BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040I04

Length=711
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU41710.1|  hypothetical protein MIMGU_mgv1a022248mg                401   9e-137   Erythranthe guttata [common monkey flower]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     408   8e-136   Sesamum indicum [beniseed]
gb|AFV46216.1|  hypothetical protein                                    392   2e-135   Scutellaria baicalensis [Baikal skullcap]
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    406   5e-135   Sesamum indicum [beniseed]
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    406   7e-135   Tarenaya hassleriana [spider flower]
ref|XP_002532297.1|  heat shock protein, putative                       406   8e-135   Ricinus communis
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     405   2e-134   Cucumis melo [Oriental melon]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    404   3e-134   Tarenaya hassleriana [spider flower]
ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2          397   5e-134   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    403   7e-134   Solanum tuberosum [potatoes]
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    403   7e-134   
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         402   8e-134   Jatropha curcas
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     403   1e-133   
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    403   1e-133   Solanum tuberosum [potatoes]
gb|AFU34347.1|  70-kDa heat shock protein                               403   1e-133   Ipomoea batatas [batate]
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        402   1e-133   Morus notabilis
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    402   2e-133   Solanum lycopersicum
gb|AAR17080.1|  heat shock protein 70-3                                 402   2e-133   Nicotiana tabacum [American tobacco]
ref|XP_002527736.1|  heat shock protein, putative                       402   2e-133   Ricinus communis
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    402   2e-133   Solanum tuberosum [potatoes]
emb|CDP09040.1|  unnamed protein product                                402   2e-133   Coffea canephora [robusta coffee]
gb|KJB46580.1|  hypothetical protein B456_007G375600                    402   2e-133   Gossypium raimondii
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     402   2e-133   Nicotiana sylvestris
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     402   2e-133   Nicotiana tomentosiformis
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    402   2e-133   Nicotiana tomentosiformis
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    401   3e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    402   3e-133   Nicotiana sylvestris
gb|KJB16980.1|  hypothetical protein B456_002G258500                    400   3e-133   Gossypium raimondii
gb|AFA51946.1|  heat shock protein 70                                   402   3e-133   Paeonia suffruticosa [moutan peony]
gb|AEK70336.1|  heat shock protein 70                                   402   3e-133   Paeonia lactiflora [common garden peony]
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    402   4e-133   Nicotiana tomentosiformis
emb|CCA29121.1|  heat shock protein 70 isoform 2                        401   4e-133   Solanum lycopersicum
ref|NP_001068540.1|  Os11g0703900                                       401   4e-133   
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                401   4e-133   Erythranthe guttata [common monkey flower]
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         401   5e-133   Jatropha curcas
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    401   6e-133   Nicotiana sylvestris
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     401   6e-133   
gb|ABP35942.1|  heat shock protein 70                                   400   8e-133   Cyclamen persicum
gb|AGR45355.1|  HSP70                                                   400   8e-133   Dendrobium officinale
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    400   1e-132   Glycine max [soybeans]
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         400   1e-132   Jatropha curcas
gb|EAY81899.1|  hypothetical protein OsI_37065                          393   1e-132   Oryza sativa Indica Group [Indian rice]
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    400   1e-132   Solanum lycopersicum
gb|KJB16979.1|  hypothetical protein B456_002G258500                    400   1e-132   Gossypium raimondii
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    400   1e-132   Sesamum indicum [beniseed]
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    400   1e-132   Oryza brachyantha
gb|ACJ11741.1|  heat shock protein 70                                   400   2e-132   Gossypium hirsutum [American cotton]
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    400   2e-132   Tarenaya hassleriana [spider flower]
gb|AIZ68155.1|  heat shock protein 70                                   400   2e-132   Ornithogalum longebracteatum [sea-onion]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    399   2e-132   Solanum lycopersicum
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     399   3e-132   Glycine soja [wild soybean]
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    399   3e-132   
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     399   3e-132   Elaeis guineensis
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     399   3e-132   Prunus mume [ume]
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    399   4e-132   Cucumis sativus [cucumbers]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    399   4e-132   Glycine max [soybeans]
emb|CAB72130.1|  heat shock protein 70                                  399   4e-132   Cucumis sativus [cucumbers]
gb|AGL07711.1|  heat shock protein 70                                   399   4e-132   Ziziphus jujuba [Chinese jujube]
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     399   4e-132   Glycine soja [wild soybean]
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     399   4e-132   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36734.1|  hypothetical protein B456_006G174000                    399   5e-132   Gossypium raimondii
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          399   5e-132   Amborella trichopoda
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    399   5e-132   Oryza brachyantha
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    397   5e-132   Nelumbo nucifera [Indian lotus]
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    399   6e-132   Cicer arietinum [garbanzo]
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        398   6e-132   Morus notabilis
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     398   6e-132   Eucalyptus grandis [rose gum]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     398   6e-132   
gb|ACJ11740.1|  heat shock protein 70                                   398   6e-132   Gossypium hirsutum [American cotton]
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       398   7e-132   Cucurbita maxima [Boston marrow]
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             398   7e-132   Citrus clementina [clementine]
dbj|BAJ34054.1|  unnamed protein product                                398   7e-132   Eutrema halophilum
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             398   7e-132   Eutrema salsugineum [saltwater cress]
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             398   8e-132   Phaseolus vulgaris [French bean]
ref|XP_007009369.1|  Heat shock protein 70                              398   9e-132   
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     398   9e-132   Nelumbo nucifera [Indian lotus]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    398   9e-132   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           398   1e-131   Cucurbita maxima [Boston marrow]
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     398   1e-131   Vitis vinifera
gb|ADD71975.1|  heat shock protein 70                                   398   1e-131   Rhododendron calophytum
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    398   1e-131   Arabis alpina [alpine rockcress]
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    398   1e-131   Arabis alpina [alpine rockcress]
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    397   1e-131   Zea mays [maize]
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             397   1e-131   Eutrema salsugineum [saltwater cress]
gb|EEC76425.1|  hypothetical protein OsI_14101                          390   1e-131   Oryza sativa Indica Group [Indian rice]
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    393   1e-131   
gb|KDO72893.1|  hypothetical protein CISIN_1g036208mg                   384   2e-131   Citrus sinensis [apfelsine]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    399   2e-131   
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    397   2e-131   Nelumbo nucifera [Indian lotus]
gb|KJB55903.1|  hypothetical protein B456_009G100400                    397   2e-131   Gossypium raimondii
gb|AAS09825.1|  heat shock cognate protein 70                           397   2e-131   Eutrema halophilum
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     396   2e-131   Eucalyptus grandis [rose gum]
ref|XP_002312089.1|  heat shock protein 70 cognate                      397   2e-131   
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             397   2e-131   Prunus persica
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    397   2e-131   Brassica rapa
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     396   2e-131   Eucalyptus grandis [rose gum]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    397   3e-131   Eucalyptus grandis [rose gum]
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    397   3e-131   Nicotiana tomentosiformis
gb|ACM42161.1|  heat shock protein 70.58                                396   3e-131   Ageratina adenophora
ref|WP_039310754.1|  molecular chaperone DnaK                           397   3e-131   Paenibacillus sp. IHB B 3415
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     399   3e-131   Eucalyptus grandis [rose gum]
ref|NP_001051724.1|  Os03g0821100                                       397   3e-131   
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     397   3e-131   Vigna radiata [mung bean]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     399   4e-131   Eucalyptus grandis [rose gum]
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       396   4e-131   Cucumis melo [Oriental melon]
gb|EPS60056.1|  heat shock protein 70                                   396   4e-131   Genlisea aurea
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    396   4e-131   Populus euphratica
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    396   5e-131   Solanum tuberosum [potatoes]
ref|XP_002311161.1|  heat shock protein 70                              396   6e-131   Populus trichocarpa [western balsam poplar]
gb|ACJ11742.1|  heat shock protein 70                                   395   7e-131   Gossypium hirsutum [American cotton]
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     395   7e-131   Vitis vinifera
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    395   7e-131   Tarenaya hassleriana [spider flower]
gb|AIA22210.1|  heat shock protein 70                                   395   7e-131   Chrysanthemum indicum
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          395   8e-131   
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    391   8e-131   Populus euphratica
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    395   8e-131   Petunia x hybrida [garden petunia]
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     395   9e-131   
gb|AAP04522.1|  heat shock protein 70                                   395   9e-131   Nicotiana tabacum [American tobacco]
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    395   1e-130   Phoenix dactylifera
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     395   1e-130   Vigna radiata [mung bean]
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          395   1e-130   Sorghum bicolor [broomcorn]
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    395   1e-130   Setaria italica
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       395   1e-130   Glycine soja [wild soybean]
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             395   1e-130   Citrus clementina [clementine]
ref|NP_001183165.1|  uncharacterized protein LOC100501536               395   1e-130   Zea mays [maize]
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          395   2e-130   Sorghum bicolor [broomcorn]
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             395   2e-130   Capsella rubella
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    395   2e-130   Populus euphratica
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    395   2e-130   Setaria italica
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     394   2e-130   Glycine max [soybeans]
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     394   2e-130   Vitis vinifera
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    394   2e-130   Setaria italica
gb|AAA86903.1|  heat shock protein cognate 70                           379   2e-130   Sorghum bicolor [broomcorn]
gb|ACD93209.1|  heat shock protein 70                                   395   2e-130   Camellia sinensis [black tea]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             394   2e-130   Phaseolus vulgaris [French bean]
gb|ACJ11745.1|  heat shock protein 70                                   394   2e-130   Gossypium hirsutum [American cotton]
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    394   3e-130   Brassica rapa
emb|CCA29120.1|  heat shock protein 70 isoform 1                        394   3e-130   Solanum lycopersicum
gb|AIU34470.1|  putative heat shock protein                             394   3e-130   Taraxacum brevicorniculatum
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    394   3e-130   
emb|CAA47948.2|  heat shock protein 70                                  394   3e-130   Oryza sativa Indica Group [Indian rice]
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     394   3e-130   Populus euphratica
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     394   4e-130   
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    389   4e-130   Brassica rapa
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             394   4e-130   Phaseolus vulgaris [French bean]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    394   5e-130   Cicer arietinum [garbanzo]
gb|AAB88009.1|  heat shock cognate protein HSC70                        393   5e-130   Brassica napus [oilseed rape]
emb|CDP09035.1|  unnamed protein product                                393   6e-130   Coffea canephora [robusta coffee]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    393   6e-130   Elaeis guineensis
dbj|BAP90755.1|  heat shock protein 70                                  393   6e-130   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    393   6e-130   Brassica rapa
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             393   7e-130   Populus trichocarpa [western balsam poplar]
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       393   7e-130   Cucurbita maxima [Boston marrow]
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                393   7e-130   
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    393   8e-130   Tarenaya hassleriana [spider flower]
ref|XP_001767839.1|  predicted protein                                  393   9e-130   
ref|XP_003621869.1|  Heat shock protein                                 393   9e-130   Medicago truncatula
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    393   1e-129   Prunus mume [ume]
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     392   1e-129   Phoenix dactylifera
gb|ACR38891.1|  heat shock protein 70                                   392   1e-129   Apopellia endiviifolia (species B)
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    392   1e-129   Fragaria vesca subsp. vesca
ref|XP_001751923.1|  predicted protein                                  392   1e-129   
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    392   1e-129   
gb|KCW74480.1|  hypothetical protein EUGRSUZ_E03189                     388   1e-129   Eucalyptus grandis [rose gum]
gb|AAB97316.1|  cytosolic heat shock 70 protein                         392   1e-129   Spinacia oleracea
ref|XP_006378714.1|  heat shock protein 70 cognate                      392   2e-129   Populus trichocarpa [western balsam poplar]
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    392   2e-129   Populus euphratica
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    388   2e-129   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             392   2e-129   Prunus persica
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          392   2e-129   Zea mays [maize]
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    392   2e-129   
ref|XP_002312090.1|  heat shock protein 70 cognate                      392   2e-129   Populus trichocarpa [western balsam poplar]
ref|NP_001055754.1|  Os05g0460000                                       392   2e-129   
ref|NP_001119156.1|  heat shock cognate protein 70-1                    387   2e-129   Arabidopsis thaliana [mouse-ear cress]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       389   2e-129   Medicago truncatula
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    392   3e-129   Cicer arietinum [garbanzo]
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    392   3e-129   Populus euphratica
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    391   3e-129   Prunus mume [ume]
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    391   3e-129   Phoenix dactylifera
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    391   3e-129   
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    391   4e-129   Pyrus x bretschneideri [bai li]
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       391   5e-129   Brachypodium distachyon [annual false brome]
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         391   5e-129   Jatropha curcas
gb|EPS68565.1|  hypothetical protein M569_06198                         391   5e-129   Genlisea aurea
ref|XP_001759874.1|  predicted protein                                  391   5e-129   
ref|NP_176036.1|  heat shock protein ERD2                               390   5e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     391   6e-129   Fragaria vesca subsp. vesca
ref|XP_002316294.1|  heat shock protein 70                              391   6e-129   Populus trichocarpa [western balsam poplar]
gb|ABX76301.1|  heat shock protein 70                                   391   6e-129   Ageratina adenophora
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    391   6e-129   
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    391   6e-129   Solanum lycopersicum
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    390   6e-129   Solanum lycopersicum
emb|CAB72129.1|  heat shock protein 70                                  391   6e-129   Cucumis sativus [cucumbers]
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    390   7e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     390   8e-129   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                390   8e-129   Erythranthe guttata [common monkey flower]
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       390   9e-129   Nicotiana tomentosiformis
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       390   1e-128   Medicago truncatula
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       390   1e-128   Phaseolus vulgaris [French bean]
ref|XP_002528432.1|  heat shock protein, putative                       390   1e-128   Ricinus communis
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    390   1e-128   
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    390   1e-128   Brachypodium distachyon [annual false brome]
ref|NP_001044757.1|  Os01g0840100                                       390   1e-128   
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             389   1e-128   
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       390   1e-128   Medicago truncatula
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       390   2e-128   Solanum lycopersicum
gb|AAB42159.1|  Hsc70                                                   390   2e-128   Solanum lycopersicum
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     392   2e-128   Glycine soja [wild soybean]
gb|AAV97978.1|  heat shock protein hsp70                                389   2e-128   Saussurea medusa
gb|ACB70177.1|  70 kDa heat shock protein                               389   2e-128   Capparis spinosa [caper]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    389   2e-128   Nicotiana tomentosiformis
ref|XP_002891955.1|  early-responsive to dehydration 2                  388   2e-128   
gb|AAA62445.1|  heat shock protein                                      389   2e-128   Spinacia oleracea
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    389   2e-128   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       389   2e-128   Nicotiana sylvestris
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    389   2e-128   Solanum tuberosum [potatoes]
ref|XP_003621886.1|  Heat shock protein                                 389   2e-128   Medicago truncatula
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    389   3e-128   Phoenix dactylifera
gb|ADZ46371.1|  HSP70                                                   389   3e-128   Malus hupehensis
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    389   3e-128   Solanum tuberosum [potatoes]
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       389   3e-128   
gb|ACJ85522.1|  unknown                                                 389   3e-128   Medicago truncatula
dbj|BAK00257.1|  predicted protein                                      389   3e-128   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001783048.1|  predicted protein                                  389   4e-128   
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    389   4e-128   Tarenaya hassleriana [spider flower]
emb|CDP00073.1|  unnamed protein product                                388   4e-128   Coffea canephora [robusta coffee]
gb|AAB99745.1|  HSP70                                                   389   4e-128   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    388   5e-128   Populus euphratica
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                389   5e-128   Erythranthe guttata [common monkey flower]
emb|CCD74508.1|  early-responsive to dehydration 2                      387   5e-128   Arabidopsis halleri subsp. halleri
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    388   5e-128   Camelina sativa [gold-of-pleasure]
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    378   6e-128   Arabis alpina [alpine rockcress]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    388   6e-128   Solanum tuberosum [potatoes]
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       387   6e-128   Triticum urartu
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             388   7e-128   Capsella rubella
ref|XP_002873056.1|  HSC70-1                                            388   7e-128   Arabidopsis lyrata subsp. lyrata
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    388   7e-128   Camelina sativa [gold-of-pleasure]
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     387   1e-127   Triticum urartu
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    387   1e-127   Pyrus x bretschneideri [bai li]
gb|AIU40169.1|  heat shock protein 70                                   387   1e-127   Saccharum arundinaceum
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    387   1e-127   Nicotiana sylvestris
ref|NP_195870.1|  heat shock cognate protein 70-1                       387   2e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AAM48131.1|AF509336_1  heat shock protein 70                         387   2e-127   Saussurea medusa
ref|XP_001785822.1|  predicted protein                                  387   2e-127   
gb|ABD32895.1|  Heat shock protein Hsp70                                387   2e-127   Medicago truncatula
gb|AAV98051.1|  heat shock protein 70                                   387   2e-127   Medicago sativa [alfalfa]
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    387   2e-127   Cucumis melo [Oriental melon]
gb|ACD45076.1|  heat-shock protein 70                                   387   2e-127   Dactylis glomerata [cocksfoot]
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    387   2e-127   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     386   3e-127   
dbj|BAJ91305.1|  predicted protein                                      386   3e-127   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    386   3e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             386   3e-127   Citrus clementina [clementine]
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        386   3e-127   Camelina sativa [gold-of-pleasure]
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             385   3e-127   Phaseolus vulgaris [French bean]
gb|KJB73858.1|  hypothetical protein B456_011G256600                    386   4e-127   Gossypium raimondii
emb|CAA52684.1|  heat shock protein 70 cognate                          386   4e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187555.1|  heat shock protein 70-3                               386   4e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             386   5e-127   Citrus clementina [clementine]
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    386   5e-127   Phoenix dactylifera
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    387   5e-127   
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    386   5e-127   Citrus sinensis [apfelsine]
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        385   5e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  385   7e-127   Morus notabilis
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     385   7e-127   Petunia x hybrida [garden petunia]
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          385   7e-127   Sorghum bicolor [broomcorn]
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             385   7e-127   Phaseolus vulgaris [French bean]
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     385   8e-127   Triticum urartu
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    385   8e-127   Elaeis guineensis
emb|CDY50531.1|  BnaA01g30490D                                          385   8e-127   Brassica napus [oilseed rape]
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    383   1e-126   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     385   1e-126   Brachypodium distachyon [annual false brome]
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    385   1e-126   Brassica rapa
ref|NP_001049712.1|  Os03g0276500                                       385   1e-126   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                385   1e-126   Erythranthe guttata [common monkey flower]
emb|CDY00784.1|  BnaC03g37680D                                          385   1e-126   
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    385   1e-126   
emb|CDX73815.1|  BnaA03g32320D                                          385   1e-126   
ref|XP_002873055.1|  predicted protein                                  385   1e-126   Arabidopsis lyrata subsp. lyrata
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    385   1e-126   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    385   1e-126   
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    385   1e-126   
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    384   2e-126   
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    384   2e-126   
gb|EPS64948.1|  hypothetical protein M569_09829                         384   2e-126   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    384   2e-126   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             384   2e-126   
dbj|BAK07857.1|  predicted protein                                      388   2e-126   
ref|NP_195869.1|  heat shock protein 70                                 384   3e-126   
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    384   3e-126   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    384   3e-126   
ref|XP_003625487.1|  Heat shock protein                                 385   4e-126   
gb|EAY89450.1|  hypothetical protein OsI_10982                          377   4e-126   
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       383   5e-126   
emb|CDY52661.1|  BnaC01g38510D                                          383   6e-126   
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    383   7e-126   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    401   7e-126   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    383   8e-126   
ref|NP_187864.1|  heat shock protein 70-4                               383   8e-126   
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    382   9e-126   
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     386   9e-126   
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    382   1e-125   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    382   2e-125   
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    382   2e-125   
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    382   2e-125   
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    382   2e-125   
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    382   2e-125   
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             382   2e-125   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    382   2e-125   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    381   3e-125   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    381   3e-125   
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             381   4e-125   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    381   4e-125   
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    381   4e-125   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    381   4e-125   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    380   7e-125   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    379   8e-125   
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    380   1e-124   
dbj|BAK02194.1|  predicted protein                                      380   1e-124   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       379   1e-124   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       380   1e-124   
emb|CAA83548.1|  PsHSC71.0                                              379   2e-124   
gb|ABR18415.1|  unknown                                                 379   2e-124   
gb|ACV52590.1|  heat shock protein 70-like protein                      363   2e-124   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       379   2e-124   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       380   3e-124   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    379   3e-124   
gb|KJB20110.1|  hypothetical protein B456_003G133400                    378   4e-124   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    378   4e-124   
dbj|BAJ86014.1|  predicted protein                                      378   4e-124   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    378   7e-124   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    388   8e-124   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          377   1e-123   
gb|EEC71767.1|  hypothetical protein OsI_04375                          370   1e-123   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    377   1e-123   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    377   1e-123   
emb|CAA05547.1|  heat shock protein 70                                  377   2e-123   
ref|XP_001767221.1|  predicted protein                                  377   2e-123   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    377   2e-123   
gb|ACJ54890.1|  heat shock protein 70                                   376   4e-123   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                376   4e-123   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    376   4e-123   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          375   5e-123   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    379   6e-123   
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             375   7e-123   
ref|XP_008458071.1|  PREDICTED: heat shock cognate 70 kDa protein...    359   8e-123   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    382   9e-123   
gb|EAY98319.1|  hypothetical protein OsI_20227                          367   9e-123   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             375   9e-123   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    374   1e-122   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                374   2e-122   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    374   2e-122   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    373   3e-122   
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             373   4e-122   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               373   5e-122   
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     372   1e-121   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    372   1e-121   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             371   3e-121   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               371   4e-121   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             370   5e-121   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    369   6e-121   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             370   6e-121   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       370   6e-121   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             370   8e-121   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               370   1e-120   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    369   2e-120   
ref|XP_001781229.1|  predicted protein                                  369   2e-120   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             369   2e-120   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             369   2e-120   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    369   2e-120   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         369   2e-120   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          369   4e-120   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     384   5e-120   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        367   6e-120   
ref|XP_006368489.1|  heat shock protein 70 cognate                      367   1e-119   
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like          367   2e-119   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          366   2e-119   
gb|ACC93947.1|  heat-shock protein 70                                   366   3e-119   
dbj|BAA04848.1|  HSP70                                                  365   6e-119   
prf||1205208A  heat shock protein hsp70                                 364   1e-118
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  364   1e-118   
ref|XP_007013854.1|  Heat shock protein 70B                             364   1e-118   
ref|XP_007023492.1|  Heat shock protein 70B                             364   1e-118   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          364   1e-118   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          364   2e-118   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               363   2e-118   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          364   2e-118   
ref|XP_002512741.1|  heat shock protein, putative                       363   2e-118   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             363   3e-118   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             363   3e-118   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     366   4e-118   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          363   4e-118   
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                363   5e-118   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    363   5e-118   
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    363   5e-118   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          363   5e-118   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    362   6e-118   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          362   6e-118   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          362   7e-118   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         362   8e-118   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             362   8e-118   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    362   9e-118   
ref|XP_002512742.1|  heat shock protein, putative                       362   1e-117   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    362   1e-117   
gb|AAA82975.1|  PsHSP71.2                                               361   2e-117   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    361   2e-117   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          361   2e-117   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               361   2e-117   
gb|ABK25453.1|  unknown                                                 361   2e-117   
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          361   3e-117   
emb|CDY02235.1|  BnaA03g39320D                                          345   3e-117   
gb|KJB49429.1|  hypothetical protein B456_008G119200                    360   3e-117   
emb|CDX89754.1|  BnaC03g46680D                                          346   3e-117   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             360   4e-117   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               360   4e-117   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    360   5e-117   
ref|XP_003610287.1|  Heat-shock protein                                 360   6e-117   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    360   7e-117   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   360   7e-117   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          360   8e-117   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          360   8e-117   
ref|XP_010063602.1|  PREDICTED: probable mediator of RNA polymera...    355   2e-116   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               358   4e-116   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               358   4e-116   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               358   5e-116   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          357   6e-116   
emb|CDY53148.1|  BnaAnng12070D                                          344   6e-116   
ref|XP_006368490.1|  heat shock protein 70 cognate                      357   6e-116   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               357   1e-115   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          357   1e-115   
emb|CAA54419.1|  heat shock cognate 70-1                                356   1e-115   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             356   1e-115   
emb|CDY36723.1|  BnaC02g31440D                                          340   2e-115   
ref|XP_010063601.1|  PREDICTED: probable mediator of RNA polymera...    354   2e-115   
emb|CDY16175.1|  BnaA09g29090D                                          342   3e-115   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     359   3e-115   
ref|XP_002976367.1|  hypothetical protein SELMODRAFT_443126             355   4e-115   
ref|XP_002987209.1|  hypothetical protein SELMODRAFT_125427             355   4e-115   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    355   5e-115   
ref|XP_010091163.1|  Heat shock 70 kDa protein                          354   8e-115   
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    354   9e-115   
gb|AGT97046.1|  heat shock protein 70                                   354   1e-114   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             353   1e-114   
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          354   1e-114   
emb|CDY31804.1|  BnaC01g27600D                                          346   1e-114   
emb|CDX85038.1|  BnaC05g20170D                                          340   2e-114   
emb|CDO98244.1|  unnamed protein product                                353   2e-114   
ref|XP_008354483.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   3e-114   
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          353   3e-114   
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                352   6e-114   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        351   1e-113   
ref|XP_010537859.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    351   1e-113   
gb|KHN14134.1|  Heat shock 70 kDa protein                               350   4e-113   
ref|XP_009399566.1|  PREDICTED: heat shock 70 kDa protein-like          350   5e-113   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             349   1e-112   
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               348   1e-112   
emb|CDP02832.1|  unnamed protein product                                349   1e-112   
gb|KDO67637.1|  hypothetical protein CISIN_1g041815mg                   343   2e-112   
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          347   4e-112   
dbj|BAJ34597.1|  unnamed protein product                                347   5e-112   
ref|XP_010678398.1|  PREDICTED: heat shock 70 kDa protein-like          347   1e-111   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          346   1e-111   
ref|XP_010687621.1|  PREDICTED: heat shock 70 kDa protein-like          346   2e-111   
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     345   2e-111   
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          345   3e-111   
ref|NP_173055.1|  heat shock protein 70B                                345   4e-111   
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               344   7e-111   
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        344   7e-111   
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          344   7e-111   
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like          344   8e-111   
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        344   1e-110   
emb|CBI31691.3|  unnamed protein product                                337   1e-110   
ref|XP_008864395.1|  hsp70-like protein                                 332   1e-110   
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             343   3e-110   
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             343   3e-110   
ref|XP_002303859.2|  heat shock protein 70 cognate                      342   3e-110   
emb|CDX83960.1|  BnaC08g16850D                                          342   4e-110   
emb|CDX96825.1|  BnaA08g23680D                                          342   6e-110   
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        342   6e-110   
dbj|BAM44861.1|  heat shock protein                                     331   7e-110   
ref|XP_004292156.2|  PREDICTED: probable mediator of RNA polymera...    338   7e-110   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   340   9e-110   
gb|EPS69582.1|  heat shock protein hsp70                                340   1e-109   
gb|EYU34331.1|  hypothetical protein MIMGU_mgv1a021436mg                341   1e-109   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             340   2e-109   
ref|XP_005643450.1|  heat shock protein 70                              340   2e-109   
gb|KDP38702.1|  hypothetical protein JCGZ_04055                         340   2e-109   
gb|AAL68968.1|  heat shock protein 70                                   340   2e-109   
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          340   3e-109   
dbj|BAE48223.1|  heat shock protein 70                                  340   3e-109   
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          340   3e-109   
ref|XP_002892893.1|  HSP70B                                             340   4e-109   
ref|XP_011469784.1|  PREDICTED: heat shock cognate 70 kDa protein...    335   5e-109   
ref|XP_005843891.1|  heat shock protein 70                              339   6e-109   
ref|XP_008891371.1|  hsp70-like protein                                 325   6e-109   
ref|XP_004292167.1|  PREDICTED: heat shock cognate 70 kDa protein...    335   1e-108   
gb|ABR01232.1|  heat shock protein 70                                   338   2e-108   
emb|CAN66715.1|  hypothetical protein VITISV_041184                     338   2e-108   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    337   2e-108   
gb|KDD74618.1|  heat shock protein Hsp70                                336   3e-108   



>gb|EYU41710.1| hypothetical protein MIMGU_mgv1a022248mg, partial [Erythranthe 
guttata]
Length=371

 Score =   401 bits (1031),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFK+IPGPGDKP+I+VNYKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFNDASVQSDIKLWPFKLIPGPGDKPLIVVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   408 bits (1049),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 195/199 (98%), Positives = 199/199 (100%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRF+DASVQSDIKLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=233

 Score =   392 bits (1008),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+VN+KGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNHKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSAGEK  199



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   406 bits (1044),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 199/199 (100%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRF+DASVQSDIKLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGATVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   406 bits (1043),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   406 bits (1043),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   405 bits (1040),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   404 bits (1039),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score =   397 bits (1021),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 190/201 (95%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = +3

Query  57   RAMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAA  236
            + MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAA
Sbjct  15   KVMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAA  74

Query  237  KNQVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQF  416
            KNQVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V+YKGEEKQF
Sbjct  75   KNQVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQF  134

Query  417  AAEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIIN  596
            AAEEISSMVL+KMREIAEA+LG  VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIIN
Sbjct  135  AAEEISSMVLMKMREIAEAFLGFAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIIN  194

Query  597  EPTAAAIAYGLDKKATSVGEK  659
            EPTAAAIAYGLDKKATSVGEK
Sbjct  195  EPTAAAIAYGLDKKATSVGEK  215



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   403 bits (1036),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDA+VQSDIK WPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   403 bits (1036),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMIIV+YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   402 bits (1033),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGITVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPGPGDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPGPGDKPMI+VNYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKVIPGPGDKPMI+V YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   402 bits (1034),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGPGDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   402 bits (1034),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKVIPGPGDKPMIIV+YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIIVSYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGPGDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EE+SSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEVSSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSAGEK  199



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD KLWPFKVIPGPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIPGPGDKPMICVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPG GDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPG GDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ABA95501.2| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   401 bits (1030),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score =   400 bits (1029),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFK+IPGP +KPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFK+IPGP +KPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   402 bits (1032),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIK WPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   401 bits (1031),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPGPGDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLI+M+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIRMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   401 bits (1031),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   401 bits (1031),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDA VQ D+K+WPFKVIPGPG+KPMI+VNYKGE+KQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDAPVQGDMKMWPFKVIPGPGEKPMIVVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   401 bits (1031),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMI+V+YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   401 bits (1030),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIK WPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   401 bits (1030),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVVYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   400 bits (1029),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   400 bits (1029),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMI+V YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPG  DKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGAADKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKVI GPGDKPMI+V+YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   393 bits (1009),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATS  647
            TAAAIAYGLDKKATS
Sbjct  181  TAAAIAYGLDKKATS  195



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDA+VQSDIK WPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V+YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSAGEK  199



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD KLWPFKVIPGPGDKPMI+VNYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFK+I GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKLISGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPGPGDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAY NDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYSNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR SDASVQSD+KLWPFKVIPGP DKPMI+VNYKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   399 bits (1025),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMI+V YKGE+KQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGYTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAASVGEK  199



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   399 bits (1025),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V YKGEE+QFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG++VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGASVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGS+VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPGP DKPMI+VNYKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QV MNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMIIV+YKG EKQFAA
Sbjct  61   QVTMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGGEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTV DAKRLIGRR+SDASVQSDIKLWPFKVIPG GDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVLDAKRLIGRRYSDASVQSDIKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   399 bits (1024),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPGP DKPMI+VNYKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   399 bits (1024),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMI+V YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KJB36734.1| hypothetical protein B456_006G174000 [Gossypium raimondii]
Length=646

 Score =   399 bits (1024),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDA+VQSDIKLWPFKVIPG GDKPMI+V+YKGEEKQFAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDAAVQSDIKLWPFKVIPGSGDKPMIVVSYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   399 bits (1025),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMI+V YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   399 bits (1024),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D SVQSDIKLWPFKVIPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDTSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   397 bits (1021),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V+YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIMVSYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAGSVGEK  199



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   399 bits (1024),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR SDASVQSD+KLWPFKVIPGP DKPMI+VNYKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   398 bits (1023),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D SVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDPSVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   398 bits (1023),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIK WPFKV PGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   398 bits (1023),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVXYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGS+VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   398 bits (1023),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD KLWPFKVI GPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIAGPGDKPMICVAYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDA VQSDIKLWPFKVI GPGDKPMI+V+YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDAPVQSDIKLWPFKVIAGPGDKPMIVVSYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQ D+KLWPFKVI GP DKPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMI+VNYKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSM+LIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMI+VNYKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSM+LIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   398 bits (1023),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD +VQSD+KLWPFKV+PGP DKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTTVQSDVKLWPFKVVPGPADKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   398 bits (1022),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DA+VQSDIKLWPFKVI GP DKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDATVQSDIKLWPFKVIAGPADKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   398 bits (1022),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAGSVGEK  199



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   398 bits (1022),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR+SDASVQSDIKLWPFKV+PGPGDKPMIIV Y+GE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDASVQSDIKLWPFKVVPGPGDKPMIIVQYRGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIG+AAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGNAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIEVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG  VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGFNVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDA+VQSDIKLWPFKV+ GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKLWPFKVVAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKVI GPG+KPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIAGPGEKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLVKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMIIVNYKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEDKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSM+LIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMIIVNYKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPG+KPMI+V +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGEKPMIVVQHKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMIIVNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|EEC76425.1| hypothetical protein OsI_14101 [Oryza sativa Indica Group]
Length=434

 Score =   390 bits (1002),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/194 (96%), Positives = 191/194 (98%), Gaps = 0/194 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  64

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNP NTVFDAKRLIGRRFSDASVQSDIK+WP+KVIPGPGDKPMI+V YKGEEKQF+AEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  184

Query  612  AIAYGLDKKATSVG  653
            AIAYGLDKKATSV 
Sbjct  185  AIAYGLDKKATSVA  198



>ref|XP_008223372.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Prunus mume]
Length=519

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDAS+QSD+KLWPFKVIPG GDKP I+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KDO72893.1| hypothetical protein CISIN_1g036208mg, partial [Citrus sinensis]
Length=279

 Score =   384 bits (987),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVI G GDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA S GEK
Sbjct  181  TAAAIAYGLDKKAGSTGEK  199



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  68   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  127

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI G  DKPMI+VNYKGEEKQFAA
Sbjct  128  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGAADKPMIVVNYKGEEKQFAA  187

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  188  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  247

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  248  TAAAIAYGLDKKATSVGEK  266



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAGSVGEK  199



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA S GEK
Sbjct  181  TAAAIAYGLDKKAGSSGEK  199



>gb|AAS09825.1| heat shock cognate protein 70 [Eutrema halophilum]
Length=651

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMIIVNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   396 bits (1017),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPG+KPMIIV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SDASVQSDIKLWPFKVIPGP +KPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDASVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V YKGEE+QFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG +VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGLSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009102555.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=647

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTP YV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPPYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPG+KPMIIV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPG+KPMIIV YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQ D+KLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQGDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   396 bits (1018),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGPG+KPMI VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGEKPMISVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRF+DASVQSD+KLWPFKVI GPGDKPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   399 bits (1026),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = +3

Query  60   AMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  239
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  93   SMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  152

Query  240  NQVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFA  419
            NQVAMNP NTVFDAKRLIGRRF+DASVQSDIK WPFKV PGPGDKPMI+VNYKGEEKQFA
Sbjct  153  NQVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFA  212

Query  420  AEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  599
            AEEISSMVL KMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
Sbjct  213  AEEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  272

Query  600  PTAAAIAYGLDKKATSVGEK  659
            PTAAAIAYGLDKKATSVGEK
Sbjct  273  PTAAAIAYGLDKKATSVGEK  292



>ref|NP_001051724.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|AAO65876.1| heat shock protein cognate 70 [Oryza sativa Japonica Group]
 gb|ABF99592.1| Heat shock cognate 70 kDa protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13638.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|EAZ29089.1| hypothetical protein OsJ_13143 [Oryza sativa Japonica Group]
 dbj|BAG91581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=649

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/196 (96%), Positives = 194/196 (99%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  64

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNP NTVFDAKRLIGRRFSDASVQSDIK+WP+KVIPGPGDKPMI+V YKGEEKQF+AEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  184

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATSVGEK
Sbjct  185  AIAYGLDKKATSVGEK  200



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVI G GDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGAGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   399 bits (1025),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/200 (95%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = +3

Query  60   AMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  239
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  93   SMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  152

Query  240  NQVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFA  419
            NQVAMNP NTVFDAKRLIGRRF+DASVQSDIK WPFKV PGPGDKPMI+VNYKGEEKQFA
Sbjct  153  NQVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFA  212

Query  420  AEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  599
            AEEISSMVL KMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
Sbjct  213  AEEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  272

Query  600  PTAAAIAYGLDKKATSVGEK  659
            PTAAAIAYGLDKKATSVGEK
Sbjct  273  PTAAAIAYGLDKKATSVGEK  292



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   396 bits (1018),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGS+VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   396 bits (1018),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SDASVQSDI+LWPFKVIPGPGDKPMI+V+YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIQLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   396 bits (1018),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   396 bits (1017),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQ D+KLWPFKVIPGPGDKPMI+V YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   396 bits (1017),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   395 bits (1016),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SD+SVQSD+KLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   395 bits (1016),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIK W FKV+PGPGDKPMI V YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGPGDKPMITVTYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   395 bits (1016),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SD SVQ+D+KLWPFKVIPGPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDPSVQADMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG++VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   395 bits (1016),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGP +KPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   395 bits (1016),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V+YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEA+LG  VKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAFLGFAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   391 bits (1005),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQ DIK WPFKV PG GDKPMI VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDIKHWPFKVTPGAGDKPMISVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEKMC*SLILEVVLLM  698
            TAAAIAYGLDKKATSVGEK    LI ++ +L+
Sbjct  181  TAAAIAYGLDKKATSVGEKNV--LIFDLGVLV  210



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   395 bits (1016),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSDIKLWPFKVIPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSAGEK  199



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   395 bits (1016),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPGP DKPMI+VNYKG+EKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGDEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   395 bits (1016),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFK I GPGDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKGISGPGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSM LIKM+E+AEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMGLIKMKEMAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD++LWPFKVIPGPGDKP+I+V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDTSVQSDMRLWPFKVIPGPGDKPLIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAASVGEK  199



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV  GPGDKPMI VNYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVFSGPGDKPMIQVNYKGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002442353.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|EES16191.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|AHV91025.1| Hsp70 [Saccharum hybrid cultivar]
Length=649

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPG+KPMI+V +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004962705.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPG+KPMI+V +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI G  DKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGAADKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDA+VQSD KLWPFKVI G GDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDTKLWPFKVIAGAGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|NP_001183165.1| uncharacterized protein LOC100501536 [Zea mays]
 gb|ACR35910.1| unknown [Zea mays]
 gb|AFW84633.1| heat shock protein1 [Zea mays]
Length=648

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKNQVA
Sbjct  3    KSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+VNYKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSSGEK  198



>ref|XP_002456611.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
 gb|EES01731.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
Length=648

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+VNYKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSAGEK  198



>ref|XP_006287234.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
 gb|EOA20132.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
Length=651

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK++PGP DKPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKILPGPADKPMIYVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR++D SVQSDIKLWPFKVIPGP +KPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004981251.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Setaria 
italica]
Length=648

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  64

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNP NTVFDAKRLIGRRFSDASVQSDIK+WP+KVIPGPGDKPMI+V YKGEEKQF+AEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  125  SSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  184

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATSVGEK
Sbjct  185  AIAYGLDKKATSVGEK  200



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQ D+KLWPFKVIPGP +KPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMI+VNY+GEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYRGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>ref|XP_004970526.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=648

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+VNYKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSAGEK  198



>gb|AAA86903.1| heat shock protein cognate 70, partial [Sorghum bicolor]
Length=209

 Score =   379 bits (973),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GP+IGIDLGTTYSCVGVWQ DRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPSIGIDLGTTYSCVGVWQRDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFK I GPG+KPMI+V +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKGISGPGEKPMIVVQHKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMRE AEAYLGST+KNAVVTVPAYFNDSQRQ TKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMRETAEAYLGSTIKNAVVTVPAYFNDSQRQGTKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAA IAYGLDKKATSVGEK
Sbjct  181  TAARIAYGLDKKATSVGEK  199



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRF+DASVQSD+KLWPFKVI GPGDKPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DA VQSDIKLWPFKVI GP DKP I+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAPVQSDIKLWPFKVIAGPADKPTIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SD+SVQSD+KLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>ref|XP_009115390.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=649

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = +3

Query  69   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQV  248
            GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKNQV
Sbjct  4    GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63

Query  249  AMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEE  428
            AMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMI+V+YKGEEKQFAAEE
Sbjct  64   AMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVDYKGEEKQFAAEE  123

Query  429  ISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  608
            ISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA
Sbjct  124  ISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA  183

Query  609  AAIAYGLDKKATSVGEK  659
            AAIAYGLDKKATSVGEK
Sbjct  184  AAIAYGLDKKATSVGEK  200



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQ D+KLWPFKVIPGPGDKPMI+V YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSAGEK  199



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGP +KPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGNTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008674324.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|ACL53191.1| unknown [Zea mays]
 tpg|DAA55191.1| TPA: heat shock protein70-4 isoform 1 [Zea mays]
 tpg|DAA55192.1| TPA: heat shock protein70-4 isoform 2 [Zea mays]
 tpg|DAA55193.1| TPA: heat shock protein70-4 isoform 3 [Zea mays]
Length=649

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPG+KPMI+V +KGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 195/199 (98%), Gaps = 1/199 (1%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVF AKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVF-AKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  119

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  120  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  179

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  180  TAAAIAYGLDKKATSVGEK  198



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSC+GVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCIGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR++D SVQSDIKLWPFKVIPGP +KPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   394 bits (1012),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR SD SVQSD+KLWPFKVI GPGDKPMI+V YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRVSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   389 bits (1000),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLW FK+I GP +KPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWLFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DA+VQSD+KLWPFKVI GPGDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAAVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   394 bits (1011),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR SDASVQSD+KLWPFKVIPGP +KPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   393 bits (1010),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+I GP +KPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>emb|CDP09035.1| unnamed protein product [Coffea canephora]
Length=650

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR SD+SVQ+DIKLWPFKVI GPGDKPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRLSDSSVQNDIKLWPFKVIAGPGDKPMIAVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+E+AEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEVAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSAGEK  199



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSDIKLWPFKV+ GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDVSVQSDIKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAGSVGEK  199



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDPERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGP +KPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+I GP +KPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   393 bits (1010),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKVI GPGDKPMI V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIGVTYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+ +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   393 bits (1010),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EE+SSMVLIKM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEVSSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK+TS GEK
Sbjct  181  TAAAIAYGLDKKSTSTGEK  199



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   393 bits (1010),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVA+NP NTVFDAKRLIGRRFSDASVQ D+KLWPFKVIPGPGDKPMI+V YKGEEK+FAA
Sbjct  61   QVALNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSAGEK  199



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   393 bits (1010),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQ DIKLWPFKVIPGP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQGDIKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLG++VKNAVVTVPAYFNDSQRQATKDAGVI GLNVMRIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVIGGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score =   393 bits (1009),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EE+SSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEVSSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   393 bits (1009),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR SDASVQSD+KLWPFKVI GPG+KPMI VNYKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGPGEKPMIGVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   393 bits (1009),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDAS+QSD+KLWPFKVIPG GDKP I+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKV+ GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+E AEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAGSVGEK  199



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQ D+KLWPFKV PGPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDGSVQDDMKLWPFKVTPGPGDKPMIGVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQ D+KLWPFKV+ GPGDKPMI+V+YKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQGDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVMYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EE+SSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEVSSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK++S GEK
Sbjct  181  TAAAIAYGLDKKSSSSGEK  199



>gb|KCW74480.1| hypothetical protein EUGRSUZ_E03189 [Eucalyptus grandis]
Length=522

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/200 (93%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQYDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            Q AMNP NTVF+AKRLIGRRFSDAS+QSDIK WPFKVIPGPGDKPMI+VNYKGEE+QFAA
Sbjct  61   QFAMNPINTVFNAKRLIGRRFSDASLQSDIKFWPFKVIPGPGDKPMIVVNYKGEEEQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS VKNAVVTVPA FNDSQRQAT DAGV+AGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAAFNDSQRQATMDAGVVAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEKM  662
            TAAAIAYGLDKKATSVGEK+
Sbjct  181  TAAAIAYGLDKKATSVGEKI  200



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKVIPG GDKPMI+V+YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVSYKGEDKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDA+VQSDIK W FKV+PG GDKPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDAAVQSDIKHWSFKVVPGAGDKPMIQVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIK W FKV+PG GDKPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGAGDKPMIQVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009353696.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Pyrus x bretschneideri]
Length=520

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DA++QSD+KLWPFKVI G GDKP I+VNYKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDATIQSDMKLWPFKVIAGAGDKPTIVVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGSTVKN+VVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNSVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDAS+QSD+KLWPFKVIPG GDKP I+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008674843.1| PREDICTED: heat shock 70 kDa protein-like [Zea mays]
 tpg|DAA56909.1| TPA: hypothetical protein ZEAMMB73_648566 [Zea mays]
Length=648

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 193/196 (98%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V+YKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKA+S GEK
Sbjct  183  AIAYGLDKKASSSGEK  198



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSD+KLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA S GEK
Sbjct  181  TAAAIAYGLDKKAGSAGEK  199



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQ DIK WPFKV PG GDKPMI VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDIKHWPFKVTPGAGDKPMISVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKV+PGPGDKPMI+V YKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSSGEK  198



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+  GP DKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR SD SVQSD+KLWPFKVIPGP DKPMI+VNYK EEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSTGEK  199



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFK+I GP +KPMI VNYKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIISGPAEKPMIGVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLG+ +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D SVQSDIKLWPFKVI GPGDKPMI V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDVSVQSDIKLWPFKVISGPGDKPMIGVTYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+ +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKV PGPGDKPMI V+YKGEEK FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGPGDKPMIGVSYKGEEKVFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GPGDKPMI V YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIGVQYKGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EE+SSMVL+KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEVSSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR SDASVQSD+KLWPFKVI G  +KPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGTAEKPMIGVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   391 bits (1005),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQ D+K WPFKVIPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_003564580.1| PREDICTED: heat shock cognate 70 kDa protein [Brachypodium distachyon]
Length=654

 Score =   391 bits (1005),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EI EAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSSGEK  199



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQ D+KLWPFKVI GPGDKPMI+V+YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQGDMKLWPFKVIAGPGDKPMIVVSYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAGSVGEK  199



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI G GDKPMI+V+YKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGVGDKPMIVVSYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIA+AYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIADAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_001759874.1| predicted protein [Physcomitrella patens]
 gb|EDQ75378.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|NP_176036.1| heat shock protein ERD2 [Arabidopsis thaliana]
 sp|Q9C7X7.1|HSP7N_ARATH RecName: Full=Heat shock 70 kDa protein 18; AltName: Full=Heat 
shock protein 70-18; Short=AtHsp70-18; AltName: Full=Heat-shock 
protein 70T-1 [Arabidopsis thaliana]
 gb|AAG51503.1|AC058785_6 heat shock protein, putative [Arabidopsis thaliana]
 gb|ABE65717.1| heat shock cognate 70 kDa protein/HSC70/HSP70 [Arabidopsis thaliana]
 gb|AEE33389.1| heat shock protein ERD2 [Arabidopsis thaliana]
Length=617

 Score =   390 bits (1001),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+K WPFKV PG  DKPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKFWPFKVTPGQADKPMIFVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVG K
Sbjct  181  TAAAIAYGLDKKATSVGIK  199



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQ D+KLWPFKV+ GPGDKPMI V+YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDMKLWPFKVVAGPGDKPMINVSYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSDIKLWPFKV+ GPGDKPMI+V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LG++V NAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGTSVNNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ABX76301.1| heat shock protein 70 [Ageratina adenophora]
Length=649

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTP YV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPPYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGP +KPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFK+I GP +KPMI VNYKGE+KQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIISGPAEKPMIGVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLG+ +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAG I+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK++S GEK
Sbjct  181  TAAAIAYGLDKKSSSTGEK  199



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   390 bits (1003),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAG I+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK++S GEK
Sbjct  181  TAAAIAYGLDKKSSSTGEK  199



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI ANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIFANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSDIKLWPFKVI GP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK++S GEK
Sbjct  181  TAAAIAYGLDKKSSSSGEK  199



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   390 bits (1003),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SD+SVQSDIKLWPFKVI GPGDKPMI+V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKAT+ GEK
Sbjct  181  TAAAIAYGLDKKATTSGEK  199



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   390 bits (1003),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+VN+KGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNHKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EE+SSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEVSSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   390 bits (1003),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQ+D+KLWPFKVIPGP +KPMI+V+YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQADMKLWPFKVIPGPAEKPMIVVSYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGKTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSAGEK  199



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   390 bits (1003),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSAGEK  199



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR SD SVQSD+KLWPFKVIPGP DKPMI+VNYK EEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSTGEK  199



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DA VQSDIKLWPFKVI GP DKP I+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAPVQSDIKLWPFKVIAGPADKPTIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGST KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTEKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SDASVQSDIKLWPFKVI GPGDKPMI+V YKGEEKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIKLWPFKVIAGPGDKPMIVVAYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSAGEK  199



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SD SVQ D+K WPFKVIPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 192/196 (98%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V +KGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQHKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEAYLG+++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMREIAEAYLGNSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSTGEK  198



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V YKGEEKQF+AEEI
Sbjct  63   MNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEAYLGS +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSSGEK  198



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFKV PGPGDKPMI V+YKGE+K FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGPGDKPMIGVSYKGEDKVFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRF D SVQSD+KLWPFKVIPGP DKPMI+VNYK EEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFGDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSTGEK  199



>ref|XP_004250959.1| PREDICTED: heat shock cognate 70 kDa protein [Solanum lycopersicum]
Length=654

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = +3

Query  60   AMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  239
            A AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAK
Sbjct  2    AAAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  61

Query  240  NQVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFA  419
            NQVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+V YKGEEKQF+
Sbjct  62   NQVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFS  121

Query  420  AEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  599
            AEEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINE
Sbjct  122  AEEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINE  181

Query  600  PTAAAIAYGLDKKATSVGEK  659
            PTAAAIAYGLDKK+TS GEK
Sbjct  182  PTAAAIAYGLDKKSTSTGEK  201



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAG I+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK +S GEK
Sbjct  181  TAAAIAYGLDKKISSTGEK  199



>gb|KHN13890.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=729

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV F DSE LIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFIDSECLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTV+DAKRLIGRRFSDASVQSD+KLWPFKVIPGP DKPMI+VNYKGE+KQF+A
Sbjct  61   QVAMNPVNTVYDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVMYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV RIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVTRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SD+SVQ+D+KLWPFKV+PG GDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQADMKLWPFKVVPGSGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LG T+KN VVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGCTIKNGVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAASVGEK  199



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAG+I+GLNVMRIINEP
Sbjct  121  EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGIISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA S GEK
Sbjct  181  TAAAIAYGLDKKAGSSGEK  199



>ref|XP_002891955.1| early-responsive to dehydration 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68214.1| early-responsive to dehydration 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   388 bits (997),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGR FS+ASVQSD+KLWPFK+IPG  DKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRIFSNASVQSDMKLWPFKIIPGQADKPMILVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVG K
Sbjct  181  TAAAIAYGLDKKATSVGYK  199



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQ+D+K WPFKV+ GPG+KPMI VNYKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQADMKHWPFKVVSGPGEKPMIGVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVIPGPGDKPMI+V YKGEEKQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI GLNVMRIINEPTAA
Sbjct  123  SSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIGGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSSGEK  198



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMI+V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSAGEK  199



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+V YKGEEKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK+TS GEK
Sbjct  181  TAAAIAYGLDKKSTSTGEK  199



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR SDASVQSD+KLWPFKVI GPG+KPMI VNYKGEEK FA+
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGPGEKPMIGVNYKGEEKLFAS  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDA VQSD+KLWPFKV+ GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDACVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLGSTVKN VVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNGVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA SVGEK
Sbjct  181  TAAAIAYGLDKKAGSVGEK  199



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRR+SD SVQ D+K WPFK IPGPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKAIPGPGDKPMIVVMYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_006349005.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+V YKGEEKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK+TS GEK
Sbjct  181  TAAAIAYGLDKKSTSTGEK  199



>gb|EMT06830.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=647

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EI EAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSSGEK  199



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR SDASVQSD+KLWPFKVI GPG+KPMI VNYKGEEK FA+
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGPGEKPMIGVNYKGEEKLFAS  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>dbj|BAK00257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=648

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIIVNYKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIIVNYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEA+LG++VKNAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAA
Sbjct  123  SSMVLIKMREIAEAFLGNSVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSTGEK  198



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSD+KLWPFKV PG  DKPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGAADKPMISVQYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR+SD SV++D+KLWPFKVI GPGDKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVKADMKLWPFKVISGPGDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLG++VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   388 bits (997),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFKVI G GDKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KM+EIAEAYLG+++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLNKMKEIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+S GEK
Sbjct  181  TAAAIAYGLDKKASSSGEK  199



>gb|AAB99745.1| HSP70 [Triticum aestivum]
 gb|EMT04103.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=648

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+VNYKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEA+LG++VKNAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAA
Sbjct  123  SSMVLIKMREIAEAFLGNSVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSTGEK  198



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   388 bits (997),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQ+DIKLWPFKV+ GPGDKPMI+V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQNDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LG+ V NAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGTAVNNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKAT+VGEK
Sbjct  181  TAAAIAYGLDKKATTVGEK  199



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   389 bits (998),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+K WPFKVIPGP +KPMI+V++KGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKHWPFKVIPGPAEKPMIVVSHKGEDKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATS GEK
Sbjct  181  TAAAIAYGLDKKATSSGEK  199



>emb|CCD74508.1| early-responsive to dehydration 2 [Arabidopsis halleri subsp. 
halleri]
Length=622

 Score =   387 bits (995),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGR FS+ASVQSD+KLWPFK+IPG  DKPMI+VNYKGEEKQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRIFSNASVQSDMKLWPFKIIPGQEDKPMILVNYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS++KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVG K
Sbjct  181  TAAAIAYGLDKKATSVGNK  199



>ref|XP_010452093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Camelina sativa]
 ref|XP_010452094.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Camelina sativa]
 ref|XP_010490701.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   388 bits (997),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+  GP DKPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVNYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|KFK38606.1| hypothetical protein AALP_AA3G135800 [Arabis alpina]
Length=357

 Score =   378 bits (971),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQ+D++ WPFKVI GP +KPMI+VN+KGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNHKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LG+ VKNAVVTVPAYFNDSQRQATKDAG I+GLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGNPVKNAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   388 bits (997),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+VNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKEFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAG I+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAFLGITIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK++S GEK
Sbjct  181  TAAAIAYGLDKKSSSTGEK  199



>gb|EMS51135.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=610

 Score =   387 bits (993),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 186/200 (93%), Positives = 193/200 (97%), Gaps = 1/200 (1%)
 Frame = +3

Query  63   MAGKG-EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  239
            MA KG EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAK
Sbjct  1    MAKKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  60

Query  240  NQVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFA  419
            NQVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+V YKGEEKQFA
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFA  120

Query  420  AEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  599
            AEEISSMVLIKM+EI EAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
Sbjct  121  AEEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  180

Query  600  PTAAAIAYGLDKKATSVGEK  659
            PTAAAIAYGLDKKA+S GEK
Sbjct  181  PTAAAIAYGLDKKASSSGEK  200



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD  LWPFK+I GPG+KPMI+VNYKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDRALWPFKIISGPGEKPMIVVNYKGEDKEFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSM+LIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_002873056.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49315.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
Length=650

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+ PGP DKPMI V YKGEEK FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQPGPADKPMIYVEYKGEEKMFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_010423853.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+  GP DKPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVNYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG ++KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score =   387 bits (995),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+VNYKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKMREIAEA+LG++VKNAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAA
Sbjct  123  SSMVLIKMREIAEAFLGNSVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKATS GEK
Sbjct  183  AIAYGLDKKATSTGEK  198



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DA++QSD+KLWPFKVI G GDKP I+VNYKGE+KQFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDATIQSDMKLWPFKVIAGAGDKPTIVVNYKGEDKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL KMREIAEAYLGSTVKN+VVTVPAYFNDSQRQATKDAGVIAG+NVMRIINEP
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNSVVTVPAYFNDSQRQATKDAGVIAGMNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AIU40169.1| heat shock protein 70 [Saccharum arundinaceum]
Length=648

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +3

Query  72   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  251
            KGEGPAIGI+LGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIELGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  252  MNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAAEEI  431
            MNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMI+VNYKGEEKQFAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEEI  122

Query  432  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  611
            SSMVLIKM+EIA  YLGST+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
Sbjct  123  SSMVLIKMKEIAGGYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA  182

Query  612  AIAYGLDKKATSVGEK  659
            AIAYGLDKKA+S GEK
Sbjct  183  AIAYGLDKKASSSGEK  198



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRF+D SVQSD+KLWPFKVIPGP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFNDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAG I+GLNVMRIINEP
Sbjct  121  EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA S GEK
Sbjct  181  TAAAIAYGLDKKAGSSGEK  199



>ref|NP_195870.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 sp|P22953.3|MD37E_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37e; AltName: Full=Heat shock 70 kDa protein 1; 
AltName: Full=Heat shock cognate 70 kDa protein 1; AltName: 
Full=Heat shock cognate protein 70-1; Short=AtHsc70-1; AltName: 
Full=Heat shock protein 70-1; Short=AtHsp70-1; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 2 [Arabidopsis 
thaliana]
 emb|CAB85987.1| dnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAL09715.1| AT5g02500/T22P11_90 [Arabidopsis thaliana]
 gb|AAM53305.1| DnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAO22583.1| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
 gb|AED90480.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=651

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+  GP DKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVMYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
             EISSMVLIKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  GEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAA AYGLDKKATSVGEK
Sbjct  181  TAAATAYGLDKKATSVGEK  199



>ref|XP_001785822.1| predicted protein [Physcomitrella patens]
 gb|EDQ49366.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGTAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRRFSDASVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EE+SSMVLIKM+EIAEAYLG TVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEVSSMVLIKMKEIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSDASVQSD+KLWPFK+I GP +KP+I VNYKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIISGPAEKPLIGVNYKGEDKEFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KMREIAEAYLGS +KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
Sbjct  121  EEISSMVLMKMREIAEAYLGSAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNPTNTVFDAKRLIGRR SDASVQSD+KLWPFKV  GPG+KPMI VNYKGEEK FA+
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVTAGPGEKPMIGVNYKGEEKLFAS  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEAYLG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKATSVGEK
Sbjct  181  TAAAIAYGLDKKATSVGEK  199



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAGKGEGTAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRFSD SVQSDIKLWPFKVI GP DKPMI+VNYKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKK++S GEK
Sbjct  181  TAAAIAYGLDKKSSSSGEK  199



>gb|ACD45076.1| heat-shock protein 70 [Dactylis glomerata]
Length=656

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/200 (93%), Positives = 193/200 (97%), Gaps = 1/200 (1%)
 Frame = +3

Query  63   MAGKG-EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAK  239
            MA KG EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAK
Sbjct  1    MAKKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  60

Query  240  NQVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFA  419
            NQVAMNPTNTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMI+V YKGEEKQFA
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFA  120

Query  420  AEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  599
            AEEISSMVLIKM+EI EAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
Sbjct  121  AEEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE  180

Query  600  PTAAAIAYGLDKKATSVGEK  659
            PTAAAIAYGLDKKA+S GEK
Sbjct  181  PTAAAIAYGLDKKASSSGEK  200



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+DASVQSDIKLWPFKV  GPGDKPMI V YKGEEKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVTSGPGDKPMIAVQYKGEEKQFSA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVL+KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct  121  EEISSMVLMKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  63   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  242
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct  1    MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  243  QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  422
            QVAMNP NTVFDAKRLIGRRF+D++VQSDIKLWPFKV+ GPGDKPMI V YKGEEKQFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA  120

Query  423  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP  602
            EEISSMVLIKMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP  180

Query  603  TAAAIAYGLDKKATSVGEK  659
            TAAAIAYGLDKKA+SVGEK
Sbjct  181  TAAAIAYGLDKKASSVGEK  199



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380