGLYVDKGVAVRKLSKF  82

Query  512  RGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            +G  A        LF+ +     +K + + + R V   T  +AL E++ P
Sbjct  83   KGHKA----GSKALFDALETGNFDKIVLLKMARKVGAATLVNALAESVKP  128



>gb|KEH35546.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=158

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = +2

Query  368  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  538
             +S P   T+   LSLLG G  +     + VK Y+ G+Y+   ++N L  W+G+ A EL+
Sbjct  10   EISYPSKITTNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELE  69

Query  539  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++   F+ +  +P+EK++ +V+++++ G  +   ++ A+
Sbjct  70   DNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAV  108



>ref|NP_001151850.1| LOC100285485 [Zea mays]
 gb|ACG44611.1| chalcone isomerase 3 [Zea mays]
Length=251

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 62/110 (56%), Gaps = 21/110 (19%)
 Frame = +2

Query  329  YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA  508
            +V E TTNVKF R +++PG    L  +GT Y                     S+    + 
Sbjct  66   FVTEDTTNVKFPREVTVPGYTHPLVAVGTDY---------------------SLRLDTEQ  104

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            W+ ++  E  + S +F++IFKAP+ KSLSI+LVR VDGKTF +AL++ I+
Sbjct  105  WKAKTGIESFDSSSVFDSIFKAPVVKSLSIILVRAVDGKTFVNALNDVIA  154



>gb|KGN50734.1| hypothetical protein Csa_5G221960 [Cucumis sativus]
Length=242

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  E     + +K+ A G+Y+  SI+  L  W+G++A +L+ D   F+ I  AP
Sbjct  56   LSLLGHGSTEIEIHFLEIKLTAIGVYLEPSIVEHLQQWKGKAAKDLEEDDDFFQAIISAP  115

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   L+ A+
Sbjct  116  VEKVIRVVVIKEIKGSQYGVQLESAV  141



>ref|XP_004171055.1| PREDICTED: chalcone--flavonone isomerase-like [Cucumis sativus]
Length=209

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  E     + +K+ A G+Y+  SI+  L  W+G++A +L+ D   F+ I  AP
Sbjct  23   LSLLGHGSTEIEIHFLEIKLTAIGVYLEPSIVEHLQQWKGKAAKDLEEDDDFFQAIISAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   L+ A+
Sbjct  83   VEKVIRVVVIKEIKGSQYGVQLESAV  108



>gb|AFK36813.1| unknown [Medicago truncatula]
Length=209

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 58/98 (59%), Gaps = 3/98 (3%)
 Frame = +2

Query  371  LSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQN  541
            +S P   T+   LSLLG G  +     + VK Y+ G+Y+   ++N L  W+G+ A EL++
Sbjct  11   ISYPSKITTNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELED  70

Query  542  DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            +   F+ +  +P+EK++ +V+++++ G  +   ++ A+
Sbjct  71   NDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAV  108



>dbj|BAJ10401.1| enhancer of flavonoid production [Torenia hybrid cultivar]
Length=214

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  IL+ L  W+G+S  EL  D   FE I  AP
Sbjct  26   LSLLGHGITDIEIHFLQIKFTAIGIYLDLQILDHLQKWKGKSETELAQDDDFFEAIVSAP  85

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   L+ A+
Sbjct  86   VEKFIRVVVIKEIKGSQYGVQLESAV  111



>ref|XP_004146474.1| PREDICTED: chalcone--flavonone isomerase-like [Cucumis sativus]
Length=291

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  E     + +K+ A G+Y+  SI+  L  W+G++A +L+ D   F+ I  AP
Sbjct  105  LSLLGHGDTEIEIHFLEIKLTAIGVYLEPSIVEHLQQWKGKAAKDLEEDDDFFQAIISAP  164

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   L+ A+
Sbjct  165  VEKVIRVVVIKEIKGSQYGVQLESAV  190



>ref|XP_004502829.1| PREDICTED: chalcone--flavonone isomerase-like [Cicer arietinum]
Length=209

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + VK Y+ G+Y++  ++  L  W+G+ A EL+N+   F+ +  AP
Sbjct  23   LSLLGHGITDMEIHFLQVKFYSIGVYLDPEVVGHLQQWKGKPAKELENNDDFFDALISAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   ++ A+
Sbjct  83   VEKVIRLVVIKEIKGSQYGVQIETAV  108



>ref|XP_002503292.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64550.1| predicted protein [Micromonas sp. RCC299]
Length=258

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 6/114 (5%)
 Frame = +2

Query  332  VEEPTTNVKFQRSLSLPGC-CTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL--  502
            V EP T +K      + G  C  L+  G G R K  A IGVKVYA GLYVN +       
Sbjct  62   VTEPKTGLKLPGEYCVNGGKCAPLT--GMGVRIKRIAGIGVKVYACGLYVNPASARAAVG  119

Query  503  DAWRGRSAAELQNDSPLFETI-FKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            D + G+S  ++  D  LF+ +   A +EK++ +V  RD+D     DAL E + P
Sbjct  120  DRYVGKSVKDVAKDQALFDVVNAAADVEKTVRLVFARDIDSAKIRDALSERLRP  173



>gb|KEH35544.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=229

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = +2

Query  368  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  538
             +S P   T+   LSLLG G  +     + VK Y+ G+Y+   ++N L  W+G+ A EL+
Sbjct  30   EISYPSKITTNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELE  89

Query  539  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++   F+ +  +P+EK++ +V+++++ G  +   ++ A+
Sbjct  90   DNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAV  128



>gb|ACU16129.1| unknown [Glycine max]
Length=210

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     I VK Y+ G+Y+   ++  LD ++G+SA EL+++   F  +  AP
Sbjct  23   LSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQFKGKSAKELEDNEEFFNALISAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   ++ A+
Sbjct  83   MEKFIRLVVIKEIKGAQYGVQIETAV  108



>gb|AHA61355.1| chalcone isomerase [Phyllanthus emblica]
Length=209

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 3/106 (3%)
 Frame = +2

Query  347  TNVKFQRSLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  517
            T +     ++ P   T+   LSL+G G  +     + +K  A G+Y+   I+N L  W G
Sbjct  3    TEIVMVDEIAFPPQITTTKPLSLVGHGITDIEIHFLQIKFTAIGVYLEPEIVNHLQKWNG  62

Query  518  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            +S  ELQ D   F  +  AP+EK L +V+++++ G  +   L+ A+
Sbjct  63   KSGNELQEDDDFFAALIDAPVEKFLRVVVIKEIKGSQYGVQLESAV  108



>ref|XP_008456952.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Cucumis 
melo]
Length=242

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  E     + +K+ A G+Y+  S++  L  W+G++A +L  D   F+ I  AP
Sbjct  56   LSLLGHGTTEIEIHFLEIKLTAIGVYLEPSVVEHLQQWKGKAAKDLVEDDDFFQAIVSAP  115

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   L+ A+
Sbjct  116  VEKVIRVVVIKEIKGSQYGVQLESAV  141



>ref|XP_007509430.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19233.1| predicted protein [Bathycoccus prasinos]
Length=254

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 59/115 (51%), Gaps = 18/115 (16%)
 Frame = +2

Query  323  AEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILN--  496
            A  V EP T ++F      P    +L LLG G REK  AI+ VKVYA G+Y +E+ +N  
Sbjct  41   ASIVIEPQTKIQF------PETSNALKLLGVGSREKKIAILNVKVYAVGMYADETKMNSI  94

Query  497  KLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            K DA        + +D  L   +     EK + I L   V+ K F+ AL+EA+ P
Sbjct  95   KKDA--------INDDEGLL--LLNGNFEKEIVIKLNMSVNEKDFFKALEEALVP  139



>emb|CCM80406.1| chalcone isomerase 2 [Lupinus angustifolius]
Length=214

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + VK Y+ G+Y++  I+  L  W+G+SA EL+ +   F+++  AP
Sbjct  28   LSLLGHGITDMEIHFLQVKFYSIGVYLDPEIVGHLQQWKGKSAKELEENDGFFDSVIFAP  87

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   ++ A+
Sbjct  88   VEKVVRLVVIKEIKGAQYGVQIESAV  113



>ref|NP_001236782.1| chalcone isomerase 4-like [Glycine max]
 gb|AAT94362.1| putative chalcone isomerase 4 [Glycine max]
Length=209

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     I VK Y+ G+Y+   ++  LD ++G+SA EL+++   F  +  AP
Sbjct  23   LSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQFKGKSAKELEDNEEFFNALISAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   ++ A+
Sbjct  83   VEKFIRLVVIKEIKGAQYGVQIETAV  108



>gb|AFK33841.1| unknown [Medicago truncatula]
Length=209

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = +2

Query  368  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  538
             +S P   T+   L LLG G  +     + VK Y+ G+Y+   ++N L  W+G+ A EL+
Sbjct  10   EISYPSKITTNKPLFLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELE  69

Query  539  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++   F+ +  +P+EK++ +V+++++ G  +   ++ A+
Sbjct  70   DNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAV  108



>gb|AHY20030.1| chalcone isomerase [Tulipa fosteriana]
Length=207

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+ + I++ L  W+G+  +EL  D   FE I  AP
Sbjct  21   LSLLGKGLTDIEIHFLQIKFNAVGIYLEKEIIDHLGKWKGKKGSELVEDDLFFEDIVSAP  80

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  81   VEKFFRIVVIKEIKGSQYGVQLESAV  106



>ref|XP_010253088.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nelumbo 
nucifera]
Length=212

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 52/95 (55%), Gaps = 2/95 (2%)
 Frame = +2

Query  377  LPGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSP  550
            LP   TS  LSLLG G  +     + +K  A G+Y+   ++  L  W+G+S  EL  D  
Sbjct  14   LPEISTSKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVAHLQQWKGKSGNELAQDDD  73

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             FE +  AP+EK + +V+++++ G  +   ++ A+
Sbjct  74   FFEALISAPVEKIVRVVVIKEIKGSQYGVQIESAV  108



>gb|AHL83555.1| chalcone isomerase type 4 [Iris x hollandica]
Length=209

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+LLGTG  +     + +K  A G+Y+ E+++  L  W+G+   EL  D   FE I  AP
Sbjct  23   LALLGTGLTDIEVHFLQIKYNAIGIYLEEAVVEHLGDWKGKKGGELAEDDDFFEAIVSAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   +V+++++ G  +   L+  +
Sbjct  83   VEKLFRVVIIKEIKGAQYGVQLESGV  108



>gb|AGE10598.1| chalcone isomerase [Lonicera japonica]
Length=208

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I++ L  W+G++  EL  D   F+++  AP
Sbjct  22   LSLLGHGITDIEIHFLQIKFTAIGVYLDSEIVSHLQKWKGKTGTELAEDDDFFDSLISAP  81

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ A+
Sbjct  82   VDKCLRVVVIKEIKGSQYGVQLESAV  107



>emb|CDP13908.1| unnamed protein product [Coffea canephora]
Length=244

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 49/92 (53%), Gaps = 0/92 (0%)
 Frame = +2

Query  380  PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFE  559
            P     LSLLG G  +     + +K  A G+Y++  I+  L  W+G+   +L  D   FE
Sbjct  50   PSTTKPLSLLGHGITDIEIHFLQIKFTAIGVYMDSEIVTYLQQWKGKKCTDLAEDDDFFE  109

Query  560  TIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             I  AP++K L IV+++++ G  +   L+ A+
Sbjct  110  AIISAPVDKFLRIVVIKEIKGSQYGVQLESAV  141



>dbj|BAJ10402.1| enhancer of flavonoid production [Torenia hybrid cultivar]
Length=214

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSL+G G  +     + +K  A G+Y++  I++ L  W+G+S  EL  D   FE I  AP
Sbjct  26   LSLVGHGITDIEIHFLQIKFTAIGIYLDLQIVDHLQKWKGKSETELAKDDDFFEAIVSAP  85

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   +V+++++ G  +   L+ A+
Sbjct  86   VEKFFRVVVIKEIKGSQYGVQLESAV  111



>gb|AFK43525.1| unknown [Lotus japonicus]
Length=217

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +2

Query  368  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  538
             ++ P   T+   LSLLG G  + V   + VK Y  G+Y++  ++  L  W+G  A EL+
Sbjct  10   EITYPSKITTTKPLSLLGYGLNDMVIHFLQVKFYTIGVYLDPEVVGHLQQWKGTPAKELE  69

Query  539  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
                 F+ +  AP+EK++ +V+++++ G  +   ++ A+
Sbjct  70   EKDDFFDALISAPVEKAIRLVVMKEIKGAQYGVQIETAV  108



>gb|AIU39024.1| chalcone isomerase 2 [Narcissus tazetta var. chinensis]
Length=216

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L L+G+G  + V   + +K  A G+Y++++I+  L  W+GR  +EL  D   F+ +  AP
Sbjct  29   LPLVGSGITDIVIHFLQIKHNAIGIYLDDNIVEHLGNWKGRKGSELAEDDDFFDALISAP  88

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
             EK   +V+++++ G  F   L+ A+
Sbjct  89   TEKYFRVVIIKEIKGAQFGLQLESAL  114



>ref|XP_009627241.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nicotiana 
tomentosiformis]
Length=210

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSL+G G  +     + +K  A G+Y++  I+  L  W+G++ AEL  +   FE I  AP
Sbjct  24   LSLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKTGAELTENDDFFEAIVNAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ A+
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAV  109



>gb|KHN25809.1| Chalcone--flavonone isomerase [Glycine soja]
Length=251

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     I VK Y+ G+Y+   ++  LD ++G+SA EL+++   F  +  AP
Sbjct  65   LSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQFKGKSAKELEDNEEFFNALISAP  124

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   ++ A+
Sbjct  125  VEKFIRLVVIKEIKGAQYGVQIETAV  150



>emb|CCM80407.1| chalcone isomerase 1 [Lupinus angustifolius]
Length=209

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +2

Query  368  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  538
             +S P   T+   L LLG G  +     + VK Y+ G+Y++  I+  L  W+G+SA EL+
Sbjct  10   EISYPSKYTTTKPLPLLGHGITDMEIHFLQVKFYSIGVYLDPEIVGHLQQWKGKSAKELE  69

Query  539  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             +   F+ +  AP+EK + +V+++++ G  +   ++ A+
Sbjct  70   ENDEFFDALVSAPVEKVVRLVVIKEIKGAQYGVQIESAV  108



>gb|AGV53050.1| chalcone isomerase [Actinidia chinensis]
Length=210

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G++  +L  D   FE +  AP
Sbjct  24   LSLLGHGIADIEIHFLQIKFTAIGVYLDCEIVGHLQQWKGKTGKDLAEDDDFFEALVSAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V++++V G  +   L+ A+
Sbjct  84   VEKFLRVVVIKEVKGSQYGVQLESAV  109



>gb|AHL83557.1| chalcone isomerase type 4 [Iris x hollandica]
Length=209

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+LLGTG  +     + +K  A G+Y+ E+++  +  W+G+   EL  D   FE I  AP
Sbjct  23   LALLGTGLTDIEVHFLQIKYNAIGIYLEEAVVEHVGDWKGKKGGELAEDDDFFEAIVSAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   +V+++++ G  +   L+  +
Sbjct  83   VEKLFRVVIIKEIKGAQYGVQLESGV  108



>gb|AIY53017.1| chalcone isomerase [Actinidia chrysantha]
Length=210

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G++  +L  D   FE +  AP
Sbjct  24   LSLLGHGITDIEIHFLQIKFTAIGVYLDCEIVGHLQQWKGKTGKDLAEDDDFFEALVSAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+ A+
Sbjct  84   VEKFLRVVVIKEIKGSQYGVQLESAV  109



>ref|XP_008792229.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Phoenix 
dactylifera]
Length=205

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+LLG G  +     + +K  A G+Y+ + I+  L  WRG+  AEL  D+  FE +  AP
Sbjct  19   LALLGHGITDIEIHFLQIKYNAIGIYMEKHIVEHLGNWRGKKGAELAKDNLFFEALVAAP  78

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K   IV+++++ G  +   L+ A+
Sbjct  79   VDKFFRIVVIKEIKGSQYGVQLESAV  104



>ref|XP_011084820.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Sesamum 
indicum]
Length=219

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +2

Query  377  LPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLF  556
            L      LSLLG G        I +K  A G+Y++  I+  L  W+G+SAAEL  D   F
Sbjct  24   LVNITKPLSLLGHGVTAVEMLSIEIKFTAIGVYLDPQIVFHLHKWKGKSAAELTQDHHFF  83

Query  557  ETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            + I   P++K + +V+++++ G  F   ++ A+
Sbjct  84   QAIISGPVDKLVRVVVIKEIKGSQFGVQIESAV  116



>ref|XP_005837532.1| hypothetical protein GUITHDRAFT_151184, partial [Guillardia theta 
CCMP2712]
 gb|EKX50552.1| hypothetical protein GUITHDRAFT_151184, partial [Guillardia theta 
CCMP2712]
Length=198

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 65/121 (54%), Gaps = 12/121 (10%)
 Frame = +2

Query  299  ASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYV  478
            A+ +  G   +VEE  T+VKF   L +PG  +SL LLG   R K    + V+VYA G+Y 
Sbjct  3    AAVAMAGEDHFVEE-ATSVKF--PLDIPGEKSSLVLLGATVRVKKILFVNVQVYAVGVYT  59

Query  479  NESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
               ++ +L   +G+      ND  +++ + + P++ SL + +VR V G     AL EA+ 
Sbjct  60   EPGVVEEL---KGKEP----ND--MYKYLMEHPVQSSLRLTMVRSVTGDQMGGALKEAVQ  110

Query  659  P  661
            P
Sbjct  111  P  111



>gb|EYU35208.1| hypothetical protein MIMGU_mgv1a024098mg [Erythranthe guttata]
Length=365

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = +2

Query  395  SLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            +L LL  G  +     + +K  A G+Y++  I+  L  W+G+SAA+L  D   FE I  A
Sbjct  178  TLPLLANGITDIEIHFLQIKFTAIGVYLDPEIVTHLIKWKGKSAADLAKDDDFFEAIISA  237

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK + +V+++++ G  F   ++ A+
Sbjct  238  PVEKLIRVVVIKEIKGSQFGVQIESAV  264



>gb|AHZ08832.1| CHI-ACAD [Allium cepa]
Length=210

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  395  SLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            +L LLG G  +     + +K  A G+Y++E +L +L  W+G+   EL ND   F+ I  A
Sbjct  22   ALPLLGCGITDIEIHFLQIKHNAIGIYLDECVLERLSNWKGKKGNELANDDEFFDAIVSA  81

Query  575  PLEKSLSIVLVRDVDGKTF  631
             +EK + +V+++++ G  F
Sbjct  82   DVEKFIRVVIIKEIKGSQF  100



>gb|AIS35913.1| chalcone isomerase [Phalaenopsis equestris]
Length=209

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+LLG G        + +K  A G+Y+ + +   L+ W+G+  AEL++D+  F+ +  AP
Sbjct  23   LALLGQGLTSLEIHFLQIKHNAIGIYIEKDVTQHLENWKGKKRAELEDDNLFFDALVSAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ AI
Sbjct  83   VEKLFRIVVIKEIKGSQYGVQLEGAI  108



>ref|XP_010922741.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Elaeis guineensis]
Length=209

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = +2

Query  386  CCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETI  565
               SL+LLG G  +     + +K  A G+Y+ ++I+  L  W+G+  AEL  D   FE +
Sbjct  19   AAKSLALLGHGITDIEIHFLQIKYNAIGIYMEKNIIEHLGNWKGKKGAELAEDDLFFEAL  78

Query  566  FKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
              AP++K   I++++++ G  +   L+ A+
Sbjct  79   VAAPVDKFFRIMVIKEIKGSQYGVQLESAV  108



>ref|XP_009363797.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Pyrus x 
bretschneideri]
 ref|XP_009363878.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Pyrus x 
bretschneideri]
Length=209

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  553
            P   T+  LSLLG G  +     + +K  A G+Y++  I++ L  W+ + A+EL  D   
Sbjct  15   PQITTTKPLSLLGQGITDIEIHFLQIKFTAIGVYLDAEIVSHLQQWKAKKASELAEDDDF  74

Query  554  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            F+ +  AP+EK + +V+++++ G  +   L+ A+
Sbjct  75   FDALVSAPVEKFIRVVVIKEIKGSQYGVQLESAV  108



>ref|XP_009384767.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009384768.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X3 
[Musa acuminata subsp. malaccensis]
Length=209

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+ + I+  L  W+G+  +EL  D   F+ +  AP
Sbjct  23   LSLLGYGVTDIEIHFLQIKYNAIGIYMEKEIIQHLADWKGKKGSELAEDDVFFDAVVSAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  83   VEKYFRIVVIKEIKGSQYGVQLESAV  108



>ref|XP_009384766.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=211

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+ + I+  L  W+G+  +EL  D   F+ +  AP
Sbjct  25   LSLLGYGVTDIEIHFLQIKYNAIGIYMEKEIIQHLADWKGKKGSELAEDDVFFDAVVSAP  84

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  85   VEKYFRIVVIKEIKGSQYGVQLESAV  110



>ref|XP_009349075.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Pyrus x bretschneideri]
Length=242

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  553
            P   TS  LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   
Sbjct  48   PQITTSKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKAKKADELAEDDDF  107

Query  554  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            F+ +  AP+EK + +V+++++ G  +   L+ A+
Sbjct  108  FDALISAPVEKFIRVVVIKEIKGSQYGVQLESAV  141



>ref|XP_009349076.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Pyrus x bretschneideri]
Length=240

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  553
            P   TS  LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   
Sbjct  46   PQITTSKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKAKKADELAEDDDF  105

Query  554  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            F+ +  AP+EK + +V+++++ G  +   L+ A+
Sbjct  106  FDALISAPVEKFIRVVVIKEIKGSQYGVQLESAV  139



>ref|XP_006435919.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 ref|XP_006486169.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Citrus 
sinensis]
 gb|ESR49159.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
Length=209

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  553
            P   T+  L+LLG G  +     + +K  A G+Y++  IL+ L  W+G+  + L  D   
Sbjct  15   PQITTTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQQWKGKQGSSLAQDDDF  74

Query  554  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            F+ +  AP+EK L IV+++++ G  +   L+ A+
Sbjct  75   FDALVSAPVEKFLRIVVIKEIKGSQYGVQLESAV  108



>ref|XP_009804396.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nicotiana 
sylvestris]
Length=210

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSL+G G  +     + +K  A G+Y++  I+  L  W+G++  EL  +   FE I  AP
Sbjct  24   LSLMGYGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKTGTELTENDDFFEAIVNAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ A+
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAV  109



>dbj|BAJ10400.1| enhancer of flavonoid production [Petunia x hybrida]
Length=210

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L L+G G  +     + +K  A G+Y++  I+  L  W+G+S AEL  +   FE I  AP
Sbjct  24   LPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKSGAELIENDEFFEAIVNAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ A+
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAV  109



>ref|XP_010321455.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Solanum 
lycopersicum]
Length=210

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L L+G G  +     + +K  A G+Y++  I+  L  W+G++ AEL  +   FE I  AP
Sbjct  24   LPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKTGAELTENDEFFEAIVNAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ AI
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAI  109



>ref|XP_010931364.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Elaeis guineensis]
Length=209

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+LLG G  +     + +K  A G+Y+ ++I+  L +W+G+  AEL  D   FE +  AP
Sbjct  23   LALLGHGITDIEIHFLQIKYNAIGIYMEKNIVEHLGSWKGKKGAELAEDDLFFEALAAAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K   IV+++++ G  +   L+ A+
Sbjct  83   VDKFFRIVVIKEIKGSQYGVQLESAV  108



>gb|AAT94363.1| chalcone isomerase 4B [Glycine max]
Length=137

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +2

Query  368  SLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQ  538
             ++ P   T+   LSLLG G  +     I VK Y+ G+Y+   ++  L+ ++G SA EL+
Sbjct  10   EITYPSKITTTKPLSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQFKGISAKELE  69

Query  539  NDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             +   F  +  AP+EK + +V+++++ G  +   ++ A+
Sbjct  70   ENDEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAV  108



>dbj|BAO58581.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
Length=191

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSL+G G  +     + +K  A G+Y++  I++ L  W+G++  +L  D   FE I  AP
Sbjct  24   LSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ ++
Sbjct  84   VDKVLRVVVIKEIKGSQYGVQLENSV  109



>dbj|BAO58577.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58578.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58579.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58580.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
Length=206

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSL+G G  +     + +K  A G+Y++  I++ L  W+G++  +L  D   FE I  AP
Sbjct  24   LSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ ++
Sbjct  84   VDKVLRVVVIKEIKGSQYGVQLENSV  109



>dbj|BAO32071.1| chalcone isomerase Type4 [Antirrhinum majus]
Length=212

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G+ A EL  D  LF+ I  AP
Sbjct  26   LSLLGHGLTDIEIHFLQIKFTAIGVYLDPEIVAHLLKWKGKPATELAEDDDLFDAIISAP  85

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K + +V+++++ G  +   L+ A+
Sbjct  86   VDKIVRVVVIKEIKGSQYGVQLESAV  111



>gb|ACM62743.1| chalcone isomerase [Garcinia mangostana]
Length=209

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +2

Query  347  TNVKFQRSLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  517
            T V     +S P   T+   LSLLG G  +     + +K+ A G+Y+   +L+ L  W+G
Sbjct  3    TEVVMVDEVSFPPQITTTKPLSLLGHGMTDIEIHFLQIKLTAIGVYLEPEVLSHLQKWKG  62

Query  518  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            +   EL  +   F+ +  AP+EK L +V+++++ G  +   L+ ++
Sbjct  63   KPGNELAENDEFFDALIAAPVEKFLRVVIIKEIKGSQYGVQLESSV  108



>ref|XP_001420321.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98614.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=312

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 21/108 (19%)
 Frame = +2

Query  338  EPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  517
            +P T + F  + S       L++LG G R K  AII VK+YA  +YV+       DA R 
Sbjct  115  DPATKISFPDTNS-----AGLTVLGAGCRVKRVAIIDVKIYALAMYVDA------DAARA  163

Query  518  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            +    L N             +K L+I L RDVDGKTF +A+DE++ P
Sbjct  164  QKGKGLLN----------GDYDKELAIELARDVDGKTFMEAMDESLGP  201



>emb|CEF99654.1| Chalcone isomerase [Ostreococcus tauri]
Length=240

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 54/109 (50%), Gaps = 23/109 (21%)
 Frame = +2

Query  338  EPTTNVKFQRSLSLPGCCTS-LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWR  514
            +P T + F      P    S L  LG G R K  AII VKVYA  +YV+ +   K    R
Sbjct  40   DPATKISF------PDATPSGLVALGAGARVKRVAIIDVKVYALCMYVDAA---KAKDQR  90

Query  515  GRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            G+              +     +K L+I L RDVDGKTF++ALDEA+ P
Sbjct  91   GKG-------------LLAGDYDKELAIELARDVDGKTFYEALDEALKP  126



>ref|XP_001700277.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98244.1| predicted protein [Chlamydomonas reinhardtii]
Length=260

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 6/119 (5%)
 Frame = +2

Query  317  GNAEYVEEPTTNVKFQRSLS-LPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESIL  493
            G+A    EP T  +F   L  L   C SL+  G G R K   I  + VYA G+YV+ +  
Sbjct  56   GSAGGRVEPATGYEFPAELCYLKKPCPSLA--GLGVRNKKIVIKDIHVYALGIYVDAAAA  113

Query  494  -NKLDAWRGRSAAELQNDSPLFETIFKAP-LEKSLSIVL-VRDVDGKTFWDALDEAISP  661
             + L  ++ ++AAEL+ D   ++ +   P +EKSL +V+  R VD K F DAL++ ++P
Sbjct  114  KSALSGFKKKTAAELEADQSFYDAVVSTPSVEKSLRLVISSRLVDRKKFLDALEDRLAP  172



>gb|ACN40662.1| unknown [Picea sitchensis]
Length=214

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = +2

Query  356  KFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAEL  535
            +F +S++ P    +L L+G G  +     + +K  A G+Y+N  + + L  W+G+S AE+
Sbjct  12   QFPKSIT-PTASKALHLVGYGITDMEIHFLQIKFTAIGIYLNAEVASHLQGWKGKSGAEI  70

Query  536  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
              D   F+++  AP++K + +V+++++ G  +   L+ A+
Sbjct  71   LADDDFFDSLCGAPVDKFIRVVVIKELKGAQYGLQLENAV  110



>ref|XP_008369367.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Malus domestica]
 ref|XP_008369368.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Malus domestica]
Length=209

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I++ L  W+ + A EL  D   F+ +  AP
Sbjct  23   LSLLGQGITDIEIHFLQIKFTAIGVYLDAEIVSHLQQWKAKKANELAEDDDFFDALVSAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   L+ A+
Sbjct  83   VEKFIRVVVIKEIKGSQYGVQLESAV  108



>gb|KDP21650.1| hypothetical protein JCGZ_03321 [Jatropha curcas]
Length=214

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 3/106 (3%)
 Frame = +2

Query  347  TNVKFQRSLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  517
            T V     +  P   T+   LSLLG G  +     + +K  A G+Y++  I+  L  W+G
Sbjct  8    TEVVLVDEVPFPSKITTTKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPEIVGHLQQWKG  67

Query  518  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            +    L  D   FE +  AP+EK L +V+++++ G  +   L+ A+
Sbjct  68   KPGNHLAEDDDFFEALIAAPVEKFLRVVVIKEIKGSQYGVQLESAV  113



>gb|ABK23299.1| unknown [Picea sitchensis]
Length=214

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = +2

Query  356  KFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAEL  535
            +F +S++ P    +L L+G G  +     + +K  A G+Y+N  + + L  W+G+S AE+
Sbjct  12   QFPKSIA-PTASKALHLVGYGITDMEIHFLQIKFTAIGIYLNAEVASHLQGWKGKSGAEI  70

Query  536  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
              D   F+++  AP++K + +V+++++ G  +   L+ A+
Sbjct  71   LADDDFFDSLCGAPVDKFIRVVVIKELKGAQYGLQLENAV  110



>ref|XP_002520870.1| Chalcone--flavonone isomerase, putative [Ricinus communis]
 gb|EEF41579.1| Chalcone--flavonone isomerase, putative [Ricinus communis]
Length=204

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G+   +L  D   F+ +  AP
Sbjct  17   LSLLGHGITDIEIHFLQIKFTAIGVYLDPQIVGHLQQWKGKPGNQLAEDDDFFDALIAAP  76

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+ A+
Sbjct  77   VEKLLRVVVIKEIKGSQYGVQLESAV  102



>ref|XP_006577878.1| PREDICTED: chalcone isomerase 4B isoform X1 [Glycine max]
Length=209

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 55/98 (56%), Gaps = 3/98 (3%)
 Frame = +2

Query  371  LSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQN  541
            ++ P   T+   LSLLG G  +     I VK Y+ G+Y+   ++  L+ ++G SA EL+ 
Sbjct  11   ITYPSKITTTKPLSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQFKGISAKELEE  70

Query  542  DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            +   F  +  AP+EK + +V+++++ G  +   ++ A+
Sbjct  71   NDEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAV  108



>ref|XP_006365329.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Solanum 
tuberosum]
Length=210

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L L+G G  +     + +K  A G+Y++  I+  L  W+G++  EL  +   FE I  AP
Sbjct  24   LPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKTGEELTENDEFFEAIVNAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ AI
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAI  109



>ref|XP_008366803.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Malus domestica]
Length=209

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  553
            P   T+  LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   
Sbjct  15   PQITTTKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKAKKADELAEDDDF  74

Query  554  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            F+ +  AP+EK + +V+++++ G  +   L+ A+
Sbjct  75   FDALISAPVEKFIRVVVIKEIKGSQYGVQLESAV  108



>ref|XP_007218407.1| hypothetical protein PRUPE_ppa011476mg [Prunus persica]
 gb|AEJ88218.1| chalcone flavonone isomerase [Prunus persica]
 gb|EMJ19606.1| hypothetical protein PRUPE_ppa011476mg [Prunus persica]
Length=209

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (52%), Gaps = 3/106 (3%)
 Frame = +2

Query  347  TNVKFQRSLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  517
            T V     +  P   T+   LSLLG G  +     + +K  A G+Y++  +++ L  W+ 
Sbjct  3    TEVVLVDDVPFPSQITTTKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKT  62

Query  518  RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            + A EL  D   F+ +  AP+EK L +V+++++ G  +   L+ A+
Sbjct  63   KKANELAEDDDFFDALISAPVEKFLRVVVIKEIKGSQYGVQLESAV  108



>ref|XP_010103648.1| Chalcone--flavonone isomerase [Morus notabilis]
 gb|EXB96531.1| Chalcone--flavonone isomerase [Morus notabilis]
Length=229

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+LLG G  +     + +K  A G+Y++  ++N L+ W+G++  EL  D   F  +  AP
Sbjct  44   LALLGHGITDIEVHFLQIKFTAIGVYLDSVVVNHLEQWKGKTGNELAKDDDFFTALISAP  103

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + IV+++++ G  +   ++ A+
Sbjct  104  VEKLVRIVVIKEIKGAQYGVQIESAL  129



>ref|XP_007137637.1| hypothetical protein PHAVU_009G143100g [Phaseolus vulgaris]
 gb|ESW09631.1| hypothetical protein PHAVU_009G143100g [Phaseolus vulgaris]
Length=209

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     I VK Y+ G+Y    +++ L  ++G+ A EL+ +   F+ +  AP
Sbjct  23   LSLLGHGITDMEIHFIHVKFYSIGVYFEPEVVSHLQQFKGKPAKELEQNDEFFDALISAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   ++ A+
Sbjct  83   VEKFIRLVVIKEIKGAQYGVQIESAV  108



>gb|AHC07954.1| CHI [Indosasa hispida]
Length=213

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LSL+G G  +     + +K  A GLY+  +++L  L+ W+GR A EL  D   F+ +  A
Sbjct  26   LSLVGHGITDIEIHFLQIKYNAIGLYLEKDNVLEHLEDWKGRKAVELVEDDAFFQALVSA  85

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK   IV+++++ G  +   L+ ++
Sbjct  86   PVEKLFRIVVIKEIKGSQYGVQLESSV  112



>ref|NP_001242041.1| chalcone isomerase 4B [Glycine max]
 gb|ACU13171.1| unknown [Glycine max]
Length=227

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     I VK Y+ G+Y+   ++  L+ ++G SA EL+ +   F  +  AP
Sbjct  23   LSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQFKGISAKELEENDEFFNALISAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   ++ A+
Sbjct  83   VEKFIRLVVIKEIKGAQYGVQIETAV  108



>emb|CBI25366.3| unnamed protein product [Vitis vinifera]
Length=218

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L LLG G  +     + +K  A G+Y+   I+  L  W+G+S  EL  +   FE +  AP
Sbjct  32   LCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQPWKGKSGKELAENDDFFEALISAP  91

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
             EK L IV+++++ G  +   L+ A+
Sbjct  92   GEKFLRIVVIKEIKGSQYGVQLESAV  117



>ref|XP_006371287.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
 gb|ERP49084.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
Length=160

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+   I+  L  W+G+   EL  +   FE +  AP
Sbjct  24   LSLLGHGITDIEIHFLQIKFTAIGVYLEPKIVGHLQQWKGKPGNELAENDDFFEALIAAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+  +
Sbjct  84   VEKFLRVVVIKEIKGSQYGVQLESVV  109



>ref|XP_002280158.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Vitis vinifera]
Length=209

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L LLG G  +     + +K  A G+Y+   I+  L  W+G+S  EL  +   FE +  AP
Sbjct  23   LCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQPWKGKSGKELAENDDFFEALISAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
             EK L IV+++++ G  +   L+ A+
Sbjct  83   GEKFLRIVVIKEIKGSQYGVQLESAV  108



>emb|CAN70349.1| hypothetical protein VITISV_012581 [Vitis vinifera]
Length=205

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L LLG G  +     + +K  A G+Y+   I+  L  W+G+S  EL  +   FE +  AP
Sbjct  19   LCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQPWKGKSGKELAENDDFFEALISAP  78

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
             EK L IV+++++ G  +   L+ A+
Sbjct  79   GEKFLRIVVIKEIKGSQYGVQLESAV  104



>ref|XP_006435917.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 ref|XP_006435918.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 gb|ESR49157.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 gb|ESR49158.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
Length=197

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +2

Query  404  LLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLE  583
            LL TG  +     + +K  A G+Y++  IL+ L  W+G+  + L  D   F+ +  AP+E
Sbjct  13   LLATGLTDIEIHFLQIKFTAIGVYLDPEILSHLQQWKGKQGSSLAQDDDFFDALVSAPVE  72

Query  584  KSLSIVLVRDVDGKTFWDALDEAI  655
            K L IV+++++ G  +   L+ A+
Sbjct  73   KFLRIVVIKEIKGSQYGVQLESAV  96



>gb|KCW65781.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
Length=165

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G+    L  D   F+ +  AP
Sbjct  23   LSLLGHGITDMEIHFLQIKFTAIGVYLDPEIVGHLKQWKGKPGKVLAEDDDFFDAVASAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  83   VEKFFRIVVIKEIKGSQYGGLLEGAV  108



>gb|AFQ92051.1| chalcone isomerase [Pyrus pyrifolia]
Length=209

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  553
            P   T+  LSLLG G  +     + +K  A G+Y++  + + L  W+ + A EL  D   
Sbjct  15   PQITTTKLLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVASHLQQWKAKKADELAEDDDF  74

Query  554  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            F+ +  AP+EK + +V+++++ G  +   L+ A+
Sbjct  75   FDALISAPVEKFIRVVVIKEIKGSQYGVQLESAV  108



>gb|AIC33515.1| CHI [Lycium chinense]
Length=210

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L L+G G  +     + +K  A G+Y++  I++ L  W+G++ A L  +   FE I  AP
Sbjct  24   LPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVSHLQQWKGKTGAGLTENDEFFEAIVNAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K L +V+++++ G  +   L+ AI
Sbjct  84   VDKFLRVVVIKEIKGSQYGVQLESAI  109



>ref|XP_008233882.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Prunus mume]
Length=209

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPL  553
            P   T+  LSLLG G  +     + +K  A G+Y++  +++ L  W+ + A EL  D   
Sbjct  15   PQITTTKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQWKTKQANELAEDDDF  74

Query  554  FETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            F  +  AP+EK L +V+++++ G  +   L+ A+
Sbjct  75   FGALISAPVEKFLRVVVIKEIKGSQYGVQLESAV  108



>ref|XP_011001399.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Populus 
euphratica]
Length=210

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+   I+  L  W+G+   EL  +   FE +  AP
Sbjct  24   LSLLGHGITDIEIHFLQIKFTAIGVYLEPEIVGHLQQWKGKPGNELAENDDFFEALIAAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+  +
Sbjct  84   VEKFLRVVVIKEIKGSQYGVQLESVV  109



>gb|ADG27840.1| chalcone isomerase [Gossypium hirsutum]
 gb|KHG08378.1| Chalcone--flavonone isomerase [Gossypium arboreum]
Length=209

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+   ++  L  W+G+    L  D   FE +  AP
Sbjct  23   LSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQWKGKPGNVLAEDDDFFEALINAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+ A+
Sbjct  83   VEKFLRVVVIKEIKGSQYGVQLESAV  108



>gb|EEC73031.1| hypothetical protein OsI_06969 [Oryza sativa Indica Group]
Length=109

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  509  WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAIS  658
            W  +   E  + S +F +IFKAP+ KSLSI+L+RDVDGKTF  ALD+ I+
Sbjct  3    WSEKVGIETFDASSVFVSIFKAPVVKSLSIILIRDVDGKTFVKALDDIIA  52



>ref|XP_006663745.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Oryza 
brachyantha]
Length=212

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LS L  G  +     + +K  A G+Y++ ES+L  L++W+G+ A EL  D   F+ +  A
Sbjct  25   LSFLAHGVTDIEIHFLQIKYNAIGVYLDKESVLGHLESWKGKKAEELVQDDGFFQALVSA  84

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK   IV+++++ G  +   L+ ++
Sbjct  85   PVEKLFRIVVIKEIKGSQYGVQLESSV  111



>gb|KJB74930.1| hypothetical protein B456_012G014600 [Gossypium raimondii]
Length=205

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+   ++  L  W+G+    L  D   FE +  AP
Sbjct  19   LSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQWKGKPGNVLAEDDNFFEALINAP  78

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+ A+
Sbjct  79   VEKFLRVVVIKEIKGSQYGVQLESAV  104



>gb|KJB74932.1| hypothetical protein B456_012G014600 [Gossypium raimondii]
Length=209

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+   ++  L  W+G+    L  D   FE +  AP
Sbjct  23   LSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQWKGKPGNVLAEDDNFFEALINAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+ A+
Sbjct  83   VEKFLRVVVIKEIKGSQYGVQLESAV  108



>ref|XP_010252061.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nelumbo 
nucifera]
Length=209

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSL+G G  +     + +K  A G+Y++  I++ L  W+G+S  EL  +   F+ +  AP
Sbjct  23   LSLIGHGITDIEIHFLQIKFTAIGVYLDPEIVSHLQQWKGKSGNELAKNDDFFDALISAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            ++K + +V+++++ G  +   L+ A+
Sbjct  83   VDKLVRVVVIKEIKGSQYGVQLESAV  108



>ref|XP_005854048.1| chalcone isomerase-like protein [Nannochloropsis gaditana CCMP526]
 ref|XP_005855216.1| chalcone isomerase-like protein [Nannochloropsis gaditana CCMP526]
 gb|EKU21138.1| chalcone isomerase-like protein [Nannochloropsis gaditana CCMP526]
 gb|EKU22307.1| chalcone isomerase-like protein [Nannochloropsis gaditana CCMP526]
Length=235

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 60/116 (52%), Gaps = 3/116 (3%)
 Frame = +2

Query  305  SSSVGNAEYVEEPTTNV-KFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVN  481
            +  V   E V++ T  V    R L   G    L+LLG G R K   ++ V VYA GLY+ 
Sbjct  30   TCEVKGKEVVDKVTGLVFPMHRILPHGGRGRELTLLGVGPRRKNLFVVEVNVYAVGLYLE  89

Query  482  ESILNKLDAWRGRSAAELQNDSPLFETIFK--APLEKSLSIVLVRDVDGKTFWDAL  643
             S+L +L A+RG+S+  L  ++  + T+ K  + L ++L ++  R V      +AL
Sbjct  90   TSLLGRLKAFRGKSSEALAKEAKYYATLMKEGSGLNRALYLIFARTVPAGKIVEAL  145



>ref|XP_002325926.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
 gb|ABK96098.1| unknown [Populus trichocarpa]
 gb|EEF00308.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
Length=210

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+   I+  L  W+G+   EL  +   FE +  AP
Sbjct  24   LSLLGHGITDIEIHFLQIKFTAIGVYLEPKIVGHLQQWKGKPGNELAENDDFFEALIAAP  83

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+  +
Sbjct  84   VEKFLRVVVIKEIKGSQYGVQLESVV  109



>ref|XP_006842472.1| hypothetical protein AMTR_s00077p00075600 [Amborella trichopoda]
 gb|ERN04147.1| hypothetical protein AMTR_s00077p00075600 [Amborella trichopoda]
Length=216

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L LLG G  +     + +K  A G+Y++  ++N L +++G + AEL  D    + + +AP
Sbjct  30   LHLLGHGITDIEIHFLQIKFTAIGIYLDSDVVNHLQSFKGTTGAELAEDDSFSDALIQAP  89

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  90   VEKFFRIVVIKEIKGSQYGVQLESAV  115



>ref|XP_006662673.1| PREDICTED: probable chalcone--flavonone isomerase 3-like isoform 
X1 [Oryza brachyantha]
Length=212

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LS L  G  +     + +K  A G+Y++ ES+L  L++W+G+ A EL  D+  F+ +  A
Sbjct  25   LSFLAHGVTDIEIHFLQIKYNAIGVYLDKESVLGHLESWKGKKAEELVQDAGFFQALVFA  84

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK   IV+++++ G  +   L+ ++
Sbjct  85   PVEKLFRIVVIKEIKGSQYGVQLESSV  111



>ref|XP_006662674.1| PREDICTED: probable chalcone--flavonone isomerase 3-like isoform 
X2 [Oryza brachyantha]
Length=208

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LS L  G  +     + +K  A G+Y++ ES+L  L++W+G+ A EL  D+  F+ +  A
Sbjct  21   LSFLAHGVTDIEIHFLQIKYNAIGVYLDKESVLGHLESWKGKKAEELVQDAGFFQALVFA  80

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK   IV+++++ G  +   L+ ++
Sbjct  81   PVEKLFRIVVIKEIKGSQYGVQLESSV  107



>ref|NP_001065587.1| Os11g0116300 [Oryza sativa Japonica Group]
 gb|ABA91231.2| Chalcone-flavanone isomerase family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABG22338.1| Chalcone-flavanone isomerase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27432.1| Os11g0116300 [Oryza sativa Japonica Group]
 dbj|BAG87002.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LSLL  G  +     + +K  A G+Y+  +++L  L++W+G+ A EL  D   F+ +  A
Sbjct  25   LSLLANGITDIEIHFLQIKYNAIGVYLEKDNVLAHLESWKGKKAEELVQDDGFFQALVSA  84

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK L IV+++++ G  +   L+ ++
Sbjct  85   PVEKLLRIVVIKEIKGSQYGVQLESSV  111



>ref|XP_010067614.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Eucalyptus 
grandis]
 gb|KCW65777.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
 gb|KCW65778.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
Length=209

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G+    L  D   F+ +  AP
Sbjct  23   LSLLGHGITDMEIHFLQIKFTAIGVYLDPEIVGHLKQWKGKPGKVLAEDDDFFDAVASAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  83   VEKFFRIVVIKEIKGSQYGGLLEGAV  108



>ref|XP_003082012.1| mRNA splicing factor ATP-dependent RNA helicase (ISS), partial 
[Ostreococcus tauri]
Length=1680

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 54/108 (50%), Gaps = 21/108 (19%)
 Frame = +2

Query  338   EPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRG  517
             +P T + F  +       + L  LG G R K  AII VKVYA  +YV+ +   K    RG
Sbjct  1480  DPATKISFPDATP-----SGLVALGAGARVKRVAIIDVKVYALCMYVDAA---KAKDQRG  1531

Query  518   RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
             +              +     +K L+I L RDVDGKTF++ALDEA+ P
Sbjct  1532  KG-------------LLAGDYDKELAIELARDVDGKTFYEALDEALKP  1566



>gb|AGQ53961.1| chalcone isomerase, partial [Dendrobium hybrid cultivar]
Length=114

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+L+G G        + +K  A G+Y+++ +   L  W G++  EL+ D   F  +F AP
Sbjct  7    LALVGQGMTSVEIHFLEIKYNAIGIYMDKDVTEYLKNWEGKTETELEEDDLFFAALFLAP  66

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  67   VEKVFRIVVIKEIKGSQYGIQLESAV  92



>gb|KCW65779.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
Length=205

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y++  I+  L  W+G+    L  D   F+ +  AP
Sbjct  19   LSLLGHGITDMEIHFLQIKFTAIGVYLDPEIVGHLKQWKGKPGKVLAEDDDFFDAVASAP  78

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  79   VEKFFRIVVIKEIKGSQYGGLLEGAV  104



>gb|EEC67544.1| hypothetical protein OsI_34872 [Oryza sativa Indica Group]
Length=218

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LSLL  G  +     + +K  A G+Y+  +++L  L++W+G+ A EL  D   F+ +  A
Sbjct  31   LSLLANGITDIEIHFLQIKYNAIGVYLEKDNVLAHLESWKGKKAEELVQDDGFFQALVSA  90

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK L IV+++++ G  +   L+ ++
Sbjct  91   PVEKLLRIVVIKEIKGSQYGVQLESSV  117



>gb|AGY46120.1| chalcone isomerase 1 [Dendrobium hybrid cultivar]
Length=209

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+L+G G        + +K  A G+Y+++ +   L  W G+   EL+ D   F  +F AP
Sbjct  23   LALVGQGMTSVEIHFLQIKYNAIGIYMDKDVTKYLKNWEGKKGTELEEDDLFFAALFLAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  83   VEKVFRIVVIKEIKGSQYGIQLESAV  108



>gb|EEE51527.1| hypothetical protein OsJ_32725 [Oryza sativa Japonica Group]
Length=218

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LSLL  G  +     + +K  A G+Y+  +++L  L++W+G+ A EL  D   F+ +  A
Sbjct  31   LSLLANGITDIEIHFLQIKYNAIGVYLEKDNVLAHLESWKGKKAEELVQDDGFFQALVSA  90

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK L IV+++++ G  +   L+ ++
Sbjct  91   PVEKLLRIVVIKEIKGSQYGVQLESSV  117



>ref|XP_004977383.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Setaria 
italica]
Length=215

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 51/88 (58%), Gaps = 2/88 (2%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYV--NESILNKLDAWRGRSAAELQNDSPLFETIFK  571
            LSLL  G  +     + +K  A G+Y+  N ++L+ L +W+G++A EL  D   F+ +  
Sbjct  25   LSLLANGITDIEIHFLQIKYNAIGIYLHNNHALLHHLQSWKGKTADELLGDDAFFQALVS  84

Query  572  APLEKSLSIVLVRDVDGKTFWDALDEAI  655
            AP+EK   +V+++++ G  +   L+ ++
Sbjct  85   APVEKLFRVVVIKEIKGSQYGVQLESSV  112



>gb|KEH35545.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=177

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +2

Query  443  IGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDG  622
            + VK Y+ G+Y+   ++N L  W+G+ A EL+++   F+ +  +P+EK++ +V+++++ G
Sbjct  6    LQVKFYSIGVYLEPEVVNHLQQWKGKPAKELEDNDDFFDALISSPVEKAIRLVVIKEIKG  65

Query  623  KTFWDALDEAI  655
              +   ++ A+
Sbjct  66   AQYGVQIETAV  76



>gb|AGY46121.1| chalcone isomerase 2 [Dendrobium hybrid cultivar]
Length=209

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+L+G G        + +K  A G+Y+++ +   L  W G++  EL+ D   F  +F AP
Sbjct  23   LALVGQGMTSVEIHFLEIKYNAIGIYMDKDVTEYLKNWEGKTETELEEDDLFFAALFLAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK   IV+++++ G  +   L+ A+
Sbjct  83   VEKVFRIVVIKEIKGSQYGIQLESAV  108



>ref|XP_007011312.1| Chalcone-flavanone isomerase family protein [Theobroma cacao]
 gb|EOY20122.1| Chalcone-flavanone isomerase family protein [Theobroma cacao]
Length=264

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSLLG G  +     + +K  A G+Y+   +   L  W+G+    L  D   FE +  AP
Sbjct  78   LSLLGYGITDIEIHFLQIKFTAIGVYLEPEVAGHLQQWKGKPGNVLAEDDDFFEALINAP  137

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+ A+
Sbjct  138  VEKFLRVVVIKEIKGSQYGVQLESAV  163



>gb|EAY82043.1| hypothetical protein OsI_37230 [Oryza sativa Indica Group]
Length=208

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 54/101 (53%), Gaps = 4/101 (4%)
 Frame = +2

Query  365  RSLSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAE  532
              +S P   T    LSLL  G  +     + +K  A G+Y+  +++L  L++W+G+ A E
Sbjct  7    EGISFPQEITVSKPLSLLAHGITDIEIHFLQIKYNAIGVYLEKDNVLGHLESWKGKKAEE  66

Query  533  LQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            L  D   F+ +  AP+EK   IV+++++ G  +   L+ ++
Sbjct  67   LVQDDGFFQALVSAPVEKLFRIVVIKEIKGSQYGVQLESSV  107



>ref|NP_001065990.1| Os12g0115700 [Oryza sativa Japonica Group]
 gb|ABA96289.1| Chalcone-flavanone isomerase family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA96290.1| Chalcone-flavanone isomerase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29009.1| Os12g0115700 [Oryza sativa Japonica Group]
Length=212

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LSLL  G  +     + +K  A G+Y+  +++L  L++W+G+ A EL  D   F+ +  A
Sbjct  25   LSLLAHGITDIEIHFLQIKYNAIGVYLEKDNVLGHLESWKGKKAEELVQDDGFFQALVSA  84

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK   IV+++++ G  +   L+ ++
Sbjct  85   PVEKLFRIVVIKEIKGSQYGVQLESSV  111



>ref|XP_004307734.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Fragaria 
vesca subsp. vesca]
Length=212

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            L+LLG G  +     + +K  A G+Y++  I+  L  W+ +   EL  D   F+ +  AP
Sbjct  26   LALLGHGITDIEIHFLQIKFTAIGVYLDPEIVGHLQKWKTKKGTELAEDDDFFDALISAP  85

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK L +V+++++ G  +   L+ ++
Sbjct  86   VEKFLRVVVIKEIKGSQYGVQLESSV  111



>gb|EAZ19439.1| hypothetical protein OsJ_35000 [Oryza sativa Japonica Group]
Length=208

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETIFKA  574
            LSLL  G  +     + +K  A G+Y+  +++L  L++W+G+ A EL  D   F+ +  A
Sbjct  21   LSLLAHGITDIEIHFLQIKYNAIGVYLEKDNVLGHLESWKGKKAEELVQDDGFFQALVSA  80

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK   IV+++++ G  +   L+ ++
Sbjct  81   PVEKLFRIVVIKEIKGSQYGVQLESSV  107



>ref|XP_002528487.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33904.1| conserved hypothetical protein [Ricinus communis]
Length=127

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  581  EKSLSIVLVRDVDGKTFWDALDEAISP  661
            EKSL IVLVRDVDGKTFWDALD+AISP
Sbjct  7    EKSLLIVLVRDVDGKTFWDALDDAISP  33



>gb|AIC73814.1| chalcone isomerase [Hibiscus cannabinus]
Length=209

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSL G G  +     + +K  A G+Y+   ++  L  W+G+    L  D   FE +  AP
Sbjct  23   LSLFGHGITDIEIHFLQIKFTAIGVYLEPQVVGHLQQWKGKPGNVLAEDDDFFEALINAP  82

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAI  655
            +EK + +V+++++ G  +   L+ A+
Sbjct  83   VEKFVRVVVIKEIKGSQYGVQLESAV  108



>ref|XP_008809461.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Phoenix 
dactylifera]
Length=192

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +2

Query  449  VKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKT  628
            +K  A G+Y+ ++I+  L  W+G+  AEL  D   FE +  AP++K   IV+++++ G  
Sbjct  23   IKYNAIGIYMEKNIIEHLGNWKGKKGAELAEDDTFFEALVAAPVDKFFRIVVIKEIKGSQ  82

Query  629  FWDALDEAI  655
            +   L+ A+
Sbjct  83   YGVQLESAV  91



>gb|EWM21716.1| chalcone isomerase-like protein [Nannochloropsis gaditana]
Length=599

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 60/116 (52%), Gaps = 3/116 (3%)
 Frame = +2

Query  305  SSSVGNAEYVEEPTTNV-KFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVN  481
            +  V   E V++ T  V    R L   G    L+LLG G R K   ++ V VYA GLY+ 
Sbjct  394  TCEVKGKEVVDKVTGLVFPMHRILPHGGRGRELTLLGVGPRRKNLFVVEVNVYAVGLYLE  453

Query  482  ESILNKLDAWRGRSAAELQNDSPLFETIFK--APLEKSLSIVLVRDVDGKTFWDAL  643
             S+L +L A+RG+S+  L  ++  + T+ K  + L ++L ++  R V      +AL
Sbjct  454  TSLLGRLKAFRGKSSEALAKEAKYYATLMKEGSGLNRALYLIFARTVPAGKIVEAL  509



>ref|XP_003058444.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56899.1| predicted protein [Micromonas pusilla CCMP1545]
Length=171

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = +2

Query  416  GYREKVFAIIGVKVYAAGLYVN-ESILNKL-DAWRGRSAAELQNDSPLFETIFKA-PLEK  586
            G R K  A IGVKVYA GLYV+ E     L D + GR  A++  D  LF+ + ++  ++K
Sbjct  2    GVRVKRIAGIGVKVYACGLYVDPEDARAALGDRFVGRDVADVGKDQSLFDGVLRSDDVDK  61

Query  587  SLSIVLVRDVDGKTFWDALDEAISP  661
            ++ +   R++D     DAL E + P
Sbjct  62   TVRLAFARNIDSAKIRDALSERLRP  86



>ref|XP_005845734.1| hypothetical protein CHLNCDRAFT_136326 [Chlorella variabilis]
 gb|EFN53632.1| hypothetical protein CHLNCDRAFT_136326 [Chlorella variabilis]
Length=219

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 55/113 (49%), Gaps = 5/113 (4%)
 Frame = +2

Query  323  AEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL  502
            A+ ++E  T V F R          L+ LG G R K  A++  KVYA  +YV+     + 
Sbjct  2    ADIIKETVTGVAFPRKQQF-WHGGELTCLGAGARVKKVAMMTAKVYAVSMYVDADSAARA  60

Query  503  DAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP  661
            D+   R     ++++ +   +      K L + LVR + GK F DALDE++ P
Sbjct  61   DSQEKRP----ESEAAVLRALQNGAFTKVLQMHLVRSITGKQFADALDESLRP  109



>pdb|4DOK|A Chain A, Crystal Structure Of Arabidopsis Thaliana Chalcone-Isomerase 
Like Protein At5g05270 (Atchil)
 pdb|4DOK|B Chain B, Crystal Structure Of Arabidopsis Thaliana Chalcone-Isomerase 
Like Protein At5g05270 (Atchil)
Length=208

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   LD W+G++  EL  D  
Sbjct  14   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKGKTGKELAGDDD  73

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +  A +EK + +V+++++ G  +   L+  +
Sbjct  74   FFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTV  108



>ref|NP_568154.1| Chalcone-flavanone isomerase family protein [Arabidopsis thaliana]
 ref|NP_850770.1| Chalcone-flavanone isomerase family protein [Arabidopsis thaliana]
 sp|Q8VZW3.1|CFI3_ARATH RecName: Full=Probable chalcone--flavonone isomerase 3; Short=Chalcone 
isomerase 3; AltName: Full=Chalcone isomerase-like 
1 [Arabidopsis thaliana]
 gb|AAL36093.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20088.1| unknown protein [Arabidopsis thaliana]
 gb|AAM65565.1| contains similarity to chalcone-flavonone isomerase (chalcone 
isomerase) [Arabidopsis thaliana]
 gb|AED90848.1| Chalcone-flavanone isomerase family protein [Arabidopsis thaliana]
 gb|AED90849.1| Chalcone-flavanone isomerase family protein [Arabidopsis thaliana]
Length=209

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   LD W+G++  EL  D  
Sbjct  15   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKGKTGKELAGDDD  74

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +  A +EK + +V+++++ G  +   L+  +
Sbjct  75   FFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTV  109



>ref|XP_002871147.1| chalcone-flavanone isomerase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47406.1| chalcone-flavanone isomerase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=209

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   LD W+G++  EL  D  
Sbjct  15   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKGKTGQELAGDDD  74

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +  A +EK + +V+++++ G  +   L+  +
Sbjct  75   FFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTV  109



>dbj|BAB09970.1| unnamed protein product [Arabidopsis thaliana]
Length=205

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   LD W+G++  EL  D  
Sbjct  11   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKGKTGKELAGDDD  70

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +  A +EK + +V+++++ G  +   L+  +
Sbjct  71   FFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTV  105



>gb|AEO17326.1| chalcone isomerase [Arachis hypogaea]
Length=209

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = +2

Query  371  LSLPGCCTS---LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQN  541
            +S P   T+   LSLLG G ++     + VK Y  G+Y++  I+N L  W+G    EL+ 
Sbjct  11   ISYPSTITTTKPLSLLGHGIKDMEIHFLQVKFYTIGVYLDPEIVNHLTQWKGTPPKELEE  70

Query  542  DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
                F+ +  AP+EK + +V+++++ G  +   ++ A+
Sbjct  71   KEEFFDGVIAAPVEKVIRLVVIKEIKGAQYGVQIETAV  108



>ref|XP_004497328.1| PREDICTED: chalcone--flavonone isomerase 2-like [Cicer arietinum]
Length=227

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 49/101 (49%), Gaps = 1/101 (1%)
 Frame = +2

Query  350  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSA  526
            N+ F  ++  PG C +L L G G R        VK  A  +Y+  + +  L D W+G+SA
Sbjct  13   NIVFPPTVKPPGSCDTLFLGGAGVRGLQIHDKFVKFTAIAIYLQYTSIPFLADKWKGKSA  72

Query  527  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  649
             EL    P F  I   P EK + + ++  + G+ + + + E
Sbjct  73   TELTETVPFFRDIVTGPFEKFMQVTMILPLTGQQYSEKVSE  113



>ref|XP_006398990.1| hypothetical protein EUTSA_v10014675mg [Eutrema salsugineum]
 gb|ESQ40443.1| hypothetical protein EUTSA_v10014675mg [Eutrema salsugineum]
Length=205

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (55%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   L+ W+G++  +L  D  
Sbjct  11   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDHSDVKTNLENWKGKTGKDLAGDDD  70

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +  A +EK + +V+++++ G  +   L+ A+
Sbjct  71   FFDALASAEVEKVIRVVVIKEIKGSQYGVQLENAV  105



>ref|XP_006398989.1| hypothetical protein EUTSA_v10014675mg [Eutrema salsugineum]
 gb|ESQ40442.1| hypothetical protein EUTSA_v10014675mg [Eutrema salsugineum]
Length=209

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (55%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   L+ W+G++  +L  D  
Sbjct  15   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDHSDVKTNLENWKGKTGKDLAGDDD  74

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +  A +EK + +V+++++ G  +   L+ A+
Sbjct  75   FFDALASAEVEKVIRVVVIKEIKGSQYGVQLENAV  109



>gb|ABS58500.1| chalcone isomerase [Oncidium hybrid cultivar]
Length=219

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 52/96 (54%), Gaps = 10/96 (10%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK----------LDAWRGRSAAELQNDS  547
            L+L+G G        + +K+ A G+Y+++ + N           L++W+G+  AEL+ D+
Sbjct  23   LALVGQGMTSLEIHFLEIKLNAIGIYMDKDVTNHIYMDKDVTQHLESWKGKKRAELEEDN  82

Query  548  PLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
              F  +  AP+EK   IV+++++ G  +   L+ A+
Sbjct  83   LFFNALVSAPVEKVFRIVVIKEIKGSQYGVQLEGAV  118



>ref|XP_005644192.1| chalcone isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE19648.1| chalcone isomerase [Coccomyxa subellipsoidea C-169]
Length=289

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 58/125 (46%), Gaps = 4/125 (3%)
 Frame = +2

Query  293  RAASSSSVGNAEYVEEPTTNVKFQRSLSL-PGCCTSLSLLGTGYREKVFAIIGVKVYAAG  469
            R   S    +   V E +T V+F    +L  G    +  +G G R K FA + VKVYA  
Sbjct  58   RGGVSVQCSSGLVVREESTGVEFPEVTTLWEG--GKMRSMGAGVRAKKFAFVPVKVYAVT  115

Query  470  LYVNESILNKLDAWRGRSAAELQN-DSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALD  646
            +YV      +    R R      N D      +      K+L + LVR V+GK F++AL+
Sbjct  116  VYVEAEKAARELGVRQRGGFFDDNRDEDFTLALVDGAFAKALVVQLVRKVEGKQFYEALE  175

Query  647  EAISP  661
            EA++P
Sbjct  176  EALAP  180



>dbj|BAH89258.1| putative chalcone isomerase fragment [Diospyros kaki]
Length=67

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +2

Query  461  AAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTF  631
            A G+Y++  I+  L  W+G++  EL  +   FE +  AP+EK L IV+++++ G  +
Sbjct  11   AIGVYLDPQIVGHLQPWKGKTGKELAENDDFFEALISAPVEKVLRIVVIKEIKGSQY  67



>ref|XP_004978529.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Setaria 
italica]
Length=216

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYV--NESILNKLDAWRGRSAA-ELQNDSPLFETIF  568
            LSLL  G  +     + +K  A G+Y+  N+++L+ L +W+G++ A EL  D   F+ + 
Sbjct  26   LSLLANGITDIEIHFLQIKYNAIGIYLHSNDALLHHLQSWKGKTTADELLGDDAFFQALV  85

Query  569  KAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             AP+EK   +V+++++ G  +   L+ ++
Sbjct  86   SAPVEKLFRVVVIKEIKGSQYGVQLESSV  114



>ref|XP_001769093.1| predicted protein [Physcomitrella patens]
 gb|EDQ66067.1| predicted protein [Physcomitrella patens]
Length=212

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 51/102 (50%), Gaps = 1/102 (1%)
 Frame = +2

Query  353  VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAE  532
            + F    + P   T L L+G G        + ++  A G Y   SI   L  W+G++ +E
Sbjct  11   IDFATKFAPPTSSTELDLIGHGNTGMEIETVEIRFTAMGFYAEPSISEHLQKWKGKAVSE  70

Query  533  L-QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
            L ++DS   + + + P+EK++ I +++ + G  +  AL  ++
Sbjct  71   LVEDDSGFHKELIQVPVEKAVRISIIKGIKGLPYGSALQSSL  112



>ref|XP_010670602.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Beta vulgaris 
subsp. vulgaris]
Length=207

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            LSL G G  E     + +K  A G+Y+ + ++  L  W+G+S  EL +D   F+ +  AP
Sbjct  22   LSLFGYGCTELEIHYLQIKFTAIGVYLEKEVVQHLQKWKGKSGKELADDDEFFDALAAAP  81

Query  578  LEKSLSIVLVRDV  616
            +E  +  V+++++
Sbjct  82   VESVIKAVVIKEI  94



>ref|XP_010238805.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Brachypodium 
distachyon]
Length=219

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/90 (27%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +2

Query  389  CTSLSLLGTGYREKVFAIIGVKVYAAGLYVNE-SILNKLDAWRGRSAAELQNDSPLFETI  565
              +LSL+G G  +     + +K  A G+Y++E  I+  L +W+G+   ++++D+  F  +
Sbjct  29   AKTLSLVGHGVTDIEIHFLQIKFNAIGVYLDEGGIMEHLQSWKGKDQLQVEDDA-FFSAL  87

Query  566  FKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
              AP+EK L +V+++++ G  +   L+ ++
Sbjct  88   VSAPVEKVLRVVVIKEIKGSQYGVQLESSV  117



>ref|XP_009122136.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Brassica 
rapa]
Length=209

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   LD W+G++  +L  D  
Sbjct  15   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDKWKGKTGKDLAGDDD  74

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +    +EK + +V+++++ G  +   L+ ++
Sbjct  75   FFDALASGEIEKVIRVVVIKEIKGAQYGVQLENSV  109



>emb|CDX70163.1| BnaA10g25120D [Brassica napus]
Length=205

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   LD W+G++  +L  D  
Sbjct  11   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDKWKGKTGKDLAGDDD  70

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +    +EK + +V+++++ G  +   L+ ++
Sbjct  71   FFDALASGEIEKVIRVVVIKEIKGAQYGVQLENSV  105



>ref|XP_010543680.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Tarenaya 
hassleriana]
Length=209

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILN-KLDAWRGRSAAELQNDSPLFETIFKA  574
            LSL+G G  +     + VK  A G+YV+ S +   L  W+G+    L +D   F  +  A
Sbjct  23   LSLIGQGITDIEIHFLQVKFTAIGVYVDSSDVGPHLGNWKGKPGNALVDDDDFFHALVSA  82

Query  575  PLEKSLSIVLVRDVDGKTFWDALDEAI  655
            P+EK + +V+++++ G  +   ++ A+
Sbjct  83   PVEKIVRVVVIKEIKGSQYGVQMENAV  109



>dbj|BAJ95751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=217

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/90 (27%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +2

Query  389  CTSLSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLFETI  565
              +LSL+G G  +     + +K  A G+Y++ +  +  L  W+G+S  +L  D   F+ +
Sbjct  27   AKTLSLVGHGVTDIEIHFLQIKFNAVGVYLDVDGAMEHLQGWKGKS--QLMEDEAFFDAL  84

Query  566  FKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
              AP+EK L +V+++++ G  +   L+ ++
Sbjct  85   VSAPVEKVLRVVVIKEIKGSQYGVQLESSV  114



>ref|XP_001773128.1| predicted protein [Physcomitrella patens]
 gb|EDQ61981.1| predicted protein [Physcomitrella patens]
Length=209

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +2

Query  350  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAA  529
            ++ F    + P   T L L+G G        + ++  A G Y   SI   L  W+G  ++
Sbjct  10   DIDFATKFTPPTGSTELDLIGYGNTGMEIETVEIRFTAIGFYAEPSISEHLQKWKGTPSS  69

Query  530  EL-QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             L ++DS   + + +AP+EK++ I +++ + G  +  AL  ++
Sbjct  70   NLVEDDSGFHKELIQAPVEKAVRISIIKGIKGLPYGSALQSSL  112



>emb|CDX98830.1| BnaC09g50050D [Brassica napus]
Length=205

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (53%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS   SLLG G  +     + VK  A G+Y++ S +   LD W+G++  +L  D  
Sbjct  11   PQIITSKPFSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDKWKGKTGKDLAGDDD  70

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +    +EK + +V+++++ G  +   L+ ++
Sbjct  71   FFDALASGEIEKVIRVVVIKEIKGAQYGVQLENSV  105



>ref|XP_005845646.1| hypothetical protein CHLNCDRAFT_136673 [Chlorella variabilis]
 gb|EFN53544.1| hypothetical protein CHLNCDRAFT_136673 [Chlorella variabilis]
Length=288

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +2

Query  398  LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP  577
            +  +G G R K  A IGVKVYA  LYV    + +    R R      +D    + +    
Sbjct  93   MRCVGAGCRSKKVAFIGVKVYAVALYVEAEKMARELGVRNRGGFFDGDDDFC-QALVDGG  151

Query  578  LEKSLSIVLVRDVDGKTFWDALDEAISP  661
              K+L + L RDV+G  F  AL+EA++P
Sbjct  152  CVKALQLELARDVEGAQFVQALEEALAP  179



>ref|XP_006288659.1| hypothetical protein CARUB_v10001966mg [Capsella rubella]
 gb|EOA21557.1| hypothetical protein CARUB_v10001966mg [Capsella rubella]
Length=209

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +2

Query  380  PGCCTS--LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSP  550
            P   TS  LSLLG G  +     + VK  A G+Y++ S +   L  W+G+++ +L  D  
Sbjct  15   PQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLVNWKGKTSEDLAGDDD  74

Query  551  LFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI  655
             F+ +    +EK + +V+++++ G  +   L+ A+
Sbjct  75   FFDALASGEMEKVIRVVVIKEIKGAQYGVQLENAV  109



>emb|CBJ33403.1| Similar to Chalcone Isomerase [Ectocarpus siliculosus]
Length=229

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 45/106 (42%), Gaps = 2/106 (2%)
 Frame = +2

Query  332  VEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNK-LDA  508
            V +P T +   R+       T L  LG G R K  A + V VY  GLYV      K L +
Sbjct  33   VRDPATGLVLPRTKQFASSKTGLVCLGVGVRVKSVAFVNVNVYTVGLYVEPKGARKALKS  92

Query  509  WRGRSAAELQNDSPLFETIFKA-PLEKSLSIVLVRDVDGKTFWDAL  643
            + GR   EL  D  ++  +  A    K L +V  R V  +   DA 
Sbjct  93   YAGRDPEELSKDKSVYRVLGGAGDFSKYLHLVFARSVGAQKVVDAF  138



>gb|ACN60401.1| chalcone isomerase, partial [Capsicum annuum]
Length=226

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +2

Query  380  PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAELQNDSPLF  556
            PG  T+L L G G R        VK  A G+Y+ ES +  L A W+G+S+ EL +    F
Sbjct  16   PGSNTTLFLAGAGIRGVDIEGKFVKCTAIGVYMEESAVPFLAAKWKGKSSKELTDSVEFF  75

Query  557  ETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  649
              I   P EK   + ++  + GK + + + E
Sbjct  76   RDIVTGPFEKFFRVTMITPLTGKQYSEKVAE  106



>sp|Q3Y4F4.1|CFI_CANGE RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Canna x generalis]
 gb|AAZ80910.1| chalcone isomerase [Canna x generalis]
Length=226

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 51/101 (50%), Gaps = 1/101 (1%)
 Frame = +2

Query  350  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD-AWRGRSA  526
             V F  + + PG  +SL L G G R        V   A G+Y+ +  ++ L   W+G++A
Sbjct  15   EVTFPPAAAPPGSSSSLFLAGAGERGLEIDRQFVVFTAIGVYLEDLAVSTLGPKWKGKTA  74

Query  527  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  649
             +L  +S  F  IF  P EK   I +V+ + G+ + + ++E
Sbjct  75   DDLAGNSDFFRDIFTGPFEKFTRITMVKPLSGQQYSEKVEE  115



>gb|ACP30360.1| chalcone isomerase protein [Malus hybrid cultivar]
Length=219

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 48/98 (49%), Gaps = 1/98 (1%)
 Frame = +2

Query  359  FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL  535
            F  S+  PG   +L L G G R        VKV A G+Y+ +S +  L   W+G++A EL
Sbjct  17   FPPSVKPPGSSNTLFLGGAGMRGLEIQGNFVKVTAIGVYLEDSAVPLLAVKWKGKTAEEL  76

Query  536  QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  649
                  F  I   P EK + ++++  + G+ + + + E
Sbjct  77   SESVEFFRDIVTGPFEKFIQVIMILPLTGQQYSEKVSE  114



>ref|XP_002993360.1| hypothetical protein SELMODRAFT_136990 [Selaginella moellendorffii]
 gb|EFJ05545.1| hypothetical protein SELMODRAFT_136990 [Selaginella moellendorffii]
Length=169

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 38/86 (44%), Gaps = 8/86 (9%)
 Frame = +2

Query  404  LLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLE  583
            LL  G REK  A + VK YA G Y N+  L   + W      E    +      F    E
Sbjct  2    LLNAGVREKKIAFVAVKAYAVGFYANKEQLP--NDWDKNFLVEAHTQT------FAGAFE  53

Query  584  KSLSIVLVRDVDGKTFWDALDEAISP  661
            K L + L RDV G  F  AL++ + P
Sbjct  54   KGLVVKLARDVSGALFSSALNDELKP  79



>gb|AAZ80911.1| chalcone isomerase [Canna x generalis]
Length=226

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 51/101 (50%), Gaps = 1/101 (1%)
 Frame = +2

Query  350  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD-AWRGRSA  526
             V F  + + PG  +SL L G G R        V   A G+Y+ +  ++ L   W+G++A
Sbjct  15   EVTFPPAAAPPGSSSSLFLAGAGERGLEIDRQFVVFTAIGVYLEDLAVSTLAPKWKGKTA  74

Query  527  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  649
             +L  +S  F  IF  P EK   I +V+ + G+ + + ++E
Sbjct  75   DDLAGNSDFFRDIFTGPFEKFTRITMVKPLSGQQYSEKVEE  115



>ref|XP_011027080.1| PREDICTED: chalcone--flavonone isomerase-like [Populus euphratica]
Length=223

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 49/101 (49%), Gaps = 1/101 (1%)
 Frame = +2

Query  350  NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA  526
            NV F  ++  P    +L L G G R        +K  A G+Y+ ++ L  L A W+G+SA
Sbjct  14   NVTFPPAVKPPASNNTLFLGGAGVRGLEIEGKFIKFTAIGVYLEDNSLQSLAAKWKGKSA  73

Query  527  AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE  649
             EL +    F  I + P EK + + ++  + G  F + + E
Sbjct  74   QELTDSVEFFRDIVRGPFEKFMRVTMILPLTGLQFSEKVAE  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320