BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040H15

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615007.1|  PREDICTED: probable metal-nicotianamine tran...    256   1e-76   Nicotiana tomentosiformis
ref|XP_009794095.1|  PREDICTED: probable metal-nicotianamine tran...    253   1e-75   Nicotiana sylvestris
ref|XP_004233770.1|  PREDICTED: probable metal-nicotianamine tran...    251   6e-75   Solanum lycopersicum
ref|XP_006363210.1|  PREDICTED: probable metal-nicotianamine tran...    249   2e-74   Solanum tuberosum [potatoes]
ref|XP_009593058.1|  PREDICTED: probable metal-nicotianamine tran...    250   2e-74   Nicotiana tomentosiformis
ref|XP_009798435.1|  PREDICTED: probable metal-nicotianamine tran...    248   9e-74   Nicotiana sylvestris
ref|XP_006343309.1|  PREDICTED: probable metal-nicotianamine tran...    244   2e-72   Solanum tuberosum [potatoes]
gb|KDP27275.1|  hypothetical protein JCGZ_21006                         243   6e-72   Jatropha curcas
ref|XP_002525883.1|  oligopeptide transporter, putative                 243   8e-72   Ricinus communis
gb|EYU25678.1|  hypothetical protein MIMGU_mgv1a002252mg                243   8e-72   Erythranthe guttata [common monkey flower]
gb|EPS73705.1|  hypothetical protein M569_01043                         241   3e-71   Genlisea aurea
ref|XP_010245490.1|  PREDICTED: probable metal-nicotianamine tran...    236   4e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006847870.1|  hypothetical protein AMTR_s00029p00090040          229   4e-71   
ref|XP_004234495.1|  PREDICTED: probable metal-nicotianamine tran...    240   6e-71   Solanum lycopersicum
ref|XP_011097988.1|  PREDICTED: probable metal-nicotianamine tran...    240   6e-71   Sesamum indicum [beniseed]
ref|XP_011046075.1|  PREDICTED: probable metal-nicotianamine tran...    237   1e-69   Populus euphratica
ref|XP_002266657.1|  PREDICTED: probable metal-nicotianamine tran...    236   2e-69   Vitis vinifera
ref|XP_006372622.1|  iron transporter-related family protein            234   9e-69   Populus trichocarpa [western balsam poplar]
ref|XP_011016255.1|  PREDICTED: probable metal-nicotianamine tran...    229   1e-68   Populus euphratica
ref|XP_011046073.1|  PREDICTED: probable metal-nicotianamine tran...    234   1e-68   Populus euphratica
ref|XP_002269277.1|  PREDICTED: probable metal-nicotianamine tran...    234   2e-68   Vitis vinifera
ref|XP_011046072.1|  PREDICTED: probable metal-nicotianamine tran...    234   2e-68   Populus euphratica
ref|XP_006391519.1|  hypothetical protein EUTSA_v10018216mg             233   3e-68   Eutrema salsugineum [saltwater cress]
ref|XP_010112419.1|  putative metal-nicotianamine transporter YSL7      233   3e-68   Morus notabilis
ref|XP_006372353.1|  hypothetical protein POPTR_0017s00810g             233   4e-68   
ref|XP_006372354.1|  hypothetical protein POPTR_0017s00810g             233   5e-68   
ref|XP_006372621.1|  hypothetical protein POPTR_0017s03320g             233   6e-68   
gb|KFK41018.1|  hypothetical protein AALP_AA2G074700                    232   8e-68   Arabis alpina [alpine rockcress]
ref|XP_007029356.1|  YELLOW STRIPE like 5                               232   9e-68   
gb|ABB76761.1|  YSL transporter 1                                       232   1e-67   Noccaea caerulescens
gb|KCW48664.1|  hypothetical protein EUGRSUZ_K02319                     228   2e-67   Eucalyptus grandis [rose gum]
ref|XP_011035386.1|  PREDICTED: probable metal-nicotianamine tran...    231   2e-67   Populus euphratica
ref|NP_176750.1|  putative metal-nicotianamine transporter YSL7         231   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011046070.1|  PREDICTED: probable metal-nicotianamine tran...    231   3e-67   Populus euphratica
ref|XP_011046074.1|  PREDICTED: probable metal-nicotianamine tran...    230   4e-67   Populus euphratica
gb|KCW48659.1|  hypothetical protein EUGRSUZ_K02315                     226   7e-67   Eucalyptus grandis [rose gum]
ref|XP_010037025.1|  PREDICTED: probable metal-nicotianamine tran...    229   7e-67   Eucalyptus grandis [rose gum]
ref|XP_002269403.1|  PREDICTED: probable metal-nicotianamine tran...    229   1e-66   Vitis vinifera
ref|XP_010940334.1|  PREDICTED: probable metal-nicotianamine tran...    228   2e-66   Elaeis guineensis
ref|XP_010037026.1|  PREDICTED: probable metal-nicotianamine tran...    228   3e-66   Eucalyptus grandis [rose gum]
ref|XP_011072072.1|  PREDICTED: probable metal-nicotianamine tran...    228   4e-66   Sesamum indicum [beniseed]
gb|ACD77012.1|  metal transporter protein                               227   4e-66   Brassica juncea [brown mustard]
ref|XP_010037024.1|  PREDICTED: probable metal-nicotianamine tran...    228   5e-66   Eucalyptus grandis [rose gum]
ref|XP_009105166.1|  PREDICTED: probable metal-nicotianamine tran...    227   5e-66   Brassica rapa
ref|XP_010039025.1|  PREDICTED: probable metal-nicotianamine tran...    227   7e-66   Eucalyptus grandis [rose gum]
ref|XP_010511122.1|  PREDICTED: probable metal-nicotianamine tran...    227   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002886962.1|  hypothetical protein ARALYDRAFT_475677             226   1e-65   
emb|CAN72423.1|  hypothetical protein VITISV_014262                     226   2e-65   Vitis vinifera
ref|XP_002510093.1|  oligopeptide transporter, putative                 226   2e-65   Ricinus communis
emb|CDY39272.1|  BnaC06g27190D                                          225   2e-65   Brassica napus [oilseed rape]
gb|KDP45817.1|  hypothetical protein JCGZ_17424                         226   2e-65   Jatropha curcas
ref|XP_008441625.1|  PREDICTED: probable metal-nicotianamine tran...    224   3e-65   Cucumis melo [Oriental melon]
gb|KFK39092.1|  hypothetical protein AALP_AA3G199800                    226   3e-65   Arabis alpina [alpine rockcress]
ref|XP_002279707.1|  PREDICTED: probable metal-nicotianamine tran...    225   3e-65   Vitis vinifera
emb|CDY46890.1|  BnaA01g27900D                                          224   8e-65   Brassica napus [oilseed rape]
ref|XP_009113863.1|  PREDICTED: probable metal-nicotianamine tran...    224   9e-65   Brassica rapa
gb|KJB26835.1|  hypothetical protein B456_004G262100                    223   1e-64   Gossypium raimondii
ref|XP_010528609.1|  PREDICTED: probable metal-nicotianamine tran...    223   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_010069525.1|  PREDICTED: probable metal-nicotianamine tran...    223   2e-64   Eucalyptus grandis [rose gum]
ref|XP_003533289.1|  PREDICTED: probable metal-nicotianamine tran...    223   2e-64   Glycine max [soybeans]
ref|XP_003548294.1|  PREDICTED: probable metal-nicotianamine tran...    223   2e-64   Glycine max [soybeans]
ref|XP_008779631.1|  PREDICTED: probable metal-nicotianamine tran...    213   2e-64   
ref|XP_002305689.1|  hypothetical protein POPTR_0004s06790g             223   2e-64   
ref|XP_006406708.1|  hypothetical protein EUTSA_v10020160mg             223   2e-64   Eutrema salsugineum [saltwater cress]
gb|KHG02257.1|  putative metal-nicotianamine transporter YSL5 -li...    223   3e-64   Gossypium arboreum [tree cotton]
ref|XP_004138807.1|  PREDICTED: probable metal-nicotianamine tran...    223   3e-64   Cucumis sativus [cucumbers]
ref|XP_009135543.1|  PREDICTED: probable metal-nicotianamine tran...    223   3e-64   Brassica rapa
ref|XP_004158540.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    222   4e-64   
gb|KJB75155.1|  hypothetical protein B456_012G027400                    222   4e-64   Gossypium raimondii
ref|XP_004515282.1|  PREDICTED: probable metal-nicotianamine tran...    222   4e-64   Cicer arietinum [garbanzo]
emb|CDY46051.1|  BnaC01g34980D                                          224   6e-64   Brassica napus [oilseed rape]
ref|XP_010470452.1|  PREDICTED: probable metal-nicotianamine tran...    221   6e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010487657.1|  PREDICTED: probable metal-nicotianamine tran...    222   6e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007152542.1|  hypothetical protein PHAVU_004G138900g             221   8e-64   Phaseolus vulgaris [French bean]
ref|XP_004976283.1|  PREDICTED: probable metal-nicotianamine tran...    221   9e-64   Setaria italica
emb|CDY68937.1|  BnaCnng61140D                                          222   9e-64   Brassica napus [oilseed rape]
ref|XP_010551587.1|  PREDICTED: probable metal-nicotianamine tran...    221   9e-64   Tarenaya hassleriana [spider flower]
ref|NP_001185468.1|  yellow stripe-like transporter 12                  221   1e-63   Zea mays [maize]
ref|XP_010943908.1|  PREDICTED: probable metal-nicotianamine tran...    221   1e-63   Elaeis guineensis
gb|KDP41617.1|  hypothetical protein JCGZ_16024                         221   1e-63   Jatropha curcas
ref|XP_010551578.1|  PREDICTED: probable metal-nicotianamine tran...    220   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_007211297.1|  hypothetical protein PRUPE_ppa001999mg             221   2e-63   Prunus persica
ref|XP_002277292.1|  PREDICTED: probable metal-nicotianamine tran...    221   2e-63   Vitis vinifera
gb|ABB76762.1|  YSL transporter 2                                       221   2e-63   Noccaea caerulescens
ref|XP_002891428.1|  hypothetical protein ARALYDRAFT_473974             220   2e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_010465820.1|  PREDICTED: probable metal-nicotianamine tran...    220   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010505667.1|  PREDICTED: probable metal-nicotianamine tran...    220   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_003620154.1|  Yellow stripe-like protein 2.1                     220   3e-63   Medicago truncatula
emb|CAI44637.1|  OSJNBb0065J09.17                                       219   4e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008801345.1|  PREDICTED: probable metal-nicotianamine tran...    219   5e-63   Phoenix dactylifera
ref|XP_006393421.1|  hypothetical protein EUTSA_v10011269mg             219   5e-63   Eutrema salsugineum [saltwater cress]
ref|XP_006297072.1|  hypothetical protein CARUB_v10013074mg             219   6e-63   Capsella rubella
ref|XP_002446809.1|  hypothetical protein SORBIDRAFT_06g023010          219   6e-63   Sorghum bicolor [broomcorn]
ref|XP_006300806.1|  hypothetical protein CARUB_v10019889mg             219   7e-63   Capsella rubella
gb|KCW57904.1|  hypothetical protein EUGRSUZ_H00651                     218   8e-63   Eucalyptus grandis [rose gum]
ref|NP_566584.1|  putative metal-nicotianamine transporter YSL5         219   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010025985.1|  PREDICTED: probable metal-nicotianamine tran...    220   9e-63   
ref|XP_009107360.1|  PREDICTED: probable metal-nicotianamine tran...    219   9e-63   Brassica rapa
ref|XP_004165464.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    218   1e-62   
ref|XP_002883075.1|  hypothetical protein ARALYDRAFT_479246             218   1e-62   
sp|Q5JQD7.2|YSL12_ORYSJ  RecName: Full=Probable metal-nicotianami...    218   1e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137637.1|  PREDICTED: probable metal-nicotianamine tran...    218   1e-62   
ref|NP_564525.1|  metal-nicotianamine transporter YSL8                  218   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008436975.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    218   2e-62   
ref|XP_009420946.1|  PREDICTED: probable metal-nicotianamine tran...    218   2e-62   
dbj|BAE44205.1|  hypothetical protein                                   218   2e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008240337.1|  PREDICTED: probable metal-nicotianamine tran...    218   2e-62   Prunus mume [ume]
ref|XP_003580167.1|  PREDICTED: probable metal-nicotianamine tran...    218   2e-62   Brachypodium distachyon [annual false brome]
ref|XP_006648859.1|  PREDICTED: probable metal-nicotianamine tran...    217   3e-62   Oryza brachyantha
sp|Q6H7J6.1|YSL14_ORYSJ  RecName: Full=Probable metal-nicotianami...    218   3e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653608.1|  PREDICTED: probable metal-nicotianamine tran...    217   3e-62   
gb|KGN64213.1|  hypothetical protein Csa_1G043160                       217   3e-62   Cucumis sativus [cucumbers]
ref|XP_011035385.1|  PREDICTED: probable metal-nicotianamine tran...    217   4e-62   Populus euphratica
gb|AAD49762.2|AC007932_10  F11A17.8                                     218   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645969.1|  PREDICTED: probable metal-nicotianamine tran...    217   5e-62   Zea mays [maize]
gb|KFK36098.1|  hypothetical protein AALP_AA4G077100                    216   5e-62   Arabis alpina [alpine rockcress]
ref|XP_010549024.1|  PREDICTED: probable metal-nicotianamine tran...    216   7e-62   Tarenaya hassleriana [spider flower]
ref|XP_007210334.1|  hypothetical protein PRUPE_ppa002002mg             216   7e-62   Prunus persica
gb|AAS00697.1|  metal-nicotianamine transporter YSL8                    216   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004953195.1|  PREDICTED: probable metal-nicotianamine tran...    216   1e-61   Setaria italica
gb|AAL09744.1|  AT3g17650/MKP6_20                                       215   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AEQ28190.1|  yellow stripe-like protein 5                            215   2e-61   Malus baccata var. xiaojinensis
gb|EMT06635.1|  Putative metal-nicotianamine transporter YSL14          215   2e-61   
ref|XP_010501891.1|  PREDICTED: probable metal-nicotianamine tran...    213   3e-61   
ref|XP_010933277.1|  PREDICTED: probable metal-nicotianamine tran...    214   6e-61   
ref|XP_010666835.1|  PREDICTED: probable metal-nicotianamine tran...    213   8e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001276131.1|  uncharacterized protein LOC100809484               213   9e-61   Glycine max [soybeans]
ref|XP_008393519.1|  PREDICTED: probable metal-nicotianamine tran...    213   1e-60   
ref|XP_008676713.1|  PREDICTED: uncharacterized protein LOC100272...    213   1e-60   
ref|NP_001152285.1|  yellow stripe-like transporter 14A                 213   1e-60   
ref|XP_006306886.1|  hypothetical protein CARUB_v10008440mg             213   1e-60   Capsella rubella
ref|XP_004978143.1|  PREDICTED: probable metal-nicotianamine tran...    213   1e-60   Setaria italica
ref|XP_010461657.1|  PREDICTED: probable metal-nicotianamine tran...    213   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010479258.1|  PREDICTED: probable metal-nicotianamine tran...    213   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008802875.1|  PREDICTED: probable metal-nicotianamine tran...    206   2e-60   Phoenix dactylifera
gb|AET00398.2|  OPT family oligopeptide transporter                     212   2e-60   Medicago truncatula
ref|XP_009383038.1|  PREDICTED: probable metal-nicotianamine tran...    212   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003617439.1|  Yellow stripe-like protein 2.8                     212   2e-60   
ref|XP_010675190.1|  PREDICTED: probable metal-nicotianamine tran...    212   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006653609.1|  PREDICTED: probable metal-nicotianamine tran...    211   4e-60   
gb|KDO46150.1|  hypothetical protein CISIN_1g005295mg                   211   4e-60   Citrus sinensis [apfelsine]
dbj|BAE91892.1|  hypothetical protein                                   211   4e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002520094.1|  oligopeptide transporter, putative                 211   5e-60   Ricinus communis
ref|XP_010276313.1|  PREDICTED: probable metal-nicotianamine tran...    201   5e-60   Nelumbo nucifera [Indian lotus]
gb|EMT14396.1|  Putative metal-nicotianamine transporter YSL13          211   6e-60   
ref|XP_006441429.1|  hypothetical protein CICLE_v10019091mg             211   7e-60   Citrus clementina [clementine]
ref|XP_002449540.1|  hypothetical protein SORBIDRAFT_05g018520          211   7e-60   Sorghum bicolor [broomcorn]
ref|XP_008669136.1|  PREDICTED: probable metal-nicotianamine tran...    210   1e-59   Zea mays [maize]
ref|XP_002446810.1|  hypothetical protein SORBIDRAFT_06g023020          210   1e-59   Sorghum bicolor [broomcorn]
ref|XP_002452492.1|  hypothetical protein SORBIDRAFT_04g026840          210   1e-59   
dbj|BAJ89062.1|  predicted protein                                      209   2e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92335.1|  predicted protein                                      209   2e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575422.1|  PREDICTED: probable metal-nicotianamine tran...    209   3e-59   Brachypodium distachyon [annual false brome]
ref|XP_003581442.1|  PREDICTED: probable metal-nicotianamine tran...    209   3e-59   Brachypodium distachyon [annual false brome]
ref|XP_009413131.1|  PREDICTED: probable metal-nicotianamine tran...    209   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299460.1|  PREDICTED: probable metal-nicotianamine tran...    209   4e-59   Fragaria vesca subsp. vesca
ref|XP_004500424.1|  PREDICTED: probable metal-nicotianamine tran...    208   4e-59   
emb|CAH67887.1|  OSIGBa0153E02-OSIGBa0093I20.16                         209   4e-59   Oryza sativa [red rice]
sp|Q7X660.1|YSL11_ORYSJ  RecName: Full=Probable metal-nicotianami...    208   5e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010032362.1|  PREDICTED: probable metal-nicotianamine tran...    208   5e-59   
emb|CAH67885.1|  OSIGBa0153E02-OSIGBa0093I20.14                         208   6e-59   Oryza sativa [red rice]
sp|Q7XKF4.2|YSL13_ORYSJ  RecName: Full=Probable metal-nicotianami...    208   9e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006493428.1|  PREDICTED: probable metal-nicotianamine tran...    207   1e-58   Citrus sinensis [apfelsine]
ref|NP_001185810.1|  yellow stripe-like transporter 11                  207   2e-58   Zea mays [maize]
gb|KEH34580.1|  OPT family oligopeptide transporter                     207   2e-58   Medicago truncatula
dbj|BAE91891.1|  hypothetical protein                                   206   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009384580.1|  PREDICTED: probable metal-nicotianamine tran...    206   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002448760.1|  hypothetical protein SORBIDRAFT_06g032720          204   1e-57   Sorghum bicolor [broomcorn]
ref|XP_008805741.1|  PREDICTED: probable metal-nicotianamine tran...    203   4e-57   Phoenix dactylifera
ref|XP_007146944.1|  hypothetical protein PHAVU_006G083800g             202   4e-57   Phaseolus vulgaris [French bean]
gb|KEH34582.1|  OPT family oligopeptide transporter                     202   5e-57   Medicago truncatula
ref|XP_008779403.1|  PREDICTED: probable metal-nicotianamine tran...    202   6e-57   
ref|XP_010940749.1|  PREDICTED: probable metal-nicotianamine tran...    202   9e-57   
sp|Q0J932.2|YSL10_ORYSJ  RecName: Full=Probable metal-nicotianami...    200   4e-56   Oryza sativa Japonica Group [Japonica rice]
gb|AFW59877.1|  hypothetical protein ZEAMMB73_955581                    200   4e-56   
ref|NP_001054241.1|  Os04g0674600                                       200   5e-56   
ref|XP_004976284.1|  PREDICTED: probable metal-nicotianamine tran...    199   8e-56   Setaria italica
ref|XP_009392235.1|  PREDICTED: probable metal-nicotianamine tran...    199   1e-55   
gb|EMT24509.1|  Putative metal-nicotianamine transporter YSL12          199   1e-55   
emb|CBG76262.1|  OO_Ba0005L10-OO_Ba0081K17.13                           197   5e-55   Oryza officinalis
gb|EMT24510.1|  Putative metal-nicotianamine transporter YSL13          197   6e-55   
ref|XP_006653020.1|  PREDICTED: probable metal-nicotianamine tran...    197   6e-55   Oryza brachyantha
emb|CAN70906.1|  hypothetical protein VITISV_043868                     197   6e-55   Vitis vinifera
ref|XP_011072202.1|  PREDICTED: probable metal-nicotianamine tran...    197   7e-55   Sesamum indicum [beniseed]
ref|XP_004148573.1|  PREDICTED: probable metal-nicotianamine tran...    194   5e-54   Cucumis sativus [cucumbers]
ref|XP_004163304.1|  PREDICTED: probable metal-nicotianamine tran...    194   5e-54   
emb|CAE03239.2|  OSJNBa0018M05.14                                       193   1e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008461864.1|  PREDICTED: probable metal-nicotianamine tran...    192   3e-53   Cucumis melo [Oriental melon]
emb|CAJ86097.1|  H0103C06.1                                             192   5e-53   Oryza sativa [red rice]
ref|XP_008441627.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    189   2e-52   Cucumis melo [Oriental melon]
gb|KDO52778.1|  hypothetical protein CISIN_1g044922mg                   190   2e-52   Citrus sinensis [apfelsine]
ref|XP_006484586.1|  PREDICTED: probable metal-nicotianamine tran...    190   2e-52   
ref|XP_006437555.1|  hypothetical protein CICLE_v10030879mg             190   2e-52   Citrus clementina [clementine]
ref|XP_002446812.1|  hypothetical protein SORBIDRAFT_06g023040          190   2e-52   
ref|XP_009592956.1|  PREDICTED: probable metal-nicotianamine tran...    184   5e-52   Nicotiana tomentosiformis
ref|XP_011022272.1|  PREDICTED: probable metal-nicotianamine tran...    188   7e-52   Populus euphratica
gb|KHG05118.1|  putative metal-nicotianamine transporter YSL7 -li...    188   9e-52   Gossypium arboreum [tree cotton]
ref|XP_007043321.1|  YELLOW STRIPE like 7                               187   2e-51   
ref|XP_006484556.1|  PREDICTED: probable metal-nicotianamine tran...    187   2e-51   
gb|KJB79884.1|  hypothetical protein B456_013G070800                    187   3e-51   Gossypium raimondii
ref|XP_008663726.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    187   3e-51   
ref|XP_006437556.1|  hypothetical protein CICLE_v10030844mg             186   4e-51   Citrus clementina [clementine]
emb|CDP01725.1|  unnamed protein product                                177   4e-51   Coffea canephora [robusta coffee]
ref|XP_002532101.1|  oligopeptide transporter, putative                 186   4e-51   Ricinus communis
ref|XP_008340452.1|  PREDICTED: probable metal-nicotianamine tran...    186   6e-51   Malus domestica [apple tree]
gb|EYU39420.1|  hypothetical protein MIMGU_mgv1a002450mg                186   8e-51   Erythranthe guttata [common monkey flower]
emb|CAN76934.1|  hypothetical protein VITISV_024664                     176   9e-51   Vitis vinifera
ref|XP_010245475.1|  PREDICTED: probable metal-nicotianamine tran...    185   1e-50   Nelumbo nucifera [Indian lotus]
gb|EMS55053.1|  putative metal-nicotianamine transporter YSL10          185   2e-50   Triticum urartu
ref|XP_002306389.2|  hypothetical protein POPTR_0005s09670g             185   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009402082.1|  PREDICTED: probable metal-nicotianamine tran...    184   3e-50   
gb|EYU27872.1|  hypothetical protein MIMGU_mgv1a019282mg                184   3e-50   Erythranthe guttata [common monkey flower]
ref|XP_010253872.1|  PREDICTED: probable metal-nicotianamine tran...    184   3e-50   Nelumbo nucifera [Indian lotus]
ref|XP_009758111.1|  PREDICTED: probable metal-nicotianamine tran...    183   4e-50   Nicotiana sylvestris
gb|EEC78242.1|  hypothetical protein OsI_17899                          183   5e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_008221041.1|  PREDICTED: probable metal-nicotianamine tran...    183   5e-50   Prunus mume [ume]
ref|XP_011463452.1|  PREDICTED: probable metal-nicotianamine tran...    183   7e-50   Fragaria vesca subsp. vesca
ref|XP_004978146.1|  PREDICTED: probable metal-nicotianamine tran...    183   7e-50   
gb|AFW58894.1|  hypothetical protein ZEAMMB73_605066                    183   9e-50   
ref|XP_007225160.1|  hypothetical protein PRUPE_ppa002368mg             182   1e-49   
ref|XP_009351712.1|  PREDICTED: probable metal-nicotianamine tran...    182   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_009593227.1|  PREDICTED: probable metal-nicotianamine tran...    181   2e-49   Nicotiana tomentosiformis
ref|XP_008360015.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    182   2e-49   
emb|CBI27130.3|  unnamed protein product                                179   4e-49   Vitis vinifera
gb|ADN33682.1|  oligopeptide transporter                                169   5e-49   Cucumis melo subsp. melo
ref|XP_009768859.1|  PREDICTED: probable metal-nicotianamine tran...    180   5e-49   Nicotiana sylvestris
gb|KDP43290.1|  hypothetical protein JCGZ_24211                         180   6e-49   Jatropha curcas
emb|CAN62811.1|  hypothetical protein VITISV_041555                     179   2e-48   Vitis vinifera
ref|XP_010650300.1|  PREDICTED: probable metal-nicotianamine tran...    178   3e-48   Vitis vinifera
gb|KCW65044.1|  hypothetical protein EUGRSUZ_G02568                     177   5e-48   Eucalyptus grandis [rose gum]
emb|CBI35268.3|  unnamed protein product                                176   6e-48   Vitis vinifera
emb|CAN61174.1|  hypothetical protein VITISV_009380                     167   7e-48   Vitis vinifera
emb|CDP18194.1|  unnamed protein product                                177   7e-48   Coffea canephora [robusta coffee]
ref|XP_002446811.1|  hypothetical protein SORBIDRAFT_06g023030          177   7e-48   
emb|CBI35280.3|  unnamed protein product                                176   7e-48   Vitis vinifera
ref|XP_004289490.1|  PREDICTED: probable metal-nicotianamine tran...    177   7e-48   Fragaria vesca subsp. vesca
ref|XP_006350378.1|  PREDICTED: probable metal-nicotianamine tran...    177   7e-48   Solanum tuberosum [potatoes]
gb|EPS65244.1|  hypothetical protein M569_09533                         177   7e-48   Genlisea aurea
ref|XP_004978145.1|  PREDICTED: probable metal-nicotianamine tran...    176   2e-47   
ref|XP_010101178.1|  putative metal-nicotianamine transporter YSL7      176   2e-47   
emb|CDP16865.1|  unnamed protein product                                176   2e-47   Coffea canephora [robusta coffee]
ref|XP_010068802.1|  PREDICTED: probable metal-nicotianamine tran...    176   2e-47   Eucalyptus grandis [rose gum]
ref|XP_006359441.1|  PREDICTED: probable metal-nicotianamine tran...    176   3e-47   Solanum tuberosum [potatoes]
ref|XP_010249085.1|  PREDICTED: probable metal-nicotianamine tran...    175   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_011000961.1|  PREDICTED: probable metal-nicotianamine tran...    175   4e-47   Populus euphratica
ref|XP_010099817.1|  putative metal-nicotianamine transporter YSL5      167   5e-47   
gb|KHG22766.1|  putative metal-nicotianamine transporter YSL6 -li...    174   6e-47   Gossypium arboreum [tree cotton]
ref|XP_006847868.1|  hypothetical protein AMTR_s00029p00088380          162   6e-47   
ref|XP_004158539.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    174   7e-47   
ref|XP_010556294.1|  PREDICTED: probable metal-nicotianamine tran...    174   8e-47   Tarenaya hassleriana [spider flower]
ref|XP_004231467.1|  PREDICTED: probable metal-nicotianamine tran...    174   9e-47   Solanum lycopersicum
ref|XP_011046069.1|  PREDICTED: probable metal-nicotianamine tran...    174   9e-47   Populus euphratica
gb|KJB70679.1|  hypothetical protein B456_011G086700                    174   1e-46   Gossypium raimondii
gb|EMT14346.1|  Putative metal-nicotianamine transporter YSL8           174   1e-46   
gb|EYU25659.1|  hypothetical protein MIMGU_mgv1a018719mg                162   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_003573299.1|  PREDICTED: probable metal-nicotianamine tran...    174   1e-46   Brachypodium distachyon [annual false brome]
ref|XP_011468195.1|  PREDICTED: probable metal-nicotianamine tran...    173   2e-46   Fragaria vesca subsp. vesca
ref|XP_004306307.1|  PREDICTED: probable metal-nicotianamine tran...    173   2e-46   Fragaria vesca subsp. vesca
ref|XP_002298639.1|  oligopeptide transporter OPT family protein        173   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_004138639.1|  PREDICTED: probable metal-nicotianamine tran...    173   2e-46   Cucumis sativus [cucumbers]
ref|XP_002274559.2|  PREDICTED: probable metal-nicotianamine tran...    173   2e-46   Vitis vinifera
emb|CBI27128.3|  unnamed protein product                                171   3e-46   Vitis vinifera
ref|XP_010514385.1|  PREDICTED: probable metal-nicotianamine tran...    172   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_003549112.1|  PREDICTED: probable metal-nicotianamine tran...    172   4e-46   Glycine max [soybeans]
ref|XP_006844632.1|  hypothetical protein AMTR_s00016p00229010          164   5e-46   
ref|XP_010028979.1|  PREDICTED: probable metal-nicotianamine tran...    172   5e-46   Eucalyptus grandis [rose gum]
ref|XP_006372617.1|  hypothetical protein POPTR_0017s032801g            160   5e-46   
ref|XP_007161672.1|  hypothetical protein PHAVU_001G088900g             172   6e-46   Phaseolus vulgaris [French bean]
gb|KDO59686.1|  hypothetical protein CISIN_1g0442262mg                  164   6e-46   Citrus sinensis [apfelsine]
gb|KGN63126.1|  hypothetical protein Csa_2G404780                       171   8e-46   Cucumis sativus [cucumbers]
ref|XP_007039160.1|  YELLOW STRIPE like 3 isoform 1                     171   8e-46   
gb|KFK33623.1|  hypothetical protein AALP_AA5G037700                    171   8e-46   Arabis alpina [alpine rockcress]
emb|CDP05015.1|  unnamed protein product                                171   9e-46   Coffea canephora [robusta coffee]
ref|XP_006405407.1|  hypothetical protein EUTSA_v10027673mg             171   1e-45   Eutrema salsugineum [saltwater cress]
ref|XP_006395492.1|  hypothetical protein EUTSA_v10003758mg             171   1e-45   Eutrema salsugineum [saltwater cress]
gb|EEE57430.1|  hypothetical protein OsJ_07631                          171   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007039161.1|  YELLOW STRIPE like 3 isoform 2                     171   1e-45   
ref|XP_009140243.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   Brassica rapa
gb|ACE77055.2|  yellow stripe-like protein 6.1                          171   1e-45   Brassica juncea [brown mustard]
ref|XP_010502660.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
dbj|BAB09702.1|  unnamed protein product                                171   1e-45   
ref|XP_009111552.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
ref|NP_198916.2|  putative metal-nicotianamine transporter YSL4         171   1e-45   
ref|XP_004514626.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
ref|XP_004148009.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
ref|XP_010425438.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
ref|XP_004954766.1|  PREDICTED: probable metal-nicotianamine tran...    171   1e-45   
ref|XP_008669135.1|  PREDICTED: probable metal-nicotianamine tran...    171   2e-45   
ref|XP_002877011.1|  hypothetical protein ARALYDRAFT_904909             171   2e-45   
emb|CDY00170.1|  BnaC09g01310D                                          171   2e-45   
ref|XP_003622146.1|  Yellow stripe-like protein 1.1                     170   2e-45   
ref|XP_010441262.1|  PREDICTED: probable metal-nicotianamine tran...    170   2e-45   
ref|XP_008680017.1|  PREDICTED: probable metal-nicotianamine tran...    170   2e-45   
emb|CBI35270.3|  unnamed protein product                                169   2e-45   
ref|XP_006604157.1|  PREDICTED: probable metal-nicotianamine tran...    170   2e-45   
gb|ACL83357.2|  yellow stripe-like protein 6.4                          170   2e-45   
ref|XP_011098915.1|  PREDICTED: probable metal-nicotianamine tran...    170   2e-45   
ref|XP_003553947.1|  PREDICTED: probable metal-nicotianamine tran...    170   3e-45   
ref|XP_008450132.1|  PREDICTED: probable metal-nicotianamine tran...    170   3e-45   
ref|XP_011098916.1|  PREDICTED: probable metal-nicotianamine tran...    170   3e-45   
gb|AAM64930.1|  unknown                                                 170   3e-45   
gb|AAM53283.1|  unknown protein                                         170   3e-45   
ref|XP_007031922.1|  YELLOW STRIPE like 6                               169   3e-45   
ref|XP_006447029.1|  hypothetical protein CICLE_v10014497mg             169   3e-45   
emb|CDY15924.1|  BnaA04g11870D                                          171   3e-45   
ref|NP_566806.1|  putative metal-nicotianamine transporter YSL6         169   3e-45   
ref|XP_006286072.1|  hypothetical protein CARUB_v10007605mg             169   3e-45   
gb|AGT16058.1|  metal-nicotianamine transporter                         169   3e-45   
gb|KDO63888.1|  hypothetical protein CISIN_1g005868mg                   169   3e-45   
ref|XP_002512907.1|  oligopeptide transporter, putative                 165   4e-45   
gb|EAY84201.1|  hypothetical protein OsI_05581                          169   4e-45   
dbj|BAK06445.1|  predicted protein                                      169   4e-45   
ref|XP_009613490.1|  PREDICTED: probable metal-nicotianamine tran...    169   4e-45   
ref|XP_002453180.1|  hypothetical protein SORBIDRAFT_04g001180          169   5e-45   
ref|XP_009398092.1|  PREDICTED: probable metal-nicotianamine tran...    167   5e-45   
ref|XP_010450578.1|  PREDICTED: probable metal-nicotianamine tran...    169   5e-45   
ref|XP_010436039.1|  PREDICTED: probable metal-nicotianamine tran...    169   6e-45   
ref|XP_002870660.1|  hypothetical protein ARALYDRAFT_493877             169   6e-45   
ref|XP_006290684.1|  hypothetical protein CARUB_v10016778mg             169   7e-45   
ref|XP_010112394.1|  putative metal-nicotianamine transporter YSL6      169   7e-45   
ref|XP_009757311.1|  PREDICTED: probable metal-nicotianamine tran...    169   7e-45   
ref|XP_010436040.1|  PREDICTED: probable metal-nicotianamine tran...    168   8e-45   
emb|CDX82356.1|  BnaA03g34650D                                          168   8e-45   
gb|ABD04075.1|  YSL transporter 3                                       168   9e-45   
gb|ABB76763.1|  YSL transporter 3                                       168   1e-44   
emb|CBI27129.3|  unnamed protein product                                167   1e-44   
gb|AFW66781.1|  hypothetical protein ZEAMMB73_792166                    166   1e-44   
ref|XP_010913001.1|  PREDICTED: probable metal-nicotianamine tran...    168   1e-44   
ref|XP_010442922.1|  PREDICTED: metal-nicotianamine transporter Y...    168   1e-44   
ref|XP_006844631.1|  hypothetical protein AMTR_s00016p00228960          168   1e-44   
ref|XP_010252366.1|  PREDICTED: metal-nicotianamine transporter YSL2    168   1e-44   
gb|KHM99726.1|  Putative metal-nicotianamine transporter YSL7           167   1e-44   
gb|EYU31834.1|  hypothetical protein MIMGU_mgv1a002047mg                168   2e-44   
ref|XP_001759545.1|  predicted protein                                  167   2e-44   
gb|KJB19873.1|  hypothetical protein B456_003G122700                    167   2e-44   
ref|XP_009398090.1|  PREDICTED: probable metal-nicotianamine tran...    167   2e-44   
emb|CDO98563.1|  unnamed protein product                                167   2e-44   
emb|CDY20064.1|  BnaA09g01870D                                          169   2e-44   
ref|XP_009405479.1|  PREDICTED: probable metal-nicotianamine tran...    167   2e-44   
ref|XP_010919337.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    166   4e-44   
ref|XP_006487168.1|  PREDICTED: probable metal-nicotianamine tran...    166   4e-44   
ref|XP_006423237.1|  hypothetical protein CICLE_v10027961mg             166   4e-44   
dbj|BAE91888.1|  hypothetical protein                                   166   5e-44   
ref|NP_001045678.1|  Os02g0116400                                       166   5e-44   
dbj|BAD07718.1|  putative iron-phytosiderophore transporter prote...    166   6e-44   
ref|XP_006578881.1|  PREDICTED: metal-nicotianamine transporter Y...    163   6e-44   
dbj|BAB09731.1|  EspB-like protein                                      166   6e-44   
ref|NP_200167.2|  metal-nicotianamine transporter YSL3                  166   6e-44   
ref|XP_002274166.1|  PREDICTED: metal-nicotianamine transporter YSL3    166   7e-44   
emb|CAN77891.1|  hypothetical protein VITISV_016271                     166   7e-44   
ref|XP_010537055.1|  PREDICTED: metal-nicotianamine transporter Y...    166   7e-44   
emb|CBI23058.3|  unnamed protein product                                166   8e-44   
ref|XP_008798980.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    165   8e-44   
ref|XP_004231762.1|  PREDICTED: probable metal-nicotianamine tran...    166   8e-44   
ref|XP_008231092.1|  PREDICTED: probable metal-nicotianamine tran...    166   9e-44   
ref|XP_006338712.1|  PREDICTED: probable metal-nicotianamine tran...    166   9e-44   
ref|XP_010537056.1|  PREDICTED: metal-nicotianamine transporter Y...    166   9e-44   
ref|XP_006491954.1|  PREDICTED: metal-nicotianamine transporter Y...    165   1e-43   
gb|AAS00695.1|  metal-nicotianamine transporter YSL6                    165   1e-43   
ref|XP_006441189.1|  hypothetical protein CICLE_v10019170mg             165   1e-43   
ref|XP_006491948.1|  PREDICTED: metal-nicotianamine transporter Y...    165   1e-43   
ref|XP_006441190.1|  hypothetical protein CICLE_v10019170mg             165   1e-43   
ref|XP_010482755.1|  PREDICTED: metal-nicotianamine transporter Y...    165   1e-43   
ref|XP_004975420.1|  PREDICTED: probable metal-nicotianamine tran...    165   2e-43   
ref|XP_007215002.1|  hypothetical protein PRUPE_ppa002401mg             165   2e-43   
ref|XP_006849121.1|  hypothetical protein AMTR_s00027p00045420          164   2e-43   
ref|XP_003579626.1|  PREDICTED: probable metal-nicotianamine tran...    164   2e-43   
ref|XP_007153093.1|  hypothetical protein PHAVU_003G006400g             164   2e-43   
ref|XP_008803948.1|  PREDICTED: probable metal-nicotianamine tran...    164   2e-43   
gb|KHG05098.1|  Metal-nicotianamine transporter YSL3 -like protein      164   2e-43   
ref|XP_006281523.1|  hypothetical protein CARUB_v10027623mg             163   5e-43   
ref|XP_010267463.1|  PREDICTED: metal-nicotianamine transporter Y...    163   5e-43   
gb|KHN19530.1|  Metal-nicotianamine transporter YSL3                    164   5e-43   
ref|XP_003523338.2|  PREDICTED: metal-nicotianamine transporter Y...    164   5e-43   
gb|KDP41791.1|  hypothetical protein JCGZ_26809                         163   5e-43   
ref|XP_006578879.1|  PREDICTED: metal-nicotianamine transporter Y...    163   5e-43   
ref|XP_009415879.1|  PREDICTED: probable metal-nicotianamine tran...    164   6e-43   
gb|EAZ31384.1|  hypothetical protein OsJ_15512                          163   6e-43   
ref|XP_010445905.1|  PREDICTED: metal-nicotianamine transporter Y...    163   8e-43   
gb|EAZ30539.1|  hypothetical protein OsJ_14587                          163   8e-43   
ref|XP_009351940.1|  PREDICTED: metal-nicotianamine transporter Y...    163   8e-43   
ref|XP_008381368.1|  PREDICTED: metal-nicotianamine transporter Y...    163   8e-43   
ref|XP_011470187.1|  PREDICTED: metal-nicotianamine transporter Y...    162   9e-43   
gb|KEH35475.1|  OPT family oligopeptide transporter                     162   9e-43   
gb|AEQ28192.1|  yellow stripe-like protein 3                            162   1e-42   
ref|XP_006401691.1|  hypothetical protein EUTSA_v10012886mg             162   1e-42   
ref|XP_011470188.1|  PREDICTED: metal-nicotianamine transporter Y...    162   1e-42   
gb|AES72566.2|  OPT family oligopeptide transporter                     162   1e-42   
gb|KDP40380.1|  hypothetical protein JCGZ_02378                         162   2e-42   
emb|CDX80439.1|  BnaC07g30050D                                          156   2e-42   
ref|XP_001751943.1|  predicted protein                                  162   2e-42   
ref|XP_003556608.1|  PREDICTED: probable metal-nicotianamine tran...    162   2e-42   
gb|KCW48666.1|  hypothetical protein EUGRSUZ_K02321                     152   2e-42   
ref|XP_006845874.1|  hypothetical protein AMTR_s00154p00065510          161   3e-42   
emb|CAH66436.1|  OSIGBa0132D06.2                                        161   3e-42   
dbj|BAE91886.1|  hypothetical protein                                   161   3e-42   
sp|Q7XRV2.1|YSL6_ORYSJ  RecName: Full=Probable metal-nicotianamin...    161   3e-42   
gb|AFU82908.1|  yellow stripe-like transporter 3.1                      161   3e-42   
ref|XP_003602315.1|  YSL transporter                                    162   3e-42   
ref|XP_002528372.1|  oligopeptide transporter, putative                 161   3e-42   
ref|XP_006394695.1|  hypothetical protein EUTSA_v10003781mg             161   3e-42   
ref|XP_002515673.1|  oligopeptide transporter, putative                 161   4e-42   
ref|NP_001131175.1|  hypothetical protein                               161   4e-42   
ref|XP_009346777.1|  PREDICTED: probable metal-nicotianamine tran...    161   4e-42   
dbj|BAB11231.1|  unnamed protein product                                160   4e-42   
ref|XP_009346778.1|  PREDICTED: probable metal-nicotianamine tran...    160   4e-42   
ref|XP_008362099.1|  PREDICTED: probable metal-nicotianamine tran...    160   5e-42   
ref|XP_006844634.1|  hypothetical protein AMTR_s00016p00229620          160   5e-42   
ref|NP_197826.2|  metal-nicotianamine transporter YSL2                  160   5e-42   
gb|KHN05985.1|  Metal-nicotianamine transporter YSL3-like protein       160   6e-42   
ref|XP_002864249.1|  predicted protein                                  160   6e-42   
ref|XP_007153094.1|  hypothetical protein PHAVU_003G006500g             160   7e-42   
ref|XP_006581667.1|  PREDICTED: metal-nicotianamine transporter Y...    160   7e-42   
gb|AFP55583.1|  yellow stripe-like protein                              161   8e-42   
gb|KJB37389.1|  hypothetical protein B456_006G203200                    160   8e-42   
ref|XP_006287225.1|  hypothetical protein CARUB_v10000403mg             160   9e-42   
ref|XP_003581443.2|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
ref|XP_009397635.1|  PREDICTED: probable metal-nicotianamine tran...    160   1e-41   
ref|XP_006601048.1|  PREDICTED: metal-nicotianamine transporter Y...    160   1e-41   
ref|XP_003551122.2|  PREDICTED: metal-nicotianamine transporter Y...    160   1e-41   
gb|AEQ28191.1|  yellow stripe-like protein 6                            160   1e-41   
ref|XP_007136481.1|  hypothetical protein PHAVU_009G048800g             159   1e-41   
ref|XP_009344228.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
ref|XP_009344229.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-41   
gb|KDP30688.1|  hypothetical protein JCGZ_16395                         159   1e-41   
gb|KGN57644.1|  hypothetical protein Csa_3G238100                       159   2e-41   
ref|XP_010035301.1|  PREDICTED: metal-nicotianamine transporter Y...    159   2e-41   
ref|XP_002872112.1|  hypothetical protein ARALYDRAFT_489303             159   2e-41   
ref|XP_003579625.1|  PREDICTED: probable metal-nicotianamine tran...    159   2e-41   
gb|KJB37387.1|  hypothetical protein B456_006G203200                    159   2e-41   
ref|XP_008379097.1|  PREDICTED: probable metal-nicotianamine tran...    159   2e-41   
ref|XP_002446309.1|  hypothetical protein SORBIDRAFT_06g013960          159   2e-41   
ref|XP_004146239.1|  PREDICTED: metal-nicotianamine transporter Y...    159   2e-41   
ref|XP_004165023.1|  PREDICTED: metal-nicotianamine transporter Y...    159   2e-41   
gb|KJB37386.1|  hypothetical protein B456_006G203200                    159   2e-41   
ref|XP_010034897.1|  PREDICTED: metal-nicotianamine transporter Y...    159   2e-41   
ref|XP_007220212.1|  hypothetical protein PRUPE_ppa002475mg             159   2e-41   
ref|XP_007140990.1|  hypothetical protein PHAVU_008G157800g             159   2e-41   
ref|XP_007140989.1|  hypothetical protein PHAVU_008G157800g             159   3e-41   
ref|XP_002318472.2|  hypothetical protein POPTR_0012s03180g             158   3e-41   
gb|ADN33766.1|  YSL transporter                                         157   4e-41   
ref|XP_010679992.1|  PREDICTED: probable metal-nicotianamine tran...    158   5e-41   
gb|EPS62701.1|  hypothetical protein M569_12087                         157   5e-41   
gb|KDO53476.1|  hypothetical protein CISIN_1g047730mg                   158   5e-41   
gb|KHG10996.1|  Metal-nicotianamine transporter YSL3 -like protein      157   5e-41   
ref|XP_011075924.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    158   5e-41   
ref|XP_006471126.1|  PREDICTED: metal-nicotianamine transporter Y...    158   5e-41   
ref|XP_010493593.1|  PREDICTED: metal-nicotianamine transporter Y...    157   6e-41   
ref|XP_010493592.1|  PREDICTED: metal-nicotianamine transporter Y...    157   6e-41   
ref|XP_010454748.1|  PREDICTED: metal-nicotianamine transporter Y...    157   6e-41   
ref|XP_010454747.1|  PREDICTED: metal-nicotianamine transporter Y...    157   6e-41   
ref|XP_011043724.1|  PREDICTED: metal-nicotianamine transporter Y...    157   6e-41   
gb|KFK27715.1|  hypothetical protein AALP_AA8G420300                    157   7e-41   
ref|XP_008456006.1|  PREDICTED: metal-nicotianamine transporter Y...    157   8e-41   
gb|KCW83950.1|  hypothetical protein EUGRSUZ_B00835                     157   8e-41   
ref|XP_008456005.1|  PREDICTED: metal-nicotianamine transporter Y...    157   9e-41   
ref|XP_009150965.1|  PREDICTED: metal-nicotianamine transporter YSL2    157   1e-40   
ref|XP_008444004.1|  PREDICTED: metal-nicotianamine transporter Y...    157   1e-40   
ref|XP_002981992.1|  hypothetical protein SELMODRAFT_179245             157   1e-40   
ref|XP_002986072.1|  hypothetical protein SELMODRAFT_123451             157   1e-40   
ref|XP_006653335.1|  PREDICTED: probable metal-nicotianamine tran...    159   1e-40   
ref|NP_001053449.2|  Os04g0542200                                       156   2e-40   
dbj|BAK07087.1|  predicted protein                                      155   2e-40   
ref|XP_004498492.1|  PREDICTED: metal-nicotianamine transporter Y...    156   2e-40   
ref|XP_008234683.1|  PREDICTED: metal-nicotianamine transporter YSL3    156   2e-40   
ref|XP_004498494.1|  PREDICTED: metal-nicotianamine transporter Y...    156   2e-40   
ref|XP_004172903.1|  PREDICTED: metal-nicotianamine transporter Y...    155   2e-40   
ref|XP_010541500.1|  PREDICTED: metal-nicotianamine transporter Y...    155   3e-40   
ref|XP_004150025.1|  PREDICTED: metal-nicotianamine transporter Y...    155   3e-40   
sp|Q7XUJ2.2|YSL9_ORYSJ  RecName: Full=Probable metal-nicotianamin...    156   3e-40   
ref|NP_001268107.1|  YS1-like protein-like                              155   3e-40   
ref|XP_010658081.1|  PREDICTED: YS1-like protein-like isoform X1        155   3e-40   
emb|CBI34579.3|  unnamed protein product                                155   3e-40   
ref|XP_009588601.1|  PREDICTED: metal-nicotianamine transporter Y...    155   3e-40   
ref|XP_009588595.1|  PREDICTED: metal-nicotianamine transporter Y...    155   3e-40   
ref|XP_006431856.1|  hypothetical protein CICLE_v10003961mg             155   4e-40   
ref|XP_010541499.1|  PREDICTED: metal-nicotianamine transporter Y...    155   4e-40   
ref|XP_003556858.1|  PREDICTED: metal-nicotianamine transporter Y...    155   5e-40   
gb|AFB32181.1|  hypothetical protein 0_10167_01                         145   5e-40   
ref|XP_010535963.1|  PREDICTED: probable metal-nicotianamine tran...    155   5e-40   
emb|CAH67443.1|  H0501D11.7                                             155   6e-40   
emb|CAN77515.1|  hypothetical protein VITISV_013366                     154   7e-40   
ref|XP_006372356.1|  hypothetical protein POPTR_0017s00820g             154   7e-40   
gb|EYU45295.1|  hypothetical protein MIMGU_mgv1a002502mg                154   1e-39   
gb|EMS45266.1|  putative metal-nicotianamine transporter YSL6           156   1e-39   
emb|CDX96232.1|  BnaC02g14190D                                          154   2e-39   
ref|XP_009361313.1|  PREDICTED: metal-nicotianamine transporter YSL2    153   2e-39   
ref|XP_009763790.1|  PREDICTED: metal-nicotianamine transporter Y...    153   2e-39   
ref|XP_003556609.1|  PREDICTED: probable metal-nicotianamine tran...    153   2e-39   
ref|XP_009763789.1|  PREDICTED: metal-nicotianamine transporter Y...    152   3e-39   
gb|EMT26359.1|  Putative metal-nicotianamine transporter YSL6           153   3e-39   
ref|XP_009763791.1|  PREDICTED: metal-nicotianamine transporter Y...    152   3e-39   
ref|XP_008376798.1|  PREDICTED: metal-nicotianamine transporter YSL3    152   7e-39   
gb|EMT17260.1|  Putative metal-nicotianamine transporter YSL11          151   8e-39   
ref|XP_008779503.1|  PREDICTED: probable metal-nicotianamine tran...    143   8e-39   
ref|XP_010671369.1|  PREDICTED: metal-nicotianamine transporter Y...    151   8e-39   
ref|XP_010671364.1|  PREDICTED: metal-nicotianamine transporter Y...    151   9e-39   
gb|AFB32178.1|  hypothetical protein 0_10167_01                         142   9e-39   
dbj|BAF48331.1|  putative yellow stripe-like protein                    151   1e-38   
ref|XP_009765494.1|  PREDICTED: metal-nicotianamine transporter Y...    151   1e-38   



>ref|XP_009615007.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Nicotiana tomentosiformis]
Length=689

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 177/203 (87%), Gaps = 4/203 (2%)
 Frame = +1

Query  76   IDSKKNEDSSESG----CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLT  243
            ++ KKN+D+   G     VERIFESKEVPSW++QLT RAF VSF+LGVLFTFIVMKLNLT
Sbjct  9    VNRKKNDDTQIEGEALDSVERIFESKEVPSWQSQLTLRAFVVSFILGVLFTFIVMKLNLT  68

Query  244  TGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggf  423
            TGIIPSLNVSAGLLGFFFVKTWT+ LEKSGFLK PFTRQENTVIQTCVV +SGIAF GGF
Sbjct  69   TGIIPSLNVSAGLLGFFFVKTWTRLLEKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGF  128

Query  424  gsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKL  603
            GSY+FGMSE VAKQ    NN  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKL
Sbjct  129  GSYLFGMSEVVAKQAVEANNAANIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKL  188

Query  604  TYPSGTATAHLIXXFHTPQGAKL  672
            TYPSGTATAHLI  FHTPQGAKL
Sbjct  189  TYPSGTATAHLINSFHTPQGAKL  211



>ref|XP_009794095.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Nicotiana sylvestris]
Length=686

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 174/200 (87%), Gaps = 4/200 (2%)
 Frame = +1

Query  85   KKNEDSSESG----CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            KKN+D+   G     VERIFESKEVPSW++QLT RAF VSF+LGVLFTFIVMKLNLTTGI
Sbjct  9    KKNDDTQIEGEALDSVERIFESKEVPSWQSQLTLRAFVVSFILGVLFTFIVMKLNLTTGI  68

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVKTWT  LEKSGFLK PFTRQENTVIQTCVV +SGIAF GGFGSY
Sbjct  69   IPSLNVSAGLLGFFFVKTWTSLLEKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSY  128

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +FGMSE VAKQ    NN  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYP
Sbjct  129  LFGMSEVVAKQAVEANNEANIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYP  188

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTPQGAKL
Sbjct  189  SGTATAHLINSFHTPQGAKL  208



>ref|XP_004233770.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=694

 Score =   251 bits (641),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 175/198 (88%), Gaps = 2/198 (1%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            D+ +NE++  S  VERIFESKEVPSW++QLT RAFCVSF+LG+LFTFIV+KL+LTTGIIP
Sbjct  21   DTAQNEEALYS--VERIFESKEVPSWQDQLTLRAFCVSFILGILFTFIVLKLSLTTGIIP  78

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNVSAGLLGFFF+KTWTK LEKSG LK PFTRQENTVIQTCVV +SGIAF GGFGSY+F
Sbjct  79   SLNVSAGLLGFFFIKTWTKLLEKSGVLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLF  138

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
             MSE  AKQ T  NN  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSG
Sbjct  139  AMSEVAAKQSTEANNAFNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSG  198

Query  619  TATAHLIXXFHTPQGAKL  672
            TATAHLI  FHTPQGAKL
Sbjct  199  TATAHLINSFHTPQGAKL  216



>ref|XP_006363210.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=692

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 175/204 (86%), Gaps = 6/204 (3%)
 Frame = +1

Query  79   DSKKNEDSSESG------CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNL  240
            ++KKN+D   +        VERIFESKEVPSW+NQLT RAFCVSF+LG+LFTFIV+KL+L
Sbjct  11   NTKKNDDDDITQREEALYSVERIFESKEVPSWQNQLTLRAFCVSFILGILFTFIVLKLSL  70

Query  241  TTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxgg  420
            TTGIIPSLNVSAGLLGFFF+KTWTK LEKSG LK PFTRQENTVIQTCVV +SGIAF GG
Sbjct  71   TTGIIPSLNVSAGLLGFFFLKTWTKLLEKSGILKQPFTRQENTVIQTCVVATSGIAFSGG  130

Query  421  fgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFK  600
            FGSY+F MSE  AKQ T  NN  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFK
Sbjct  131  FGSYLFAMSEVAAKQSTEANNAFNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFK  190

Query  601  LTYPSGTATAHLIXXFHTPQGAKL  672
            LTYPSGTATAHLI  FHTPQGAKL
Sbjct  191  LTYPSGTATAHLINSFHTPQGAKL  214



>ref|XP_009593058.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=713

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = +1

Query  76   IDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGII  255
            ++ ++ E+S++S  VERIFESKEVP+W++QLTFRAF VSFVLG+LFTFIVMKLNLTTGII
Sbjct  39   LEPEQEEESTQS--VERIFESKEVPTWQSQLTFRAFFVSFVLGILFTFIVMKLNLTTGII  96

Query  256  PSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsym  435
            PSLNVSAGLLGFFFVKTWTKFLEKSG+LK PFTRQENTVIQTCVV +SGIAF GGFGSY+
Sbjct  97   PSLNVSAGLLGFFFVKTWTKFLEKSGWLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYL  156

Query  436  fgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPS  615
            FGMSE +AKQ    N  +NIKNP + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPS
Sbjct  157  FGMSEVIAKQSNEDNAADNIKNPSLGWMISFLFVVSFLGLFSVVPLRKIMIIDFKLVYPS  216

Query  616  GTATAHLIXXFHTPQGAKL  672
            GTATAHLI  FHTPQGAKL
Sbjct  217  GTATAHLINSFHTPQGAKL  235



>ref|XP_009798435.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=712

 Score =   248 bits (633),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +1

Query  85   KKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSL  264
            ++ E+S++S  VERIFESKEVP+W++QLTFRAF VSF+LG+LFTFIVMKLNLTTGIIPSL
Sbjct  41   EQEEESTQS--VERIFESKEVPTWQSQLTFRAFFVSFILGILFTFIVMKLNLTTGIIPSL  98

Query  265  NVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgm  444
            NVSAGLLGFFFVKTWTKFLEKSG+LK PFTRQENTVIQTCVV +SGIAF GGFGSY+FGM
Sbjct  99   NVSAGLLGFFFVKTWTKFLEKSGWLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGM  158

Query  445  sESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTA  624
            SE +AKQ    N  +NIKNP + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTA
Sbjct  159  SEVIAKQSNEDNAADNIKNPSLGWMISFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTA  218

Query  625  TAHLIXXFHTPQGAKL  672
            TAHLI  FHTPQGAKL
Sbjct  219  TAHLINSFHTPQGAKL  234



>ref|XP_006343309.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=699

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFESK+VPSW++QLT RAF VS +LG+LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  37   VERIFESKQVPSWQSQLTLRAFFVSLILGILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  96

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTKFL+KSGFLK PFTRQENTVIQTCVV +SGIAF GGFGSY+FGMSE +AKQ T  
Sbjct  97   VKTWTKFLDKSGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSEGIAKQSTEA  156

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N  +N+KNP + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTP
Sbjct  157  NAADNVKNPSLGWMITFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTATAHLINSFHTP  216

Query  658  QGAKL  672
            QGAKL
Sbjct  217  QGAKL  221



>gb|KDP27275.1| hypothetical protein JCGZ_21006 [Jatropha curcas]
Length=690

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 173/195 (89%), Gaps = 2/195 (1%)
 Frame = +1

Query  88   KNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLN  267
            K  +S ES  VE+IFE+K+VP W++QLT RAF VSFVLGVLF+FIVMKLNLTTGIIPSLN
Sbjct  25   KEFESEES--VEKIFEAKQVPKWQSQLTLRAFVVSFVLGVLFSFIVMKLNLTTGIIPSLN  82

Query  268  VSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgms  447
            VSAGLLGFFFVKTWTKFL+K+GFLK PFTRQENTVIQTCVV +SGIAF GGFGSY+FGMS
Sbjct  83   VSAGLLGFFFVKTWTKFLQKAGFLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMS  142

Query  448  ESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTAT  627
            E VAKQ     NP+N+KNP + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTAT
Sbjct  143  EVVAKQSVEAGNPQNVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTAT  202

Query  628  AHLIXXFHTPQGAKL  672
            AHLI  FHTPQGAKL
Sbjct  203  AHLINSFHTPQGAKL  217



>ref|XP_002525883.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF36487.1| oligopeptide transporter, putative [Ricinus communis]
Length=717

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +1

Query  76   IDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGII  255
            + +K ++ S     VE IFE+KEVP+W++QLT RAF VSFVLG+LF+FIVMKLNLTTGII
Sbjct  42   MKTKGDDQSGADDSVEMIFEAKEVPTWKDQLTIRAFVVSFVLGILFSFIVMKLNLTTGII  101

Query  256  PSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsym  435
            PSLNVSAGLLGFFFVKTWTKFL KSG LK PFTRQENTVIQTCVV +SGIAF GGFGSY+
Sbjct  102  PSLNVSAGLLGFFFVKTWTKFLSKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYL  161

Query  436  fgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPS  615
            FGMSE VAKQ T  N   NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKL YPS
Sbjct  162  FGMSEVVAKQSTEANTAGNIKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLIYPS  221

Query  616  GTATAHLIXXFHTPQGAKL  672
            GTATAHLI  FHTPQGAKL
Sbjct  222  GTATAHLINSFHTPQGAKL  240



>gb|EYU25678.1| hypothetical protein MIMGU_mgv1a002252mg [Erythranthe guttata]
Length=695

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +1

Query  85   KKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSL  264
            +++ +++++G +E+ FE  EVP W+ QLT RAF VSFVLG+LFTFIVMKLNLTTGIIPSL
Sbjct  26   QEDANNNDAGSIEKTFEGTEVPPWQKQLTLRAFVVSFVLGILFTFIVMKLNLTTGIIPSL  85

Query  265  NVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgm  444
            NVSAGLLGFFFVKTW+KFLEKSG LK PFTRQENTVIQTCVV +SGIAF GGFGSY+FGM
Sbjct  86   NVSAGLLGFFFVKTWSKFLEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGM  145

Query  445  sESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTA  624
            SE +AKQ T  N+ +N+KNP ++WMIGFLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTA
Sbjct  146  SEVIAKQSTEANDSQNVKNPSLSWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYPSGTA  205

Query  625  TAHLIXXFHTPQGAKL  672
            TAHLI  FHTPQGAKL
Sbjct  206  TAHLINSFHTPQGAKL  221



>gb|EPS73705.1| hypothetical protein M569_01043 [Genlisea aurea]
Length=695

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G+ +  N    E   VE+IFESKEVP W+ QLT RA  VSF+L +LFTFIVMKLNLTTGI
Sbjct  20   GVQTVDNAGKEEIESVEKIFESKEVPPWQRQLTLRAIFVSFILSILFTFIVMKLNLTTGI  79

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVKTWTKFLEKSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  80   IPSLNVSAGLLGFFFVKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSY  139

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +FGMSE +A Q T  N+P+N+KNP +AW+IGFLFVVSFLGLFSVVPLRK+MIIDFKL YP
Sbjct  140  LFGMSEVIASQSTEANDPKNVKNPNLAWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLIYP  199

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTPQGAKL
Sbjct  200  SGTATAHLINSFHTPQGAKL  219



>ref|XP_010245490.1| PREDICTED: probable metal-nicotianamine transporter YSL7, partial 
[Nelumbo nucifera]
Length=502

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            D K+ ED  E   +ERIF+S+E+P W+NQLT RAF VSF+L +LF+FIVMKLNLTTGIIP
Sbjct  30   DKKRLEDD-EKESIERIFDSQEIPPWQNQLTLRAFAVSFLLAILFSFIVMKLNLTTGIIP  88

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNVSAGLLGFFFVKTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+F
Sbjct  89   SLNVSAGLLGFFFVKTWTKFLEKSGMLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLF  148

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMS + AKQ       +NIK+P + WMIGFLF+VSFLGLFSVVPLRK+MIIDFKLTYPSG
Sbjct  149  GMSSAEAKQSAETGAAQNIKDPALGWMIGFLFIVSFLGLFSVVPLRKIMIIDFKLTYPSG  208

Query  619  TATAHLIXXFHTPQGAKL  672
            TATAHLI  FHTPQGA L
Sbjct  209  TATAHLINSFHTPQGANL  226



>ref|XP_006847870.1| hypothetical protein AMTR_s00029p00090040 [Amborella trichopoda]
 gb|ERN09451.1| hypothetical protein AMTR_s00029p00090040 [Amborella trichopoda]
Length=262

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +1

Query  73   GIDS-KKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTG  249
            G DS  ++ED  +   VE+IFESK +P W+ QLTFRAF VSFVLGV+F+ IVMKLNLTTG
Sbjct  14   GYDSTHRDEDERDVLSVEQIFESKTIPPWQEQLTFRAFFVSFVLGVMFSVIVMKLNLTTG  73

Query  250  IIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgs  429
            IIPSLNVSAGLLGFFFVK+WTKFLEK G LK PFTRQENTVIQTCVV  SGIAF GGFGS
Sbjct  74   IIPSLNVSAGLLGFFFVKSWTKFLEKMGLLKQPFTRQENTVIQTCVVACSGIAFSGGFGS  133

Query  430  ymfgmsESVAKQMTIXN-NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            Y+FGMSE++A + T    +P+ IKNPG+ WMIGFLFVVSFLGLFS+VPLRK+M+ID+KLT
Sbjct  134  YLFGMSETIAHRSTDGPIDPQTIKNPGLGWMIGFLFVVSFLGLFSIVPLRKIMVIDYKLT  193

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YPSGTATA LI  FHTPQGAKL
Sbjct  194  YPSGTATALLINSFHTPQGAKL  215



>ref|XP_004234495.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=696

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
             +K+ ++  E   VERIFESK+V SW +QLT RAF VS +LG+LFTFIVMKLNLTTGIIP
Sbjct  17   STKRIQEEQEVQSVERIFESKQVSSWESQLTLRAFFVSLLLGILFTFIVMKLNLTTGIIP  76

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNVSAGLLGFFFVKTWTKFL+KSG LK PFTRQENTVIQTCVV +SGIAF GGFGSY+F
Sbjct  77   SLNVSAGLLGFFFVKTWTKFLDKSGVLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLF  136

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMSE +AKQ T  N  +N+KNP + WMI FL VVSFLGLFSVVPLRK+MIIDFKL YPSG
Sbjct  137  GMSEVIAKQSTEANAADNVKNPSLGWMITFLLVVSFLGLFSVVPLRKIMIIDFKLIYPSG  196

Query  619  TATAHLIXXFHTPQGAKL  672
            TATAHLI  FHTPQGAKL
Sbjct  197  TATAHLINSFHTPQGAKL  214



>ref|XP_011097988.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=693

 Score =   240 bits (613),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 155/182 (85%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = +1

Query  127  IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  306
            IFES+EVP W+ QLTFRAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  37   IFESREVPPWQKQLTFRAFIVSFVLAVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  96

Query  307  WTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNP  486
            WTKFLEKSG LK PFTRQENTVIQTCVV +SGIAF GGFGSY+FGMSE VAKQ T  N+ 
Sbjct  97   WTKFLEKSGLLKQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSEVVAKQSTEANDA  156

Query  487  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGA  666
             +IKNP +AWMIGFLFVVSFLGLFSV+PLRK+MIIDFKL YPSGTATAHLI  FHTPQGA
Sbjct  157  LDIKNPSLAWMIGFLFVVSFLGLFSVLPLRKIMIIDFKLIYPSGTATAHLINSFHTPQGA  216

Query  667  KL  672
            KL
Sbjct  217  KL  218



>ref|XP_011046075.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X5 [Populus euphratica]
Length=699

 Score =   237 bits (604),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 152/185 (82%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  39   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  98

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS++VAKQ+T  
Sbjct  99   IKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDTVAKQLT--  156

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFS VPLRKVMIIDFKLTYPSGTATAHLI  FHTP
Sbjct  157  EDSDAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  216

Query  658  QGAKL  672
             GAKL
Sbjct  217  AGAKL  221



>ref|XP_002266657.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=708

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  46   VERIFEGKEVPSWREQLTVRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  105

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V  WTKFL+KSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS+++AKQ    
Sbjct  106  VSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSQAIAKQSENA  165

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
               E  KNP VAWMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLI  FHTP
Sbjct  166  GGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHTP  225

Query  658  QGAKL  672
            QGAKL
Sbjct  226  QGAKL  230



>ref|XP_006372622.1| iron transporter-related family protein [Populus trichocarpa]
 gb|ERP50419.1| iron transporter-related family protein [Populus trichocarpa]
Length=698

 Score =   234 bits (598),  Expect = 9e-69, Method: Composition-based stats.
 Identities = 154/185 (83%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE+VAKQ T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAKQST--  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LI  FHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  AGAKL  220



>ref|XP_011016255.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Populus 
euphratica]
Length=471

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE++EVPSWRNQLT RAF VSFVL +LFT IVMKLNLTTGI+PSLN+SAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFTVIVMKLNLTTGILPSLNISAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIA  GGFG+Y+FGMSE+VAKQ T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIANSGGFGNYLFGMSETVAKQST--  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
               +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMI+DFKLTYPSGTAT HLI  FHTP
Sbjct  156  EYRDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIVDFKLTYPSGTATGHLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  TGAKL  220



>ref|XP_011046073.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X3 [Populus euphratica]
Length=700

 Score =   234 bits (598),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 152/185 (82%), Positives = 165/185 (89%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER FE++EVPSWRNQLT RAF +SFVL +LFT IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS++VAKQ+T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGSYLFGMSDTVAKQLT--  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFS VPLRKVMIIDFKLTYPSGTATAHLI  FHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  AGAKL  220



>ref|XP_002269277.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=704

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+FE KEVPSWR QLT RAF V FVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  42   VERLFEGKEVPSWREQLTVRAFVVRFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  101

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V  WTKFL+KSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS+++AKQ    
Sbjct  102  VSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSQAIAKQSENA  161

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
               E  KNP VAWMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLI  FHTP
Sbjct  162  GGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFHTP  221

Query  658  QGAKL  672
            QGAKL
Sbjct  222  QGAKL  226



>ref|XP_011046072.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Populus euphratica]
Length=701

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  39   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  98

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS++VAKQ+T  
Sbjct  99   IKTWTKFLEKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDTVAKQLT--  156

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFS VPLRKVMIIDFKLTYPSGTATAHLI  FHTP
Sbjct  157  EDSDAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  216

Query  658  QGAKL  672
             GAKL
Sbjct  217  AGAKL  221



>ref|XP_006391519.1| hypothetical protein EUTSA_v10018216mg [Eutrema salsugineum]
 gb|ESQ28805.1| hypothetical protein EUTSA_v10018216mg [Eutrema salsugineum]
Length=691

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 170/196 (87%), Gaps = 2/196 (1%)
 Frame = +1

Query  91   NEDSSESGCVERIFE-SKEVPS-WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSL  264
            + +S+E   VERIFE S EVP  W+NQLTFRA  VSFVL +LFTF+VMKLNLTTGIIPSL
Sbjct  20   DGESAEEVSVERIFEASSEVPPPWQNQLTFRAMIVSFVLSILFTFVVMKLNLTTGIIPSL  79

Query  265  NVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgm  444
            N+SAGLLGFFFVKTWTK L K GFLK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGM
Sbjct  80   NISAGLLGFFFVKTWTKLLHKGGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGM  139

Query  445  sESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTA  624
            S+ VAKQ +  N+P NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MI+DFKLTYPSGTA
Sbjct  140  SDVVAKQSSEANSPLNIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTA  199

Query  625  TAHLIXXFHTPQGAKL  672
            TAHLI  FHTPQGAKL
Sbjct  200  TAHLINSFHTPQGAKL  215



>ref|XP_010112419.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
 gb|EXC33540.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
Length=692

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 169/198 (85%), Gaps = 3/198 (2%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            + K   +  ES  VERIF S+EVPSWRNQLT RAF VSFVL +LFTFIVMKLNLTTGIIP
Sbjct  23   NQKMKREEGESLSVERIFASQEVPSWRNQLTVRAFVVSFVLSILFTFIVMKLNLTTGIIP  82

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNVSAGLLGFFFVK WTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+F
Sbjct  83   SLNVSAGLLGFFFVKVWTKFLEKSGILKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLF  142

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMS+ +AK     ++  + KNP +AW+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSG
Sbjct  143  GMSKRIAKD---SSDTSDFKNPSLAWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSG  199

Query  619  TATAHLIXXFHTPQGAKL  672
            TATAHLI  FHTP+GAKL
Sbjct  200  TATAHLINSFHTPEGAKL  217



>ref|XP_006372353.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50150.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=680

 Score =   233 bits (593),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 153/185 (83%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE+VA+Q T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAEQST--  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LI  FHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  AGAKL  220



>ref|XP_006372354.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50151.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=698

 Score =   233 bits (593),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 153/185 (83%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE++EVPSWRNQLT RAF VSFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRAFVVSFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE+VA+Q T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAEQST--  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LI  FHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  AGAKL  220



>ref|XP_006372621.1| hypothetical protein POPTR_0017s03320g [Populus trichocarpa]
 gb|ERP50418.1| hypothetical protein POPTR_0017s03320g [Populus trichocarpa]
Length=698

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 164/185 (89%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE++EVPSWRNQLT RA  VSFVL +LF  IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERIFENQEVPSWRNQLTLRALVVSFVLSILFCVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE+VAKQ+T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETVAKQLT--  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFS VPLRKVMIIDFKLTYPSGTATAHLI  FHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSAVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  AGAKL  220



>gb|KFK41018.1| hypothetical protein AALP_AA2G074700 [Arabis alpina]
Length=690

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 171/204 (84%), Gaps = 2/204 (1%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFE--SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNL  240
            DL   +  + +S+E   VERIFE   +  P+W+NQLTFRA  VSF+L +LFTF+VMKLNL
Sbjct  11   DLNNAATVDGESTEEVSVERIFEVSGEAPPAWQNQLTFRAMIVSFILSILFTFVVMKLNL  70

Query  241  TTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxgg  420
            TTGIIPSLN+SAGLLGFFFVKTWTK L K+GFLK PFTRQENTVIQTCVV SSGIAF GG
Sbjct  71   TTGIIPSLNISAGLLGFFFVKTWTKLLHKAGFLKQPFTRQENTVIQTCVVASSGIAFSGG  130

Query  421  fgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFK  600
            FGSY+FGMS+ VAKQ    N P NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MI+DFK
Sbjct  131  FGSYLFGMSDIVAKQSGEANTPINIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFK  190

Query  601  LTYPSGTATAHLIXXFHTPQGAKL  672
            LTYPSGTATAHLI  FHTPQGAKL
Sbjct  191  LTYPSGTATAHLINSFHTPQGAKL  214



>ref|XP_007029356.1| YELLOW STRIPE like 5 [Theobroma cacao]
 gb|EOY09858.1| YELLOW STRIPE like 5 [Theobroma cacao]
Length=689

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 167/198 (84%), Gaps = 3/198 (2%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            D +K E       VE+IFES+EVPSWR QLT RAF VSFVL +LF+FIVMKLNLTTGIIP
Sbjct  20   DDRKKEMKEAEMSVEQIFESQEVPSWRKQLTMRAFAVSFVLSILFSFIVMKLNLTTGIIP  79

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNVSAGLLGFFFVKTWTK LEKSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+F
Sbjct  80   SLNVSAGLLGFFFVKTWTKMLEKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLF  139

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMSE +A+Q     +   +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDF+LTYPSG
Sbjct  140  GMSERIAQQ---SGDTRGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFRLTYPSG  196

Query  619  TATAHLIXXFHTPQGAKL  672
            TATAHLI  FHTPQGAKL
Sbjct  197  TATAHLINSFHTPQGAKL  214



>gb|ABB76761.1| YSL transporter 1 [Noccaea caerulescens]
 gb|ABD04076.1| YSL transporter 1 [Noccaea caerulescens]
Length=693

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 170/204 (83%), Gaps = 2/204 (1%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFES--KEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNL  240
            +  + +  +  S+E   VERIFE+  +  P+W+NQLT RA  VSFVL +LFTF+VMKLNL
Sbjct  13   NAAVTTAGDGGSAEEASVERIFEANGEAPPTWQNQLTIRAMIVSFVLSILFTFVVMKLNL  72

Query  241  TTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxgg  420
            TTGIIPSLN+SAGLLGFFFVKTWTK L K+GFLK PFTRQENTVIQTCVV SSGIAF GG
Sbjct  73   TTGIIPSLNISAGLLGFFFVKTWTKLLSKAGFLKQPFTRQENTVIQTCVVASSGIAFSGG  132

Query  421  fgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFK  600
            FGSY+FGMS+ VAKQ    N P NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MI+DFK
Sbjct  133  FGSYLFGMSDVVAKQSADANTPLNIKNPHLGWMIGFLFIVSFLGLFSVVPLRKIMIVDFK  192

Query  601  LTYPSGTATAHLIXXFHTPQGAKL  672
            LTYPSGTATAHLI  FHTPQGAKL
Sbjct  193  LTYPSGTATAHLINSFHTPQGAKL  216



>gb|KCW48664.1| hypothetical protein EUGRSUZ_K02319 [Eucalyptus grandis]
Length=564

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G  S++ +D S     ERIFE + VPSW  QLTFRAF VSF+L ++F FIVMKLNLT GI
Sbjct  37   GSRSRRGQDESNGLSAERIFEGQAVPSWGRQLTFRAFAVSFMLSIMFAFIVMKLNLTAGI  96

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVKTWTK L+KSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  97   IPSLNVSAGLLGFFFVKTWTKVLDKSGLLQVPFTRQENTVIQTCVVASSGIAFSGGFGSY  156

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +F MS  VA Q T   +    KNP +AWMIGFLFVVSFLGLF+VVPLRK+MIIDFKLTYP
Sbjct  157  LFAMSARVAGQSTDPQSAHVFKNPSLAWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYP  216

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTPQGAKL
Sbjct  217  SGTATAHLINSFHTPQGAKL  236



>ref|XP_011035386.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Populus 
euphratica]
Length=684

 Score =   231 bits (588),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 150/185 (81%), Positives = 167/185 (90%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+FE++EVPSWRNQLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  24   VERVFENQEVPSWRNQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  83

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKF+E+SG LK PFTRQ+NTVIQTCVV SSGIAF GGFGSY+FGMSE+VAKQ T  
Sbjct  84   IKTWTKFVERSGLLKQPFTRQKNTVIQTCVVASSGIAFSGGFGSYLFGMSEAVAKQST--  141

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMI+DFKLTYPSGTATA+LI  FHTP
Sbjct  142  EHTDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIVDFKLTYPSGTATAYLINSFHTP  201

Query  658  QGAKL  672
             GAKL
Sbjct  202  AGAKL  206



>ref|NP_176750.1| putative metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
 sp|Q9SHY2.1|YSL7_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL7; 
AltName: Full=Protein YELLOW STRIPE LIKE 7; Short=AtYSL7 [Arabidopsis 
thaliana]
 gb|AAF23830.1|AC007234_2 F1E22.10 [Arabidopsis thaliana]
 gb|AAO22767.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04062.1| unknown protein [Arabidopsis thaliana]
 gb|AAS00696.1| metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
 gb|AEE34418.1| putative metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
Length=688

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 171/204 (84%), Gaps = 4/204 (2%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFE-SKEVPS-WRNQLTFRAFCVSFVLGVLFTFIVMKLNL  240
            DL   SK NE+   S  VERIFE S E+P  W+ QLTFRA  VSF+L +LFTF+VMKLNL
Sbjct  11   DLNNGSKSNEEEEIS--VERIFEESNEIPPPWQKQLTFRALIVSFILAILFTFVVMKLNL  68

Query  241  TTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxgg  420
            TTGIIPSLN+SAGLLGFFFVK+WTK L K+GFLK PFTRQENTVIQTCVV SSGIAF GG
Sbjct  69   TTGIIPSLNISAGLLGFFFVKSWTKILNKAGFLKQPFTRQENTVIQTCVVASSGIAFSGG  128

Query  421  fgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFK  600
            FGSY+FGMS+ VAKQ    N P NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFK
Sbjct  129  FGSYLFGMSDVVAKQSAEANTPLNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFK  188

Query  601  LTYPSGTATAHLIXXFHTPQGAKL  672
            LTYPSGTATAHLI  FHTPQGAKL
Sbjct  189  LTYPSGTATAHLINSFHTPQGAKL  212



>ref|XP_011046070.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Populus euphratica]
Length=704

 Score =   231 bits (588),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 150/185 (81%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER FE++EVPSWRNQLT RAF +SFVL +LFT IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFG Y+ GMSE+VA+Q T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGHYLLGMSETVARQST--  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LI  FHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  AGAKL  220



>ref|XP_011046074.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X4 [Populus euphratica]
Length=700

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER FE++EVPSWRNQLT RAF +SFVL +LFT IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERKFENQEVPSWRNQLTLRAFVLSFVLSILFTVIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTKFLEKSG LK PFTRQENTVIQTCVV SSGIAF GGFG Y+ GMSE+VA+Q T  
Sbjct  98   IKTWTKFLEKSGLLKQPFTRQENTVIQTCVVASSGIAFNGGFGHYLLGMSETVARQST--  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +  KNP ++WMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAHLI  FHTP
Sbjct  156  EDSDAFKNPSLSWMIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAHLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  AGAKL  220



>gb|KCW48659.1| hypothetical protein EUGRSUZ_K02315 [Eucalyptus grandis]
Length=531

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G  S  +ED S    VERIFE + VPSWR QLTFRAF VSFVL V+F FIVMKLNLT GI
Sbjct  36   GGGSGSSEDESNGLSVERIFEGQGVPSWRGQLTFRAFAVSFVLSVMFAFIVMKLNLTAGI  95

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVKTWTK L+KSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  96   IPSLNVSAGLLGFFFVKTWTKVLDKSGLLRVPFTRQENTVIQTCVVASSGIAFSGGFGSY  155

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +F MS+ VA Q       +  K+P ++WMIGFLFVVSFLGLF+VVPLRK+MIIDFKLTYP
Sbjct  156  LFAMSKRVADQSKDPQRAQVFKDPSLSWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYP  215

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTP+GAKL
Sbjct  216  SGTATAHLINSFHTPEGAKL  235



>ref|XP_010037025.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48660.1| hypothetical protein EUGRSUZ_K02316 [Eucalyptus grandis]
Length=702

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = +1

Query  82   SKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPS  261
            S+  ED S    VERIFES+ VPSWR QLTFRAF VSF L V+F FIVMKLNLTTGIIPS
Sbjct  28   SRSGEDESNGLSVERIFESQGVPSWRRQLTFRAFAVSFALSVIFAFIVMKLNLTTGIIPS  87

Query  262  LNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfg  441
            LNVSAGLLGFFFVKTWTK L+KSG L+ PFTRQENTVIQTCVV SSGIAF GGFGS++F 
Sbjct  88   LNVSAGLLGFFFVKTWTKVLDKSGLLQVPFTRQENTVIQTCVVASSGIAFSGGFGSFLFA  147

Query  442  msESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGT  621
            MSE VA+Q T   +    KNP + WM GFLFVVSFLGLF+VVPLRK+MIIDFKL+YPSGT
Sbjct  148  MSERVARQSTDPQSAPVYKNPSLLWMTGFLFVVSFLGLFAVVPLRKIMIIDFKLSYPSGT  207

Query  622  ATAHLIXXFHTPQGAKL  672
            ATAHLI  FHTP+GAKL
Sbjct  208  ATAHLINSFHTPEGAKL  224



>ref|XP_002269403.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=708

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFESKEVPSWR QLT RAF VS V+GVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  46   VERIFESKEVPSWREQLTVRAFVVSLVVGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  105

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
               WTKFL+ SG LK PFTRQENTVIQTCVV  SGIAF GGFGSY+FGMSE VAK+    
Sbjct  106  TSGWTKFLDNSGLLKQPFTRQENTVIQTCVVAISGIAFSGGFGSYLFGMSEVVAKESEDV  165

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + ++ KNP + WMIGFLFVVSFLGLFSV+PLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  166  QSSQDYKNPAIGWMIGFLFVVSFLGLFSVLPLRKIMIIDFKLTYPSGTATAHLINSFHTP  225

Query  658  QGAKL  672
            +GA+L
Sbjct  226  EGARL  230



>ref|XP_010940334.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=709

 Score =   228 bits (582),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 142/185 (77%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +ER+F+ K VP+WR QLT RAF VS +LGV+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   MERVFDEKPVPTWREQLTVRAFAVSALLGVMFSIIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TW + LEK+G LK PFTRQENTVIQTCVV +SGIAF GGFGSY+F MS+++AKQ T  
Sbjct  104  VRTWARVLEKTGLLKQPFTRQENTVIQTCVVATSGIAFSGGFGSYLFAMSDTIAKQTTEE  163

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+ +NIKNP + WMIGFLFVVSFLGLFS+VPLRK+MIID+KLTYPSGTATAHLI  FHTP
Sbjct  164  NDAQNIKNPKLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLTYPSGTATAHLINSFHTP  223

Query  658  QGAKL  672
            QGAKL
Sbjct  224  QGAKL  228



>ref|XP_010037026.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48663.1| hypothetical protein EUGRSUZ_K02319 [Eucalyptus grandis]
Length=714

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G  S++ +D S     ERIFE + VPSW  QLTFRAF VSF+L ++F FIVMKLNLT GI
Sbjct  37   GSRSRRGQDESNGLSAERIFEGQAVPSWGRQLTFRAFAVSFMLSIMFAFIVMKLNLTAGI  96

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVKTWTK L+KSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  97   IPSLNVSAGLLGFFFVKTWTKVLDKSGLLQVPFTRQENTVIQTCVVASSGIAFSGGFGSY  156

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +F MS  VA Q T   +    KNP +AWMIGFLFVVSFLGLF+VVPLRK+MIIDFKLTYP
Sbjct  157  LFAMSARVAGQSTDPQSAHVFKNPSLAWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYP  216

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTPQGAKL
Sbjct  217  SGTATAHLINSFHTPQGAKL  236



>ref|XP_011072072.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=697

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 168/203 (83%), Gaps = 3/203 (1%)
 Frame = +1

Query  73   GIDSKKNED---SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLT  243
            G+D ++ E      E   VERIFE+KEVPSWR QLT RAF VSF+L V+F FIVMKLNLT
Sbjct  17   GMDDERKEKFMKEDEKLSVERIFENKEVPSWRKQLTVRAFAVSFLLSVMFCFIVMKLNLT  76

Query  244  TGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggf  423
            TGIIPSLNVSAGLLGFFFVKTWTK + KSG L+ PFTRQENTVIQTCVV SSGIAF GGF
Sbjct  77   TGIIPSLNVSAGLLGFFFVKTWTKLIAKSGMLRQPFTRQENTVIQTCVVASSGIAFSGGF  136

Query  424  gsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKL  603
            GSY+FGMSE +A+Q     +  + KNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKL
Sbjct  137  GSYLFGMSEQIAQQSEHRKDGFDYKNPSLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKL  196

Query  604  TYPSGTATAHLIXXFHTPQGAKL  672
            TYPSGTATAHLI  FHTP+GAKL
Sbjct  197  TYPSGTATAHLINSFHTPEGAKL  219



>gb|ACD77012.1| metal transporter protein [Brassica juncea]
Length=689

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 169/208 (81%), Gaps = 11/208 (5%)
 Frame = +1

Query  82   SKKNED---------SSESGCVERIFE--SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVM  228
            +KK++D         S+E   VERIFE  +   P+W+NQLTFRA  VSF+L +LFTF+VM
Sbjct  6    AKKDDDLNSADGGGGSAEEVSVERIFEESADAPPAWQNQLTFRAMIVSFILSILFTFVVM  65

Query  229  KLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgia  408
            KLNLTTGIIPSLN+SAGLL FFFVKTWTK L K+G LK PFTRQENTVIQTCVV SSGIA
Sbjct  66   KLNLTTGIIPSLNISAGLLSFFFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIA  125

Query  409  fxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMI  588
            F GGFGSY+FGMSE VAKQ    N P NIKNP + WMIGFLF VSFLGLFSVVPLRK+MI
Sbjct  126  FSGGFGSYLFGMSEVVAKQSAEANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMI  185

Query  589  IDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            +DFKLTYPSGTATAHLI  FHTPQGAKL
Sbjct  186  VDFKLTYPSGTATAHLINSFHTPQGAKL  213



>ref|XP_010037024.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48658.1| hypothetical protein EUGRSUZ_K02315 [Eucalyptus grandis]
Length=713

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G  S  +ED S    VERIFE + VPSWR QLTFRAF VSFVL V+F FIVMKLNLT GI
Sbjct  36   GGGSGSSEDESNGLSVERIFEGQGVPSWRGQLTFRAFAVSFVLSVMFAFIVMKLNLTAGI  95

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVKTWTK L+KSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  96   IPSLNVSAGLLGFFFVKTWTKVLDKSGLLRVPFTRQENTVIQTCVVASSGIAFSGGFGSY  155

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +F MS+ VA Q       +  K+P ++WMIGFLFVVSFLGLF+VVPLRK+MIIDFKLTYP
Sbjct  156  LFAMSKRVADQSKDPQRAQVFKDPSLSWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLTYP  215

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTP+GAKL
Sbjct  216  SGTATAHLINSFHTPEGAKL  235



>ref|XP_009105166.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Brassica 
rapa]
 emb|CDY07462.1| BnaA07g25410D [Brassica napus]
Length=690

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 165/204 (81%), Gaps = 2/204 (1%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFE--SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNL  240
            DL         S+E   VERIFE  +   P+W+NQLTFRA  VSF+L +LFTF+VMKLNL
Sbjct  11   DLNSADGGGGGSAEEVSVERIFEESADAPPAWQNQLTFRAMIVSFILSILFTFVVMKLNL  70

Query  241  TTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxgg  420
            TTGIIPSLN+SAGLL FFFVKTWTK L K+G LK PFTRQENTVIQTCVV SSGIAF GG
Sbjct  71   TTGIIPSLNISAGLLSFFFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIAFSGG  130

Query  421  fgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFK  600
            FGSY+FGMSE VAKQ    N P NIKNP + WMIGFLF VSFLGLFSVVPLRK+MI+DFK
Sbjct  131  FGSYLFGMSEVVAKQSAEANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMIVDFK  190

Query  601  LTYPSGTATAHLIXXFHTPQGAKL  672
            LTYPSGTATAHLI  FHTPQGAKL
Sbjct  191  LTYPSGTATAHLINSFHTPQGAKL  214



>ref|XP_010039025.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48662.1| hypothetical protein EUGRSUZ_K02318 [Eucalyptus grandis]
Length=707

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G  S   ED +    VERIFE + VPSWR QLTFRAF VSF L V+F FIVMKLNL TGI
Sbjct  30   GSQSWSWEDENNGLLVERIFEGQGVPSWRRQLTFRAFAVSFALNVMFAFIVMKLNLMTGI  89

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVKTWTK LEKSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  90   IPSLNVSAGLLGFFFVKTWTKVLEKSGLLRVPFTRQENTVIQTCVVASSGIAFSGGFGSY  149

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +F M+E VA Q T   +    KNP + WMIGFLFVVSFLGL +VVPLRK+MIIDFKLTYP
Sbjct  150  LFAMNERVANQSTDTQSAHVYKNPSLLWMIGFLFVVSFLGLLAVVPLRKIMIIDFKLTYP  209

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTP+GAKL
Sbjct  210  SGTATAHLINSFHTPEGAKL  229



>ref|XP_010511122.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Camelina 
sativa]
Length=691

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 172/208 (83%), Gaps = 11/208 (5%)
 Frame = +1

Query  82   SKKNEDSSESGC---------VERIFE-SKEVP-SWRNQLTFRAFCVSFVLGVLFTFIVM  228
            SKK++D + +G          VERIFE S EVP SW++QLTFRA  VSF+L +LFTF+VM
Sbjct  8    SKKDDDLATNGSGGTEEEEVSVERIFEASHEVPPSWQHQLTFRALIVSFILAILFTFVVM  67

Query  229  KLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgia  408
            KLNLTTGIIPSLN+SAGLLGFFFVKTWTK L K+G LK PFTRQENTVIQTCVV SSGIA
Sbjct  68   KLNLTTGIIPSLNISAGLLGFFFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIA  127

Query  409  fxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMI  588
            F GGFGSY+FGMS+ VAKQ    N   NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI
Sbjct  128  FSGGFGSYLFGMSDVVAKQSAEANTAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMI  187

Query  589  IDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            +DFKLTYPSGTATAHLI  FHTPQGAKL
Sbjct  188  VDFKLTYPSGTATAHLINSFHTPQGAKL  215



>ref|XP_002886962.1| hypothetical protein ARALYDRAFT_475677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63221.1| hypothetical protein ARALYDRAFT_475677 [Arabidopsis lyrata subsp. 
lyrata]
Length=693

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +1

Query  118  VERIFE-SKEVPS-WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  291
            VERIFE S E+P  W+ QLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  31   VERIFEASHEIPPPWQKQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLGF  90

Query  292  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMT  471
            FFVKTWTK L K+GFLK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS+ VAKQ  
Sbjct  91   FFVKTWTKILNKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQSA  150

Query  472  IXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFH  651
              N P NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLI  FH
Sbjct  151  EANTPMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  210

Query  652  TPQGAKL  672
            TPQGAKL
Sbjct  211  TPQGAKL  217



>emb|CAN72423.1| hypothetical protein VITISV_014262 [Vitis vinifera]
Length=684

 Score =   226 bits (575),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 146/202 (72%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTT  246
            D G   ++ +   +   VE IF+ +  PSWR QLT RAF VSFVLGVLFTFIVMKLNLTT
Sbjct  7    DHGDGGRRLDSDDKLPSVEMIFKGQVEPSWREQLTIRAFVVSFVLGVLFTFIVMKLNLTT  66

Query  247  GIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfg  426
            GIIPSLNVSAGLLGFFF+K+WTK +EKSG LK PFTRQENTVIQTCVV +SGIAF GGFG
Sbjct  67   GIIPSLNVSAGLLGFFFLKSWTKLMEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFG  126

Query  427  symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            SY+FGMS +VA Q +  N  +N K+P ++W+IGFLF VSFLGLFSV+PLRK+MIID+KLT
Sbjct  127  SYLFGMSSTVAGQSSETNAAQNTKDPSLSWIIGFLFAVSFLGLFSVLPLRKIMIIDYKLT  186

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YPSGTATAHLI  FHTPQGAKL
Sbjct  187  YPSGTATAHLINSFHTPQGAKL  208



>ref|XP_002510093.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF52280.1| oligopeptide transporter, putative [Ricinus communis]
Length=709

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFE + VPSWR QLT+RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VEQIFERQGVPSWREQLTWRAFGVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TWTK LEK G LK PFTRQENTVIQTC+V SSGIAF GGFGSY+FGMSE  A+Q +  
Sbjct  104  VRTWTKILEKPGLLKQPFTRQENTVIQTCIVASSGIAFSGGFGSYLFGMSERAAQQSSED  163

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N   +IKNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  164  NGATSIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  223

Query  658  QGAKL  672
            QGAKL
Sbjct  224  QGAKL  228



>emb|CDY39272.1| BnaC06g27190D [Brassica napus]
Length=689

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 168/208 (81%), Gaps = 11/208 (5%)
 Frame = +1

Query  82   SKKNED---------SSESGCVERIFE--SKEVPSWRNQLTFRAFCVSFVLGVLFTFIVM  228
            +KK++D         S+E   VERIFE  +   P W+NQLTFRA  VSF+L +LFTF+VM
Sbjct  6    AKKDDDLNSADGGGGSAEEISVERIFEESADAPPPWQNQLTFRAMIVSFILSILFTFVVM  65

Query  229  KLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgia  408
            KLNLTTGIIPSLN+SAGLL FFFVKTWTK L K+G LK PFTRQENTVIQTCVV SSGIA
Sbjct  66   KLNLTTGIIPSLNISAGLLSFFFVKTWTKILNKAGILKQPFTRQENTVIQTCVVASSGIA  125

Query  409  fxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMI  588
            F GGFGSY+FGMSE VAKQ    N P NIKNP + WMIGFLF VSFLGLFSVVPLRK+MI
Sbjct  126  FSGGFGSYLFGMSEVVAKQSPEANTPLNIKNPHLGWMIGFLFTVSFLGLFSVVPLRKIMI  185

Query  589  IDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            +DFKLTYPSGTATAHLI  FHTPQGAKL
Sbjct  186  VDFKLTYPSGTATAHLINSFHTPQGAKL  213



>gb|KDP45817.1| hypothetical protein JCGZ_17424 [Jatropha curcas]
Length=698

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 162/185 (88%), Gaps = 3/185 (2%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IF  +EVPSW+ QLT RAF VSF+L +LFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  39   VEQIFREQEVPSWQQQLTVRAFVVSFILSILFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  98

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +K WT FLEKS  LKHPFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE++AKQ    
Sbjct  99   LKIWTSFLEKSRLLKHPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETIAKQ---S  155

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+  + KNP VAWMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  156  NDKSDHKNPAVAWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  215

Query  658  QGAKL  672
             GAKL
Sbjct  216  AGAKL  220



>ref|XP_008441625.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Cucumis 
melo]
Length=660

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            + ES  VERIFE++EVPSW+NQLT RAF VSF L VLFTFIVMKLNLTTGIIPSLNVSAG
Sbjct  42   AEESMSVERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAG  101

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLGFFFVKTWTK LEKSGFLK PFTRQENTVIQTCVV SSGIAF GGFGSY+FG+S+ ++
Sbjct  102  LLGFFFVKTWTKLLEKSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGLSQRIS  161

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
            +  +   N    KNP + W+IGFLF+VSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLI
Sbjct  162  QLSSADIN--EFKNPSLGWIIGFLFIVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLI  219

Query  640  XXFHTPQGAKL  672
              FHTP+GAKL
Sbjct  220  NSFHTPRGAKL  230



>gb|KFK39092.1| hypothetical protein AALP_AA3G199800 [Arabis alpina]
Length=721

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  53   VEKIFESREVPSWKKQLTLRAFMVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  112

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L KSG+LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  113  VKTWTKMLHKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQSG--  170

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  171  DAARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  230

Query  658  QGAKL  672
            QGAKL
Sbjct  231  QGAKL  235



>ref|XP_002279707.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=713

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTT  246
            D G   ++ +   +   VE IF+ +  PSWR QLT RAF VSFVLGVLFTFIVMKLNLTT
Sbjct  37   DHGDGGRRLDSDDKLPSVEMIFKGQVEPSWREQLTIRAFVVSFVLGVLFTFIVMKLNLTT  96

Query  247  GIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfg  426
            GIIPSLNVSAGLLGFFF+K+WTK +EKSG LK PFTRQENTVIQTCVV +SGIAF GGFG
Sbjct  97   GIIPSLNVSAGLLGFFFLKSWTKLMEKSGLLKQPFTRQENTVIQTCVVATSGIAFSGGFG  156

Query  427  symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            SY+FGMS +VA Q +  N  +N K+P ++W+IGFLF VSFLGLFSV+PLRK+MIID+KLT
Sbjct  157  SYLFGMSSTVAGQSSETNAAQNTKDPSLSWIIGFLFAVSFLGLFSVLPLRKIMIIDYKLT  216

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YPSGTATAHLI  FHTPQGAKL
Sbjct  217  YPSGTATAHLINSFHTPQGAKL  238



>emb|CDY46890.1| BnaA01g27900D [Brassica napus]
Length=715

 Score =   224 bits (571),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW  QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG+LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +AKQ    
Sbjct  107  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQSG--  164

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  165  DVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  658  QGAKL  672
            QGAKL
Sbjct  225  QGAKL  229



>ref|XP_009113863.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Brassica rapa]
Length=714

 Score =   224 bits (571),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW  QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  45   VEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  104

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG+LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +AKQ    
Sbjct  105  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQSG--  162

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  163  DVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  222

Query  658  QGAKL  672
            QGAKL
Sbjct  223  QGAKL  227



>gb|KJB26835.1| hypothetical protein B456_004G262100 [Gossypium raimondii]
Length=697

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 162/194 (84%), Gaps = 3/194 (2%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
            N  +     VE+IFE++EVP W+ QLT RAF VSFVL +LFTFIVMKLNLTTGIIPSLNV
Sbjct  30   NNGAEHEMSVEQIFENREVPPWKKQLTMRAFAVSFVLSILFTFIVMKLNLTTGIIPSLNV  89

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            SAGLLGFFFVKTWTK L KSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE
Sbjct  90   SAGLLGFFFVKTWTKLLSKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSE  149

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
             VAKQ     +    KNP + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA
Sbjct  150  RVAKQ---SGDNGGFKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATA  206

Query  631  HLIXXFHTPQGAKL  672
            HLI  FHTPQGAKL
Sbjct  207  HLINSFHTPQGAKL  220



>ref|XP_010528609.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Tarenaya 
hassleriana]
Length=689

 Score =   223 bits (569),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 149/199 (75%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = +1

Query  82   SKKNEDSSESGCVERIFES--KEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGII  255
            + + + S E   VERIFE+  +  P W +QLT RA  VSFVL +LFTF+VMKLNLTTGII
Sbjct  17   AARGDGSPEETSVERIFEASGEAPPPWHHQLTIRAMVVSFVLSILFTFVVMKLNLTTGII  76

Query  256  PSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsym  435
            PSLN+SAGLLGFFFVKTWTK L K+GFLK PFTRQENTVIQTCVV SSGIAF GGFGSY+
Sbjct  77   PSLNISAGLLGFFFVKTWTKLLHKAGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYL  136

Query  436  fgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPS  615
            FGMS+ VAKQ    N+  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKL YPS
Sbjct  137  FGMSDIVAKQSAEANSVMNIKNPQLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLIYPS  196

Query  616  GTATAHLIXXFHTPQGAKL  672
            GTATAHLI  FHTPQGAKL
Sbjct  197  GTATAHLINSFHTPQGAKL  215



>ref|XP_010069525.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Eucalyptus 
grandis]
 gb|KCW57905.1| hypothetical protein EUGRSUZ_H00652 [Eucalyptus grandis]
Length=698

 Score =   223 bits (569),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 145/185 (78%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+FE KEVPSWR QLT RAF VSFVL VLF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  38   VERVFEGKEVPSWRQQLTVRAFVVSFVLSVLFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  97

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK LEKSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS+ +A+QM   
Sbjct  98   VKTWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDHIAEQMGNG  157

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
                + K   + W+IGFLF+VSFLGL +VVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  158  PGANDYKKLSLPWIIGFLFIVSFLGLLAVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  217

Query  658  QGAKL  672
            +GAKL
Sbjct  218  EGAKL  222



>ref|XP_003533289.1| PREDICTED: probable metal-nicotianamine transporter YSL8-like 
[Glycine max]
Length=703

 Score =   223 bits (569),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 147/189 (78%), Positives = 162/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  106  ESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLL  285
            E   VER+F+   VPSWRNQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLL
Sbjct  41   EEVSVERVFQHLLVPSWRNQLTVRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLL  100

Query  286  GFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQ  465
            GFFFVKTWTKFLEKS  L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE +AKQ
Sbjct  101  GFFFVKTWTKFLEKSNMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIAKQ  160

Query  466  MTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXX  645
                ++  + K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  
Sbjct  161  ---SSDTGHFKDPKLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINS  217

Query  646  FHTPQGAKL  672
            FHTPQGAKL
Sbjct  218  FHTPQGAKL  226



>ref|XP_003548294.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Glycine max]
 gb|KHN24500.1| Putative metal-nicotianamine transporter YSL7 [Glycine soja]
Length=702

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  106  ESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLL  285
            E   VER+F+   VPSWRNQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLL
Sbjct  40   EEVSVERVFQHLLVPSWRNQLTVRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLL  99

Query  286  GFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQ  465
            GFFFVKTWTKFLEKS  L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE +AKQ
Sbjct  100  GFFFVKTWTKFLEKSNMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIAKQ  159

Query  466  MTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXX  645
                ++P + K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  
Sbjct  160  ---SSDPSHFKDPKLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINS  216

Query  646  FHTPQGAKL  672
            FHTPQGAKL
Sbjct  217  FHTPQGAKL  225



>ref|XP_008779631.1| PREDICTED: probable metal-nicotianamine transporter YSL14, partial 
[Phoenix dactylifera]
Length=286

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +ER FE K VP+WR QLT RA  VSF+L V+ +FI MKLNLTTGI+PSLNV+AGLLGFFF
Sbjct  28   IERAFEGKRVPTWREQLTLRALVVSFLLSVICSFIAMKLNLTTGIVPSLNVAAGLLGFFF  87

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK LEK+G L+ PFTRQENTVIQTCVV + GIA  GGFG+ + GMSE +AKQ +  
Sbjct  88   VKTWTKALEKAGLLRLPFTRQENTVIQTCVVAAYGIASYGGFGAQLLGMSERIAKQASEA  147

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +N +NI++P + WMIGFLF+VSF GLFS+VPLRK+MIID+KL YPSGTATA LI  FHTP
Sbjct  148  DNAQNIRDPELGWMIGFLFLVSFPGLFSLVPLRKIMIIDYKLIYPSGTATAFLINGFHTP  207

Query  658  QGAK  669
            QGAK
Sbjct  208  QGAK  211



>ref|XP_002305689.1| hypothetical protein POPTR_0004s06790g [Populus trichocarpa]
 gb|EEE86200.1| hypothetical protein POPTR_0004s06790g [Populus trichocarpa]
Length=689

 Score =   223 bits (568),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIF  +EVPSWRNQLT+RAF VSF+L VLF+FIVMKLNLT GIIPSLNVSAGLLGFFF
Sbjct  24   VERIFAKQEVPSWRNQLTWRAFGVSFILSVLFSFIVMKLNLTAGIIPSLNVSAGLLGFFF  83

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWT+FLE  G LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS  +A++    
Sbjct  84   VKTWTRFLENCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGRIAQESADQ  143

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + ++IK+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  144  PSAKDIKDPALGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  203

Query  658  QGAKL  672
            +GAKL
Sbjct  204  EGAKL  208



>ref|XP_006406708.1| hypothetical protein EUTSA_v10020160mg [Eutrema salsugineum]
 dbj|BAJ33889.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48161.1| hypothetical protein EUTSA_v10020160mg [Eutrema salsugineum]
Length=716

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VEKIFESREVPSWKKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG+LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  109  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQSG--  166

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  167  DAARGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  226

Query  658  QGAKL  672
            QGAKL
Sbjct  227  QGAKL  231



>gb|KHG02257.1| putative metal-nicotianamine transporter YSL5 -like protein [Gossypium 
arboreum]
Length=696

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 162/200 (81%), Gaps = 3/200 (2%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G     N  +     VE+IFE +EVP W+ QLT RAF VSFVL +LFTFIVMKLNLTTGI
Sbjct  23   GGRKSSNNGAEYEMSVEQIFEKREVPPWKKQLTMRAFAVSFVLSILFTFIVMKLNLTTGI  82

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVKTWTK L KSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  83   IPSLNVSAGLLGFFFVKTWTKLLSKSGLLRQPFTRQENTVIQTCVVASSGIAFSGGFGSY  142

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +FGMSE VAKQ     +    KNP + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYP
Sbjct  143  LFGMSERVAKQ---SGDNGGFKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYP  199

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTPQGAKL
Sbjct  200  SGTATAHLINSFHTPQGAKL  219



>ref|XP_004138807.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
 gb|KGN63124.1| hypothetical protein Csa_2G404760 [Cucumis sativus]
Length=706

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            + ES  VERIFE++EVPSW+NQLT RAF VSF L VLFTFIVMKLNLTTGIIPSLNVSAG
Sbjct  43   AEESMSVERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAG  102

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLGFFFVK+WTK LEKSG+LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FG+S+ ++
Sbjct  103  LLGFFFVKSWTKLLEKSGWLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGLSQRIS  162

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
            +  +  ++    KNP + W+IGFLF+VSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI
Sbjct  163  QLSS--DDINEFKNPSLGWIIGFLFIVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLI  220

Query  640  XXFHTPQGAKL  672
              FHTP+GAKL
Sbjct  221  NSFHTPRGAKL  231



>ref|XP_009135543.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Brassica rapa]
Length=713

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  48   VEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  107

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L KSG+LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +AKQ    
Sbjct  108  VKTWTKVLYKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQSG--  165

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +     K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  166  DASRGFKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  225

Query  658  QGAKL  672
            QGAKL
Sbjct  226  QGAKL  230



>ref|XP_004158540.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=706

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            + ES  VERIFE++EVPSW+NQLT RAF VSF L VLFTFIVMKLNLTTGIIPSLNVSAG
Sbjct  43   AEESMSVERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAG  102

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLGFFFVK+WTK LEKSG+LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FG+S+ ++
Sbjct  103  LLGFFFVKSWTKLLEKSGWLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGLSQRIS  162

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
            +  +  ++    KNP + W+IGFLF+VSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI
Sbjct  163  QLSS--DDINEFKNPSLGWIIGFLFIVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLI  220

Query  640  XXFHTPQGAKL  672
              FHTP+GAKL
Sbjct  221  NSFHTPRGAKL  231



>gb|KJB75155.1| hypothetical protein B456_012G027400 [Gossypium raimondii]
Length=690

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 166/198 (84%), Gaps = 3/198 (2%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            + KK         VE IF+S+EVP W+NQLT RAF VSF+L ++F+FIVMKLNLTTGIIP
Sbjct  20   NGKKEVKGGGEKSVEEIFQSQEVPLWKNQLTIRAFGVSFLLSIMFSFIVMKLNLTTGIIP  79

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNVSAGLLGFFFVKTWTK L+KSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+F
Sbjct  80   SLNVSAGLLGFFFVKTWTKMLQKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLF  139

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMSE +AKQ    ++  + KNP + W+IGFLFVVSFLGLFSV+PLRK+M+IDFKLTYPSG
Sbjct  140  GMSERIAKQ---SDDNGSFKNPSLGWIIGFLFVVSFLGLFSVLPLRKIMVIDFKLTYPSG  196

Query  619  TATAHLIXXFHTPQGAKL  672
            TATAHLI  FHTPQGAKL
Sbjct  197  TATAHLINSFHTPQGAKL  214



>ref|XP_004515282.1| PREDICTED: probable metal-nicotianamine transporter YSL5-like 
[Cicer arietinum]
Length=709

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 166/196 (85%), Gaps = 5/196 (3%)
 Frame = +1

Query  85   KKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSL  264
            KK E+  E+  VE++F+   VPSWRNQLT RAF VSF L +LF+FIVMKLNLTTGIIPSL
Sbjct  40   KKEEE--EAASVEKVFKHLLVPSWRNQLTIRAFVVSFFLSILFSFIVMKLNLTTGIIPSL  97

Query  265  NVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgm  444
            NVSAGLLGFFFVKTWTKFLEKS  LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGM
Sbjct  98   NVSAGLLGFFFVKTWTKFLEKSDMLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGM  157

Query  445  sESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTA  624
            SE VAKQ    ++  + K+P + W+I FLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTA
Sbjct  158  SEHVAKQ---SSDTSDFKDPKLVWIIAFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTA  214

Query  625  TAHLIXXFHTPQGAKL  672
            TAHLI  FHTPQGAKL
Sbjct  215  TAHLINSFHTPQGAKL  230



>emb|CDY46051.1| BnaC01g34980D [Brassica napus]
Length=960

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW  QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWTKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG+LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +AKQ    
Sbjct  107  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQSG--  164

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  165  DVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  658  QGAKL  672
            QGAKL
Sbjct  225  QGAKL  229



>ref|XP_010470452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Camelina 
sativa]
Length=692

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = +1

Query  118  VERIFE-SKEVP-SWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  291
            VE+IFE S EVP SW++QLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  30   VEKIFEASHEVPPSWQHQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLGF  89

Query  292  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMT  471
            FFVKTWTK L K+G LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS+ VAKQ  
Sbjct  90   FFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDIVAKQSA  149

Query  472  IXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFH  651
              N   NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATAHLI  FH
Sbjct  150  EANTAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATAHLINSFH  209

Query  652  TPQGAKL  672
            TPQGAKL
Sbjct  210  TPQGAKL  216



>ref|XP_010487657.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=711

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 161/185 (87%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SGFLK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  104  VKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQSG--  161

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +KNP + W++GFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  162  DAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  221

Query  658  QGAKL  672
            QGAKL
Sbjct  222  QGAKL  226



>ref|XP_007152542.1| hypothetical protein PHAVU_004G138900g [Phaseolus vulgaris]
 gb|ESW24536.1| hypothetical protein PHAVU_004G138900g [Phaseolus vulgaris]
Length=701

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F+   VPSWRNQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  43   VERVFQHLLVPSWRNQLTGRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  102

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTKFLEKSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE +A Q T  
Sbjct  103  VKTWTKFLEKSGMLRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSEEIANQST--  160

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             +  + K+P + W+I FLFVVSFLGLFSVVPLRK+M++DFKLTYPSGTATAHLI  FHTP
Sbjct  161  -DTSDFKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMVVDFKLTYPSGTATAHLINSFHTP  219

Query  658  QGAKL  672
            QGAKL
Sbjct  220  QGAKL  224



>ref|XP_004976283.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Setaria italica]
Length=718

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER FE + VPSWR QLT RAF VSF L V+F+ IVMKLNLTTGIIPSLNVSAGLL FFF
Sbjct  59   VERAFEGQPVPSWREQLTVRAFVVSFFLSVMFSVIVMKLNLTTGIIPSLNVSAGLLSFFF  118

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WTK +E  G L+ PFTRQENTVIQTCVV +  IAF GGFG+Y+FGMSE++AKQ T  
Sbjct  119  VRLWTKAIESMGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATEA  178

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NNP+N+KNP + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  179  NNPQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  238

Query  658  QGAKL  672
            +GAKL
Sbjct  239  EGAKL  243



>emb|CDY68937.1| BnaCnng61140D, partial [Brassica napus]
Length=735

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L KSG+LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +AKQ    
Sbjct  109  VKTWTKVLYKSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIAKQSG--  166

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +     K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  167  DASRGFKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  226

Query  658  QGAKL  672
            QGAKL
Sbjct  227  QGAKL  231



>ref|XP_010551587.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Tarenaya hassleriana]
Length=694

 Score =   221 bits (563),  Expect = 9e-64, Method: Composition-based stats.
 Identities = 148/201 (74%), Positives = 166/201 (83%), Gaps = 3/201 (1%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEV--PSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            D   N+  +E   VERIFE      P W+NQLT RA  VSFVL ++FTF+VMKLNLTTGI
Sbjct  11   DDDFNDTVAEETSVERIFEESGAVPPPWQNQLTIRALVVSFVLSIMFTFVVMKLNLTTGI  70

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLN+SAGLLGFFFVKTWTK L K+G+LK PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  71   IPSLNISAGLLGFFFVKTWTKLLHKAGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGSY  130

Query  433  mfgmsESVAKQMTIXNNPE-NIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTY  609
            +FGMS+ VAKQ++   +P   IKNP + WMIGFLFVVSF+GLFSVVPLRK+MI+DFKLTY
Sbjct  131  LFGMSDVVAKQISPEPSPPMTIKNPQLGWMIGFLFVVSFIGLFSVVPLRKIMIVDFKLTY  190

Query  610  PSGTATAHLIXXFHTPQGAKL  672
            PSGTATAHLI  FHTPQGAKL
Sbjct  191  PSGTATAHLINSFHTPQGAKL  211



>ref|NP_001185468.1| yellow stripe-like transporter 12 [Zea mays]
 gb|ADO20999.1| yellow stripe-like transporter 12 [Zea mays]
 gb|AFW58896.1| hypothetical protein ZEAMMB73_279911 [Zea mays]
Length=718

 Score =   221 bits (564),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 135/201 (67%), Positives = 165/201 (82%), Gaps = 1/201 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESG-CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTG  249
            G+ +  ++D   +   VER F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTG
Sbjct  43   GVAAAADDDGEGNALSVERAFADQAVPSWREQLTVRAFVVSFFLAIMFSVIVMKLNLTTG  102

Query  250  IIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgs  429
            IIPSLNVSAGLLGFFFV+ WT  +E+ G L+ PFTRQENTVIQTCVV +  IAF GGFG+
Sbjct  103  IIPSLNVSAGLLGFFFVRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGT  162

Query  430  ymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTY  609
            Y+FGMSE++AKQ T  +NP+N+KNP + WMIGFLF+VSF+GLF++VPLRKVMI+D+KLTY
Sbjct  163  YLFGMSETIAKQATEADNPQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKVMIVDYKLTY  222

Query  610  PSGTATAHLIXXFHTPQGAKL  672
            PSGTATA+LI  FHTP+GAKL
Sbjct  223  PSGTATAYLINGFHTPEGAKL  243



>ref|XP_010943908.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=731

 Score =   221 bits (564),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 139/185 (75%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +ER+F+ K VPSWR Q+TFRA  V+F L V+F+FIVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  65   IERVFDGKPVPSWREQVTFRAMVVAFFLSVMFSFIVMKLNLTTGIIPSLNVAAGLLGFFF  124

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTK LEK+G L+  FTRQENTVIQTCVV +SGIAF GGFGSY+FGMSE +A Q T  
Sbjct  125  IKTWTKVLEKTGLLQQAFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSERIANQATEA  184

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +N +N+K+PG+ WMIGFLFVVSFLGLFS+VPLRK+MIID+KL YPSGTATA LI  FHTP
Sbjct  185  DNAQNVKDPGLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAFLINGFHTP  244

Query  658  QGAKL  672
            QGAKL
Sbjct  245  QGAKL  249



>gb|KDP41617.1| hypothetical protein JCGZ_16024 [Jatropha curcas]
Length=690

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+ VPSWR QLT+RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  27   VEQIFESQRVPSWREQLTWRAFGVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  86

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TWTK LE SG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS  VA+Q T  
Sbjct  87   VRTWTKILETSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGIVAQQST-E  145

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +N  +IK+P + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA+LI  FHTP
Sbjct  146  DNGTDIKDPKLGWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHTP  205

Query  658  QGAKL  672
            +GAKL
Sbjct  206  EGAKL  210



>ref|XP_010551578.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Tarenaya hassleriana]
Length=686

 Score =   220 bits (561),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 148/201 (74%), Positives = 166/201 (83%), Gaps = 3/201 (1%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEV--PSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            D   N+  +E   VERIFE      P W+NQLT RA  VSFVL ++FTF+VMKLNLTTGI
Sbjct  11   DDDFNDTVAEETSVERIFEESGAVPPPWQNQLTIRALVVSFVLSIMFTFVVMKLNLTTGI  70

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLN+SAGLLGFFFVKTWTK L K+G+LK PFTRQENTVIQTCVV SSGIAF GGFGSY
Sbjct  71   IPSLNISAGLLGFFFVKTWTKLLHKAGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGSY  130

Query  433  mfgmsESVAKQMTIXNNPE-NIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTY  609
            +FGMS+ VAKQ++   +P   IKNP + WMIGFLFVVSF+GLFSVVPLRK+MI+DFKLTY
Sbjct  131  LFGMSDVVAKQISPEPSPPMTIKNPQLGWMIGFLFVVSFIGLFSVVPLRKIMIVDFKLTY  190

Query  610  PSGTATAHLIXXFHTPQGAKL  672
            PSGTATAHLI  FHTPQGAKL
Sbjct  191  PSGTATAHLINSFHTPQGAKL  211



>ref|XP_007211297.1| hypothetical protein PRUPE_ppa001999mg [Prunus persica]
 gb|EMJ12496.1| hypothetical protein PRUPE_ppa001999mg [Prunus persica]
Length=731

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
            N    E   VERIFE + VPSW+ QLT RAF +SFVL VLF+ IVMKLNLTTGIIPSLNV
Sbjct  58   NLGVEEELSVERIFEQQIVPSWKEQLTVRAFFISFVLSVLFSVIVMKLNLTTGIIPSLNV  117

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            SAGLLGFFFV+TWTKFL++ G LK PFTRQENTVIQTCVV SS IAF GGFG+Y+FGMS 
Sbjct  118  SAGLLGFFFVRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSSIAFSGGFGNYLFGMSA  177

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
             +A+Q T  N+  +IK+PG+ W IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA
Sbjct  178  RIAQQST-DNSTSDIKDPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATA  236

Query  631  HLIXXFHTPQGAKL  672
            HLI  FHTPQGAKL
Sbjct  237  HLINSFHTPQGAKL  250



>ref|XP_002277292.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=713

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 164/200 (82%), Gaps = 2/200 (1%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G     ++D S S  VE +F+ K VPSWR QLT RAF VSFVLGVL TFIVMKLNLTTGI
Sbjct  41   GEGGGDSDDKSLS--VEMLFKGKVVPSWREQLTIRAFVVSFVLGVLLTFIVMKLNLTTGI  98

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNVSAGLLGFFFVK+W KF+EKSG LK PFTRQENTVIQTCVV +SGIAF GGFGSY
Sbjct  99   IPSLNVSAGLLGFFFVKSWAKFMEKSGMLKQPFTRQENTVIQTCVVATSGIAFSGGFGSY  158

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +FGMS  VA Q     + +N K+P + W+IGFLF VSFLGLFSV+PLRK+M+ID+KLTYP
Sbjct  159  LFGMSSIVAGQSAKSIDAQNTKDPRLPWIIGFLFAVSFLGLFSVLPLRKIMVIDYKLTYP  218

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHTPQGAKL
Sbjct  219  SGTATAHLINSFHTPQGAKL  238



>gb|ABB76762.1| YSL transporter 2 [Noccaea caerulescens]
 gb|ABD04074.1| YSL transporter 2 [Noccaea caerulescens]
Length=716

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 161/185 (87%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSFVL +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  49   VEKIFESREVPSWKKQLTLRAFVVSFVLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  108

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG+LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  109  VKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQSG--  166

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +     K+P + W++GFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  167  DASRGFKDPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  226

Query  658  QGAKL  672
            QGAKL
Sbjct  227  QGAKL  231



>ref|XP_002891428.1| hypothetical protein ARALYDRAFT_473974 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67687.1| hypothetical protein ARALYDRAFT_473974 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 156/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE IFES+EVPSW+NQLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VEGIFESREVPSWKNQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MS  +A Q    
Sbjct  116  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQSG--  173

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTP
Sbjct  174  DVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTP  233

Query  658  QGAKL  672
            QGAKL
Sbjct  234  QGAKL  238



>ref|XP_010465820.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=711

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SGFLK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  104  VKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQSG--  161

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +KNP + W++GFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  162  DAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  221

Query  658  QGAKL  672
            QG KL
Sbjct  222  QGVKL  226



>ref|XP_010505667.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Camelina sativa]
Length=711

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  44   VEKIFESREVPSWKKQLTLRAFVVSFFLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  103

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SGFLK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  104  VKTWTKMLHRSGFLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQSG--  161

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +KNP + W++GFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  162  DAYRGVKNPSLGWIMGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  221

Query  658  QGAKL  672
            QG KL
Sbjct  222  QGVKL  226



>ref|XP_003620154.1| Yellow stripe-like protein 2.1 [Medicago truncatula]
 gb|AES76372.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=712

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 162/197 (82%), Gaps = 3/197 (2%)
 Frame = +1

Query  82   SKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPS  261
            S K     E   +E++F+   VPSWRNQLT RAF VSF L VLF+FIVMKLNLTTGIIPS
Sbjct  42   SSKRLLKEEEASIEKVFKHLLVPSWRNQLTIRAFVVSFFLSVLFSFIVMKLNLTTGIIPS  101

Query  262  LNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfg  441
            LNVSAGLLGFFFVKTWTKFLEKS  LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FG
Sbjct  102  LNVSAGLLGFFFVKTWTKFLEKSDMLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFG  161

Query  442  msESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGT  621
            MSE VA Q    ++  + K+P + W+I FLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGT
Sbjct  162  MSEHVATQ---SSDTSDFKDPKLGWIIAFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGT  218

Query  622  ATAHLIXXFHTPQGAKL  672
            ATAHLI  FHTPQGAKL
Sbjct  219  ATAHLINSFHTPQGAKL  235



>emb|CAI44637.1| OSJNBb0065J09.17 [Oryza sativa Japonica Group]
Length=672

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VERAFVDRAVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ G L+ PFTRQENTVIQTCVV + GIAF GGFG+Y+FGMSE++AKQ T  
Sbjct  116  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQATEA  175

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NN +N+KNP + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  176  NNAQNVKNPHIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  235

Query  658  QGAKL  672
            +GAKL
Sbjct  236  EGAKL  240



>ref|XP_008801345.1| PREDICTED: probable metal-nicotianamine transporter YSL12 isoform 
X1 [Phoenix dactylifera]
Length=729

 Score =   219 bits (559),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 136/185 (74%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +E++F+ K +P WR QLTFRA  VSF L V+F+FIVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  63   IEKLFDGKPLPGWREQLTFRAMVVSFFLSVMFSFIVMKLNLTTGIIPSLNVAAGLLGFFF  122

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTW+K LEK+G L+  FTRQENTVIQTCVV +SG+AF GGFGSY+FGMSE++AKQ T  
Sbjct  123  IKTWSKALEKTGLLRQAFTRQENTVIQTCVVAASGVAFSGGFGSYLFGMSETIAKQATEA  182

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +N +N+K+PG+ WMIGFLFVVSFLGLFS+VPLRK+MI+D+KL YPSGTATA LI  FHTP
Sbjct  183  DNAQNVKDPGLGWMIGFLFVVSFLGLFSLVPLRKIMIVDYKLIYPSGTATAFLINGFHTP  242

Query  658  QGAKL  672
            QGAKL
Sbjct  243  QGAKL  247



>ref|XP_006393421.1| hypothetical protein EUTSA_v10011269mg [Eutrema salsugineum]
 gb|ESQ30707.1| hypothetical protein EUTSA_v10011269mg [Eutrema salsugineum]
Length=721

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 157/185 (85%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MSE +A Q    
Sbjct  116  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIAIQSG--  173

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  174  DVARGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  233

Query  658  QGAKL  672
            QGAKL
Sbjct  234  QGAKL  238



>ref|XP_006297072.1| hypothetical protein CARUB_v10013074mg [Capsella rubella]
 gb|EOA29970.1| hypothetical protein CARUB_v10013074mg [Capsella rubella]
Length=714

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWKKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  107  VKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIANQSG--  164

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  165  DGYRGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  658  QGAKL  672
             GAKL
Sbjct  225  LGAKL  229



>ref|XP_002446809.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor]
 gb|EES11137.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor]
Length=722

 Score =   219 bits (558),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F  + VPSWR QLT RAF VSF L V+F+ IVMKL LTTGIIPSLNVSAGLLGFFF
Sbjct  63   VERVFAEQAVPSWREQLTVRAFVVSFFLAVMFSIIVMKLGLTTGIIPSLNVSAGLLGFFF  122

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ G LK PFTRQENTVIQTCVV +  IAF GGFG+Y+FGMSE++AKQ T  
Sbjct  123  VRLWTAAIERVGLLKQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATEA  182

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            ++P+N+KNP + WMIGFLF+ SF+GLF++VPLRKVMI+D+KLTYPSGTATA+LI  FHTP
Sbjct  183  DDPQNVKNPHIGWMIGFLFLASFIGLFALVPLRKVMIVDYKLTYPSGTATAYLINGFHTP  242

Query  658  QGAKL  672
            +GAKL
Sbjct  243  EGAKL  247



>ref|XP_006300806.1| hypothetical protein CARUB_v10019889mg [Capsella rubella]
 gb|EOA33704.1| hypothetical protein CARUB_v10019889mg [Capsella rubella]
Length=694

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = +1

Query  118  VERIFE-SKEVPS-WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGF  291
            VER+FE S EVP  W+NQLTFRA  VSF+L +LFTF+VMKLNLTTGIIPSLN+SAGLLGF
Sbjct  32   VERVFEQSNEVPPPWQNQLTFRALIVSFILAILFTFVVMKLNLTTGIIPSLNISAGLLGF  91

Query  292  FFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMT  471
            FFVKTWTK L K+G LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS+ +AKQ  
Sbjct  92   FFVKTWTKILNKAGVLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSDVIAKQSA  151

Query  472  IXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFH  651
              N+  NIKNP + WMIGFLFVVSFLGLFSVVPLRK+MI+DFKLTYPSGTATA LI  FH
Sbjct  152  EANSAMNIKNPHLGWMIGFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSGTATATLINSFH  211

Query  652  TPQGAKL  672
            TPQGAKL
Sbjct  212  TPQGAKL  218



>gb|KCW57904.1| hypothetical protein EUGRSUZ_H00651 [Eucalyptus grandis]
Length=683

 Score =   218 bits (556),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 140/183 (77%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = +1

Query  124  RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  303
            + FESKEVPSWR QLT RAF VSFVL V+F+FIVMKLNLTTGIIPSLNVSAGLLGFFF+K
Sbjct  32   KAFESKEVPSWRQQLTVRAFAVSFVLSVMFSFIVMKLNLTTGIIPSLNVSAGLLGFFFIK  91

Query  304  TWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNN  483
            TWTK LEKSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+F MS  +A Q      
Sbjct  92   TWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSGRIASQAESGPG  151

Query  484  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQG  663
              + K+P + W+IGFLF+VSF+GL SVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP+G
Sbjct  152  TNDYKDPSLGWIIGFLFIVSFVGLLSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTPEG  211

Query  664  AKL  672
            AKL
Sbjct  212  AKL  214



>ref|NP_566584.1| putative metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
 sp|Q9LUN2.1|YSL5_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL5; 
AltName: Full=Protein YELLOW STRIPE LIKE 5; Short=AtYSL5 [Arabidopsis 
thaliana]
 dbj|BAB02055.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS00694.1| metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
 gb|AEE75985.1| putative metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
Length=714

 Score =   219 bits (557),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 161/185 (87%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWKKQLTVRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  107  VKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQS--G  164

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  165  DVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  658  QGAKL  672
            QGAKL
Sbjct  225  QGAKL  229



>ref|XP_010025985.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=827

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+ FESKEVPSWR QLT RAF VSFVL V+F+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  174  VEKAFESKEVPSWRQQLTVRAFAVSFVLSVMFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  233

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTK LEKSG L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+F MS  +A Q    
Sbjct  234  IKTWTKVLEKSGMLQVPFTRQENTVIQTCVVASSGIAFSGGFGSYLFAMSGRIASQAESG  293

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
                + K+P + W+IGFLF+VSF+GL SVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  294  PGTNDYKDPSLGWIIGFLFIVSFVGLLSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  353

Query  658  QGAKL  672
            +GAKL
Sbjct  354  EGAKL  358



>ref|XP_009107360.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Brassica 
rapa]
 emb|CDY41835.1| BnaA08g03300D [Brassica napus]
Length=718

 Score =   219 bits (557),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 156/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  53   VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  112

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MSE +A      
Sbjct  113  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIANHSG--  170

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  171  DAARGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  230

Query  658  QGAKL  672
            QGAKL
Sbjct  231  QGAKL  235



>ref|XP_004165464.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=698

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 163/197 (83%), Gaps = 3/197 (2%)
 Frame = +1

Query  82   SKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPS  261
            +KK E       +E  FE +EVPSWR QLTFRAF VSF L +LF+FIVMKLNLTTGIIPS
Sbjct  30   NKKGEVEGGVLSIEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPS  89

Query  262  LNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfg  441
            LNVSAGLLGFFFVK+WTKFLE+SG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FG
Sbjct  90   LNVSAGLLGFFFVKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFG  149

Query  442  msESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGT  621
            MSE +A +    +   + K+P + WMIGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGT
Sbjct  150  MSERIAHK---ASGSRDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGT  206

Query  622  ATAHLIXXFHTPQGAKL  672
            ATAHLI  FHTP+GA L
Sbjct  207  ATAHLINSFHTPRGAAL  223



>ref|XP_002883075.1| hypothetical protein ARALYDRAFT_479246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59334.1| hypothetical protein ARALYDRAFT_479246 [Arabidopsis lyrata subsp. 
lyrata]
Length=714

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW  QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWTKQLTLRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  107  VKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQS--G  164

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHTP
Sbjct  165  DVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTP  224

Query  658  QGAKL  672
            QGAKL
Sbjct  225  QGAKL  229



>sp|Q5JQD7.2|YSL12_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL12; 
AltName: Full=Protein YELLOW STRIPE LIKE 12; Short=OsYSL12 
[Oryza sativa Japonica Group]
 emb|CAH67886.1| OSIGBa0153E02-OSIGBa0093I20.15 [Oryza sativa Indica Group]
Length=717

 Score =   218 bits (556),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VERAFVDRAVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ G L+ PFTRQENTVIQTCVV + GIAF GGFG+Y+FGMSE++AKQ T  
Sbjct  116  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQATEA  175

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NN +N+KNP + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  176  NNAQNVKNPHIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  235

Query  658  QGAKL  672
            +GAKL
Sbjct  236  EGAKL  240



>ref|XP_004137637.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=723

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 163/197 (83%), Gaps = 3/197 (2%)
 Frame = +1

Query  82   SKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPS  261
            +KK E       +E  FE +EVPSWR QLTFRAF VSF L +LF+FIVMKLNLTTGIIPS
Sbjct  55   NKKGEVEGGVLSIEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPS  114

Query  262  LNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfg  441
            LNVSAGLLGFFFVK+WTKFLE+SG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FG
Sbjct  115  LNVSAGLLGFFFVKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFG  174

Query  442  msESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGT  621
            MSE +A +    +   + K+P + WMIGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGT
Sbjct  175  MSERIAHK---ASGSRDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGT  231

Query  622  ATAHLIXXFHTPQGAKL  672
            ATAHLI  FHTP+GA L
Sbjct  232  ATAHLINSFHTPRGAAL  248



>ref|NP_564525.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
 sp|Q6R3K4.2|YSL8_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL8; 
AltName: Full=Protein YELLOW STRIPE LIKE 8; Short=AtYSL8 [Arabidopsis 
thaliana]
 gb|AAK62655.1| At1g48370/F11A17_27 [Arabidopsis thaliana]
 gb|AAQ65095.1| At1g48370/F11A17_27 [Arabidopsis thaliana]
 gb|AEE32281.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
Length=724

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 155/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MS  +A Q    
Sbjct  116  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQSG--  173

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTP
Sbjct  174  DVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTP  233

Query  658  QGAKL  672
            QGAKL
Sbjct  234  QGAKL  238



>ref|XP_008436975.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL5 [Cucumis melo]
Length=693

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 162/197 (82%), Gaps = 5/197 (3%)
 Frame = +1

Query  88   KNEDSSESGC--VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPS  261
            +    S SG   +E  FE +EVPSWR QLTFRAF VSF L +LF+FIVMKLNLTTGIIPS
Sbjct  25   RQRFGSRSGVLSIEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPS  84

Query  262  LNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfg  441
            LNVSAGLLGFFFVK+WTKFLE+SG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FG
Sbjct  85   LNVSAGLLGFFFVKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFG  144

Query  442  msESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGT  621
            MSE +A + +      + K+P + WMIGF FVVSFLGLFSVVPLRK+MIIDFKLTYPSGT
Sbjct  145  MSERIAHKAS---GSRDFKDPSLGWMIGFXFVVSFLGLFSVVPLRKIMIIDFKLTYPSGT  201

Query  622  ATAHLIXXFHTPQGAKL  672
            ATAHLI  FHTP+GA L
Sbjct  202  ATAHLINSFHTPRGAAL  218



>ref|XP_009420946.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   218 bits (554),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  103  SESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGL  282
            +E+  +E  F+ + VP WR QLT RAF VS VLG +F+ IVMKLNLTTG+IPSLNVSAGL
Sbjct  32   TEAPSIESEFDGERVPPWREQLTARAFAVSLVLGAMFSVIVMKLNLTTGVIPSLNVSAGL  91

Query  283  LGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAK  462
            LGFFFV+TWT  L ++G L+ PFTRQENTVIQTCVV +SGIA  GGFGSY+F MSE++AK
Sbjct  92   LGFFFVRTWTVALGRAGLLRQPFTRQENTVIQTCVVATSGIASSGGFGSYLFAMSETIAK  151

Query  463  QMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIX  642
            Q T  N+ +NIKNP + WMIGFLFVVSFLGLFS+VPLRK+MI+D+KL YPSGTATAHLI 
Sbjct  152  QSTEANDSQNIKNPKLGWMIGFLFVVSFLGLFSLVPLRKIMIVDYKLIYPSGTATAHLIN  211

Query  643  XFHTPQGAKL  672
             FHTPQGAKL
Sbjct  212  SFHTPQGAKL  221



>dbj|BAE44205.1| hypothetical protein [Oryza sativa Japonica Group]
Length=727

 Score =   218 bits (555),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 135/192 (70%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = +1

Query  97   DSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSA  276
            D  ++  VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSA
Sbjct  57   DDPDATSVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSA  116

Query  277  GLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESV  456
            GLLGFFFV+ WT  +E+ G LK PFTRQENTVIQTCVV + GIAF GGFGSY+FGMSE++
Sbjct  117  GLLGFFFVRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETI  176

Query  457  AKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHL  636
            AKQ T   + +NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+L
Sbjct  177  AKQATEAKDAQNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYL  236

Query  637  IXXFHTPQGAKL  672
            I  FHTP+GAKL
Sbjct  237  INGFHTPEGAKL  248



>ref|XP_008240337.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Prunus 
mume]
Length=735

 Score =   218 bits (555),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 144/185 (78%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE + VPSW+ QLT RAF +S VL VLF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  69   VERIFEKQTVPSWKEQLTVRAFFISLVLSVLFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  128

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TWTKFL++ G LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS  +A+Q +  
Sbjct  129  VRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSARIAQQ-SAD  187

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             +  +IK PG+ W IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  188  RSTRDIKEPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  247

Query  658  QGAKL  672
            QGAKL
Sbjct  248  QGAKL  252



>ref|XP_003580167.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Brachypodium 
distachyon]
Length=717

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER FE K VP+WR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  57   VERAFEGKAVPTWREQLTLRAFVVSFFLAIMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  116

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ GFL+ PFTRQENTVIQTCVV +  IAF GGFG+Y+F MS+++A Q T  
Sbjct  117  VRLWTGAIERMGFLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLFAMSDTIANQTTEA  176

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +NIKNP V WMI FLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  177  KDAQNIKNPHVGWMIAFLFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  236

Query  658  QGAKL  672
            +GAKL
Sbjct  237  EGAKL  241



>ref|XP_006648859.1| PREDICTED: probable metal-nicotianamine transporter YSL14-like, 
partial [Oryza brachyantha]
Length=694

 Score =   217 bits (553),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 133/192 (69%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = +1

Query  97   DSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSA  276
            D  ++  VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSA
Sbjct  24   DDPDATSVERVFADKAVPSWREQLTLRAFVVSALLSVMFSVIVMKLNLTTGIIPSLNVSA  83

Query  277  GLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESV  456
            GLLGFFFV+ WT  +E+ G L+ PFTRQENTVIQTCVV + GIAF GGFGSY+FGMSE++
Sbjct  84   GLLGFFFVRLWTSAVERMGLLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETI  143

Query  457  AKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHL  636
            AKQ T   + +NIK+P + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLTYPSGTATA+L
Sbjct  144  AKQATEAKDAQNIKDPHLGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYL  203

Query  637  IXXFHTPQGAKL  672
            I  FHTP+GAKL
Sbjct  204  INGFHTPEGAKL  215



>sp|Q6H7J6.1|YSL14_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL14; 
AltName: Full=Protein YELLOW STRIPE LIKE 14; Short=OsYSL14 
[Oryza sativa Japonica Group]
 dbj|BAD25303.1| oligopeptide transporter OPT-like [Oryza sativa Japonica Group]
Length=727

 Score =   218 bits (554),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 135/192 (70%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = +1

Query  97   DSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSA  276
            D  ++  VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSA
Sbjct  57   DDPDATSVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSA  116

Query  277  GLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESV  456
            GLLGFFFV+ WT  +E+ G LK PFTRQENTVIQTCVV + GIAF GGFGSY+FGMSE++
Sbjct  117  GLLGFFFVRLWTSAVERIGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSETI  176

Query  457  AKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHL  636
            AKQ T   + +NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+L
Sbjct  177  AKQATEAKDAQNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYL  236

Query  637  IXXFHTPQGAKL  672
            I  FHTP+GAKL
Sbjct  237  INGFHTPEGAKL  248



>ref|XP_006653608.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Oryza brachyantha]
Length=693

 Score =   217 bits (553),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 131/185 (71%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  32   VERVFADRPVPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFF  91

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ G L+ PFTRQENTVIQTCVV +  IAF GGFG+Y+FGMSE++AKQ T  
Sbjct  92   VRLWTAAIERLGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGTYLFGMSETIAKQATEA  151

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+ +N+KNP + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  152  NDAQNVKNPHIGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  211

Query  658  QGAKL  672
            +GAKL
Sbjct  212  EGAKL  216



>gb|KGN64213.1| hypothetical protein Csa_1G043160 [Cucumis sativus]
Length=693

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 163/197 (83%), Gaps = 5/197 (3%)
 Frame = +1

Query  88   KNEDSSESGC--VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPS  261
            +    S SG   +E  FE +EVPSWR QLTFRAF VSF L +LF+FIVMKLNLTTGIIPS
Sbjct  25   RQRFGSRSGVLSIEEFFEDQEVPSWRKQLTFRAFFVSFWLSILFSFIVMKLNLTTGIIPS  84

Query  262  LNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfg  441
            LNVSAGLLGFFFVK+WTKFLE+SG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FG
Sbjct  85   LNVSAGLLGFFFVKSWTKFLERSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFG  144

Query  442  msESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGT  621
            MSE +A +    +   + K+P + WMIGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGT
Sbjct  145  MSERIAHK---ASGSRDFKDPSLGWMIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGT  201

Query  622  ATAHLIXXFHTPQGAKL  672
            ATAHLI  FHTP+GA L
Sbjct  202  ATAHLINSFHTPRGAAL  218



>ref|XP_011035385.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
Length=704

 Score =   217 bits (552),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIF  + VPSWRNQLT RAF VSF+L VLF+FIVMKLNLT GIIPSLNVSAGLLGFFF
Sbjct  39   VERIFAKQGVPSWRNQLTRRAFGVSFILSVLFSFIVMKLNLTAGIIPSLNVSAGLLGFFF  98

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWT+FLE  G LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS  +A++    
Sbjct  99   VKTWTRFLESCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSGRIAQESADQ  158

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + ++IK+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKL YPSGTATAHLI  FHTP
Sbjct  159  PSAKDIKDPALGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLIYPSGTATAHLINSFHTP  218

Query  658  QGAKL  672
            +GAKL
Sbjct  219  EGAKL  223



>gb|AAD49762.2|AC007932_10 F11A17.8 [Arabidopsis thaliana]
Length=803

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 155/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  168  VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  227

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MS  +A Q    
Sbjct  228  VKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQSG--  285

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTP
Sbjct  286  DVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTP  345

Query  658  QGAKL  672
            QGAKL
Sbjct  346  QGAKL  350



>ref|XP_008645969.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Zea 
mays]
 gb|AFW72448.1| hypothetical protein ZEAMMB73_917654 [Zea mays]
Length=721

 Score =   217 bits (552),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 133/200 (67%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G+D   +  +     +ER+F  K VPSWR QLT RAF VS +L V+F  IVMKLNLTTGI
Sbjct  42   GLDGNGDAGADGQASLERVFADKAVPSWREQLTLRAFVVSALLAVMFNVIVMKLNLTTGI  101

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            +PSLNVSAGLLGFFFV+ WT  +E+ GFL HPFTRQENT+IQTCVV + GIAF GGFGSY
Sbjct  102  VPSLNVSAGLLGFFFVRMWTAAVERMGFLCHPFTRQENTIIQTCVVSAYGIAFSGGFGSY  161

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +FGMS+ +AKQ T   +  NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYP
Sbjct  162  LFGMSDKIAKQATEAKDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYP  221

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATA+LI  FHTP+GAKL
Sbjct  222  SGTATAYLINGFHTPEGAKL  241



>gb|KFK36098.1| hypothetical protein AALP_AA4G077100 [Arabis alpina]
Length=713

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 155/182 (85%), Gaps = 2/182 (1%)
 Frame = +1

Query  127  IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  306
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIP+LNVSAGLLGFFFVKT
Sbjct  51   IFESREVPSWKKQLTIRAFVVSFFLSILFSFIVMKLNLTTGIIPTLNVSAGLLGFFFVKT  110

Query  307  WTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNP  486
            WTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MSE +A Q    +  
Sbjct  111  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSERIANQSG--DAA  168

Query  487  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGA  666
              IK+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTPQGA
Sbjct  169  RGIKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTPQGA  228

Query  667  KL  672
            KL
Sbjct  229  KL  230



>ref|XP_010549024.1| PREDICTED: probable metal-nicotianamine transporter YSL8 isoform 
X1 [Tarenaya hassleriana]
Length=703

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  41   VERIFESREVPSWKKQLTVRAFVVSFGLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  100

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +KTWTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMS+ VAK     
Sbjct  101  LKTWTKVLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSQRVAKHAG--  158

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            ++    K+P + W++GFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  159  DSYLGFKDPSLGWIMGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  218

Query  658  QGAKL  672
            QGAKL
Sbjct  219  QGAKL  223



>ref|XP_007210334.1| hypothetical protein PRUPE_ppa002002mg [Prunus persica]
 gb|EMJ11533.1| hypothetical protein PRUPE_ppa002002mg [Prunus persica]
Length=731

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 160/185 (86%), Gaps = 1/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE + VPSW+ QLT RAF +S VL VLF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  67   VERIFEQQTVPSWKEQLTVRAFFISLVLSVLFSLIVMKLNLTTGIIPSLNVSAGLLGFFF  126

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TWTKFL++ G LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS  +A+Q +  
Sbjct  127  VRTWTKFLDRCGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSARIAQQ-SAD  185

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            ++  +IK PG+ W IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  186  SSTSDIKEPGLLWFIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  245

Query  658  QGAKL  672
            QGAKL
Sbjct  246  QGAKL  250



>gb|AAS00697.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
Length=724

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 155/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE IFES+EVPSW+ QLT RAF VSF L +LF+F+VMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  56   VEGIFESREVPSWKKQLTIRAFVVSFALSILFSFVVMKLNLTTGIIPSLNVSAGLLGFFF  115

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TWTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MS  +A Q    
Sbjct  116  VETWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQSG--  173

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + WMI FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTP
Sbjct  174  DVARGVKDPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTP  233

Query  658  QGAKL  672
            QGAKL
Sbjct  234  QGAKL  238



>ref|XP_004953195.1| PREDICTED: probable metal-nicotianamine transporter YSL14-like 
[Setaria italica]
Length=724

 Score =   216 bits (549),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 133/202 (66%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTT  246
            D G+       + ++  VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTT
Sbjct  43   DEGMCGNGTAGAGDAASVERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTT  102

Query  247  GIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfg  426
            GIIPSLNVSAGLLGFFFV+ WT  +E+ GFL+ PFTRQENTVIQTCVV + GIAF GGFG
Sbjct  103  GIIPSLNVSAGLLGFFFVRMWTAAVERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFG  162

Query  427  symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            SY+FGMS+ +A Q T   +  NIK+P + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLT
Sbjct  163  SYLFGMSDKIANQATEAKDANNIKDPHLGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLT  222

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YPSGTATA+LI  FHTP+GAKL
Sbjct  223  YPSGTATAYLINGFHTPEGAKL  244



>gb|AAL09744.1| AT3g17650/MKP6_20 [Arabidopsis thaliana]
 gb|AAN46868.1| At3g17650/MKP6_20 [Arabidopsis thaliana]
Length=714

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFES+EVPSW+ QLT RAF VSF+L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  47   VEKIFESREVPSWKKQLTVRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFF  106

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L +SG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+FGMSE +A Q    
Sbjct  107  VKTWTKMLHRSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQS--G  164

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            +    +K+P + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATAHLI  FHT 
Sbjct  165  DVSRGVKDPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTT  224

Query  658  QGAKL  672
            QGAKL
Sbjct  225  QGAKL  229



>gb|AEQ28190.1| yellow stripe-like protein 5 [Malus baccata var. xiaojinensis]
Length=733

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 161/185 (87%), Gaps = 3/185 (2%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE++FE++ VPSWR QLTFRAF +SFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  69   VEKLFENQPVPSWREQLTFRAFFISFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  128

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TWTKFLE+ G L  PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE +A+Q    
Sbjct  129  VRTWTKFLERCGLLNQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAQQ---S  185

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             +  + K+PG+ W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  186  KDRSDTKDPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  245

Query  658  QGAKL  672
            +G KL
Sbjct  246  EGVKL  250



>gb|EMT06635.1| Putative metal-nicotianamine transporter YSL14 [Aegilops tauschii]
Length=711

 Score =   215 bits (548),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 132/191 (69%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            S E   VE++F  K VPSWR QLT RA  VS +L V+F+ IVMKLNLTTGIIPSLNVSAG
Sbjct  44   SPEDASVEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAG  103

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLGFFFV+ WT   E+ G + HPFTRQENTVIQTCVV + GIAF GGFGSY+FGMS+++A
Sbjct  104  LLGFFFVRLWTNAFERMGLVGHPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIA  163

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
            KQ T  N+P NIK P + WMIGFLF+VSF+G+F++VP+RK+MI+D+KLTYPSGTATA+LI
Sbjct  164  KQATEANDPWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLI  223

Query  640  XXFHTPQGAKL  672
              FHTP+GAKL
Sbjct  224  NGFHTPEGAKL  234



>ref|XP_010501891.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=627

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = +1

Query  127  IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  306
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  59   IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  118

Query  307  WTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNP  486
            WTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MS+ +A Q    +  
Sbjct  119  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQSG--DAF  176

Query  487  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGA  666
              +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTPQGA
Sbjct  177  RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  236

Query  667  KL  672
            KL
Sbjct  237  KL  238



>ref|XP_010933277.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=727

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 162/195 (83%), Gaps = 2/195 (1%)
 Frame = +1

Query  88   KNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLN  267
            ++ED + S  +E+ FE K VP+WR QLT RAF VSF L VLF+ IVMKLNLTTGIIPSLN
Sbjct  53   RSEDKTMS--MEKAFEGKRVPTWREQLTLRAFVVSFFLSVLFSIIVMKLNLTTGIIPSLN  110

Query  268  VSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgms  447
            V+AGLLGFFF+KTWTK LEK+G L+ PFTRQENTVIQTC V +  IAF GGFGSY+FGMS
Sbjct  111  VAAGLLGFFFIKTWTKALEKTGLLRLPFTRQENTVIQTCCVAAYDIAFSGGFGSYLFGMS  170

Query  448  ESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTAT  627
              +AKQ +  NN ++IK+P + WMIGFLFVVSFLGLFS+VPLRK+MIID+KL YPSGTAT
Sbjct  171  GRIAKQASEANNEQDIKDPKLGWMIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTAT  230

Query  628  AHLIXXFHTPQGAKL  672
            A LI  FHTP+GAKL
Sbjct  231  AFLINGFHTPEGAKL  245



>ref|XP_010666835.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Beta 
vulgaris subsp. vulgaris]
Length=672

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +1

Query  97   DSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSA  276
            D+S +  +E+ FE+ EVP W+ QLT RAF VSF+L +LFTFIVMKLNLTTGIIPSLN+SA
Sbjct  15   DASMTTSIEKNFEATEVPPWQQQLTLRAFVVSFLLSILFTFIVMKLNLTTGIIPSLNISA  74

Query  277  GLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESV  456
            GLLGFFFVK WTK LEKSGFLK PFTRQENTVIQTC+V SSGIAF GG  SY+ GMSE +
Sbjct  75   GLLGFFFVKCWTKLLEKSGFLKQPFTRQENTVIQTCIVASSGIAFSGGAASYVLGMSERI  134

Query  457  AKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHL  636
            A  +       + KNP + WMIGFLFVVSF+GLFSVVPLRK+MIIDFKLTYPSGTATAHL
Sbjct  135  A-NLGEKAYLLDTKNPSLGWMIGFLFVVSFIGLFSVVPLRKIMIIDFKLTYPSGTATAHL  193

Query  637  IXXFHTPQGA  666
            I  FHTP+GA
Sbjct  194  INSFHTPEGA  203



>ref|NP_001276131.1| uncharacterized protein LOC100809484 [Glycine max]
 gb|AFD96645.1| YSL1 [Glycine max]
Length=682

 Score =   213 bits (542),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 138/193 (72%), Positives = 157/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  94   EDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVS  273
            E +  +  VE+ FE KEVP W  Q+T R+  VS VLGV+FTFIVMKLNLTTGIIPSLN+S
Sbjct  15   EVAEAAASVEKAFEGKEVPPWERQVTVRSMVVSLVLGVMFTFIVMKLNLTTGIIPSLNIS  74

Query  274  AGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsES  453
            AGLLGFFFVK WTK L KSG L  P+TRQENTVIQTCVV SSGIAF GGFGSY+FGMS  
Sbjct  75   AGLLGFFFVKAWTKLLAKSGMLMQPYTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSSD  134

Query  454  VAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAH  633
            +AKQ +     ++IK+PG+ WMI F FVVSFLGLFS+VPLRK+MI+DFKLTYPSGTATAH
Sbjct  135  IAKQ-SPEATAQDIKDPGLGWMIAFAFVVSFLGLFSLVPLRKIMIVDFKLTYPSGTATAH  193

Query  634  LIXXFHTPQGAKL  672
            LI  FHT +GAKL
Sbjct  194  LINSFHTTEGAKL  206



>ref|XP_008393519.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Malus 
domestica]
Length=733

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 161/185 (87%), Gaps = 3/185 (2%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE++FE++ VPSWR QLTFRAF +SFVL +LF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  69   VEKLFENQPVPSWREQLTFRAFFISFVLSILFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  128

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TWTKFLE+ G L  PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE +A+Q    
Sbjct  129  VRTWTKFLERCGLLNQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSERIAQQ---S  185

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             +  + K+PG+ W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA+LI  FHTP
Sbjct  186  KDRSDTKDPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHTP  245

Query  658  QGAKL  672
            +G KL
Sbjct  246  EGVKL  250



>ref|XP_008676713.1| PREDICTED: uncharacterized protein LOC100272237 isoform X1 [Zea 
mays]
 gb|ACN34648.1| unknown [Zea mays]
 gb|ADG21035.1| oligopeptide transporter [Zea mays]
 gb|ADO21000.1| yellow stripe-like transporter 14A [Zea mays]
 gb|AFW63091.1| transposon protein [Zea mays]
Length=716

 Score =   213 bits (542),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 133/185 (72%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  52   VERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  111

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT   E+ GFL+ PFTRQENTVIQTCVV + GIAF GGFGSY+FGMS+ +AKQ T  
Sbjct  112  VRMWTAAAERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATEA  171

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             +  NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  172  KDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  231

Query  658  QGAKL  672
            +GAKL
Sbjct  232  EGAKL  236



>ref|NP_001152285.1| yellow stripe-like transporter 14A [Zea mays]
 gb|ACG46801.1| transposon protein [Zea mays]
Length=716

 Score =   213 bits (542),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 133/185 (72%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F  K VPSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  52   VERVFADKAVPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  111

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT   E+ GFL+ PFTRQENTVIQTCVV + GIAF GGFGSY+FGMS+ +AKQ T  
Sbjct  112  VRMWTAAAERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATEA  171

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             +  NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  172  KDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  231

Query  658  QGAKL  672
            +GAKL
Sbjct  232  EGAKL  236



>ref|XP_006306886.1| hypothetical protein CARUB_v10008440mg [Capsella rubella]
 gb|EOA39784.1| hypothetical protein CARUB_v10008440mg [Capsella rubella]
Length=723

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = +1

Query  127  IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  306
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  60   IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  119

Query  307  WTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNP  486
            WTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MS+ +A Q    +  
Sbjct  120  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQSG--DAF  177

Query  487  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGA  666
              +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTPQGA
Sbjct  178  RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  237

Query  667  KL  672
            KL
Sbjct  238  KL  239



>ref|XP_004978143.1| PREDICTED: probable metal-nicotianamine transporter YSL13-like 
[Setaria italica]
Length=733

 Score =   213 bits (543),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 133/185 (72%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER F  + VPSWR QLT RAF VSF L VLF+ IVMKLNLTTGIIPSLN+SAGLLGFFF
Sbjct  68   VERAFAGQPVPSWREQLTVRAFVVSFFLAVLFSIIVMKLNLTTGIIPSLNISAGLLGFFF  127

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WTK +E  G LK PFTRQENTVIQTCVV S G+AF GGFGSY+  MS+ +A   T  
Sbjct  128  VRLWTKAIESVGLLKQPFTRQENTVIQTCVVASYGLAFSGGFGSYLLAMSDKIAAMSTEA  187

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+ +NIKNP + W+IGFLF+VSF+GLF +VPLRKVMI+D+KLTYPSGTATA+LI  FHTP
Sbjct  188  NDAQNIKNPQLGWIIGFLFLVSFIGLFGLVPLRKVMIVDYKLTYPSGTATAYLINGFHTP  247

Query  658  QGAKL  672
            QGAKL
Sbjct  248  QGAKL  252



>ref|XP_010461657.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=721

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = +1

Query  127  IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  306
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  58   IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  117

Query  307  WTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNP  486
            WTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MS+ +A Q    +  
Sbjct  118  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQSG--DAF  175

Query  487  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGA  666
              +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTPQGA
Sbjct  176  RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  235

Query  667  KL  672
            KL
Sbjct  236  KL  237



>ref|XP_010479258.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=722

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = +1

Query  127  IFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  306
            IFES+EVPSW+ QLT RAF VSF L +LF+FIVMKLNLTTGIIPSLNVSAGLLGFFFVKT
Sbjct  58   IFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKT  117

Query  307  WTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNP  486
            WTK L KSG LK PFTRQENTVIQTCVV SSGIAF GGFG+Y+F MS+ +A Q    +  
Sbjct  118  WTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSQRIADQSG--DAF  175

Query  487  ENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGA  666
              +K+P + W+I FLFVVSFLGLFSVVPLRK+MIIDFKL YPSGTATAHLI  FHTPQGA
Sbjct  176  RGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGA  235

Query  667  KL  672
            KL
Sbjct  236  KL  237



>ref|XP_008802875.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Phoenix 
dactylifera]
Length=392

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 157/194 (81%), Gaps = 2/194 (1%)
 Frame = +1

Query  88   KNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLN  267
            ++ED + S  +ER FE K VP+WR QLT RA  VSF L V+ + IV KLNLTTGIIPSLN
Sbjct  64   RSEDKAMS--IERAFEGKRVPTWREQLTLRALVVSFFLSVMLSIIVTKLNLTTGIIPSLN  121

Query  268  VSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgms  447
            V+AGLLGFFF+KTWTK LEK+G L+ PFTRQENTVIQTC V + GIAF GGFG+Y+FGMS
Sbjct  122  VAAGLLGFFFIKTWTKALEKTGLLRLPFTRQENTVIQTCCVAAYGIAFSGGFGNYLFGMS  181

Query  448  ESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTAT  627
              +A Q +  NN +NIK+P + WMIGFLF VSFLGLFSVVPLRK+MIID+KL YPSGTAT
Sbjct  182  GRIANQASEANNEQNIKDPKLGWMIGFLFAVSFLGLFSVVPLRKIMIIDYKLIYPSGTAT  241

Query  628  AHLIXXFHTPQGAK  669
            A LI  FHTP+GAK
Sbjct  242  AFLINGFHTPEGAK  255



>gb|AET00398.2| OPT family oligopeptide transporter [Medicago truncatula]
Length=682

 Score =   212 bits (540),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 138/198 (70%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            D + +++  +   +E+ FE K VPSW+ Q+T RA  VS +L V+FTFIVMKLNLTTGIIP
Sbjct  9    DVETSDEQLDEISIEKGFEGKSVPSWQKQVTVRAIVVSIMLSVMFTFIVMKLNLTTGIIP  68

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNVSAGLLGFFFVKTWTK LEK+G+L  PFTRQENTVIQTCVV +SGIAF GGFGSY+F
Sbjct  69   SLNVSAGLLGFFFVKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLF  128

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMS ++AKQ+       ++K+ G+ WMI FLFVVSFLGLFSVVPLRK+MI+DFKLTYPSG
Sbjct  129  GMSPTIAKQIPEAGTANDVKSLGLGWMIAFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSG  188

Query  619  TATAHLIXXFHTPQGAKL  672
            TATAHLI  FHT +GAKL
Sbjct  189  TATAHLINSFHTSEGAKL  206



>ref|XP_009383038.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=688

 Score =   212 bits (540),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 134/185 (72%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+FE + VP+WR QLT RAF VSF L V+F+ IVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  26   VERVFEGQRVPAWREQLTVRAFVVSFFLAVMFSVIVMKLNLTTGIIPSLNVAAGLLGFFF  85

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK WTK LE +G L+ PFTRQENTVIQTCVV + G+AF GG+GSY+FGMS  VA Q T  
Sbjct  86   VKLWTKGLESTGLLRTPFTRQENTVIQTCVVAAYGLAFSGGYGSYLFGMSSRVAAQATDD  145

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            ++ +NIK+P + WMIGF+FVVSFLGLFSVVPLRK+M+ID+KL YPSGTATA+LI  FHTP
Sbjct  146  DDSQNIKDPRLGWMIGFMFVVSFLGLFSVVPLRKIMVIDYKLIYPSGTATAYLINGFHTP  205

Query  658  QGAKL  672
            QG KL
Sbjct  206  QGEKL  210



>ref|XP_003617439.1| Yellow stripe-like protein 2.8 [Medicago truncatula]
Length=690

 Score =   212 bits (540),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 138/198 (70%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            D + +++  +   +E+ FE K VPSW+ Q+T RA  VS +L V+FTFIVMKLNLTTGIIP
Sbjct  9    DVETSDEQLDEISIEKGFEGKSVPSWQKQVTVRAIVVSIMLSVMFTFIVMKLNLTTGIIP  68

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNVSAGLLGFFFVKTWTK LEK+G+L  PFTRQENTVIQTCVV +SGIAF GGFGSY+F
Sbjct  69   SLNVSAGLLGFFFVKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLF  128

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMS ++AKQ+       ++K+ G+ WMI FLFVVSFLGLFSVVPLRK+MI+DFKLTYPSG
Sbjct  129  GMSPTIAKQIPEAGTANDVKSLGLGWMIAFLFVVSFLGLFSVVPLRKIMIVDFKLTYPSG  188

Query  619  TATAHLIXXFHTPQGAKL  672
            TATAHLI  FHT +GAKL
Sbjct  189  TATAHLINSFHTSEGAKL  206



>ref|XP_010675190.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Beta 
vulgaris subsp. vulgaris]
Length=683

 Score =   212 bits (539),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 141/192 (73%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +1

Query  97   DSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSA  276
            D+  S  VE++F SK V  W+ QLT RAF VSF L +LFTFIVMKLNLTTG+IPSLNVSA
Sbjct  24   DTDLSASVEKVFSSKPVLPWKQQLTVRAFVVSFFLSILFTFIVMKLNLTTGVIPSLNVSA  83

Query  277  GLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESV  456
            GLLG+FFVK WTKFLEK GFLK PFTRQENTVIQTCVV +SGIAF GGFGSY+ GMSE +
Sbjct  84   GLLGYFFVKVWTKFLEKFGFLKQPFTRQENTVIQTCVVAASGIAFSGGFGSYILGMSERI  143

Query  457  AKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHL  636
            AKQ        + KNP + W+IGFLFVVSFLGLFSVVPLRK+M+IDFKLTYPSGTATA+L
Sbjct  144  AKQAD-RGYQHDSKNPHLGWLIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAYL  202

Query  637  IXXFHTPQGAKL  672
            I  FHTP+GA L
Sbjct  203  INSFHTPKGAIL  214



>ref|XP_006653609.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like, 
partial [Oryza brachyantha]
Length=670

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  106  ESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLL  285
            E+  VER+F  + VP+WR QLT RAF V F+L V+F  IVMKL+LTTG+IPSLNVSA LL
Sbjct  5    EAPSVERVFADRPVPAWREQLTVRAFVVGFLLSVMFNVIVMKLSLTTGVIPSLNVSASLL  64

Query  286  GFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQ  465
            GFF V+ WT  +E+ GFLK PFTRQENTVIQTCVV + G+AF GGFGSY+FGMSE++AKQ
Sbjct  65   GFFLVRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQ  124

Query  466  MTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXX  645
             T  N+P N+KNP + W+IGFLF+VSF+GLF++VP+RKVMI+D+KLTYPSGTATA+LI  
Sbjct  125  ATEANDPLNVKNPHIGWIIGFLFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLING  184

Query  646  FHTPQGAKL  672
            FHTP+GA+L
Sbjct  185  FHTPEGAEL  193



>gb|KDO46150.1| hypothetical protein CISIN_1g005295mg [Citrus sinensis]
Length=703

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 156/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER F+ KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  43   VERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  102

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTKFLE S  L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+ GMS+ +A Q    
Sbjct  103  VKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIALQSEDT  162

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N     KN  + W+IGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATA+LI  FHTP
Sbjct  163  N--LGYKNLSLTWIIGFLFVVSFLGLFSVVPLRKVMIIDFKLTYPSGTATAYLINSFHTP  220

Query  658  QGAKL  672
            +GA+L
Sbjct  221  EGARL  225



>dbj|BAE91892.1| hypothetical protein [Oryza sativa Japonica Group]
Length=716

 Score =   211 bits (538),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 128/176 (73%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = +1

Query  145  VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLE  324
            VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFFV+ WT  +E
Sbjct  64   VPSWREQLTVRAFVVSFFLSIMFSIIVMKLNLTTGIIPSLNVSAGLLGFFFVRLWTAAIE  123

Query  325  KSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNPENIKNP  504
            + G L+ PFTRQENTVIQTCVV + GIAF GGFG+Y+FGMSE++AKQ T  NN +N+KNP
Sbjct  124  RVGLLRQPFTRQENTVIQTCVVAAYGIAFSGGFGTYLFGMSETIAKQATEANNAQNVKNP  183

Query  505  GVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
             + WMIGFLF+VSF+GL ++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP+GAKL
Sbjct  184  HIGWMIGFLFLVSFIGLLALVPLRKIMIVDYKLTYPSGTATAYLINGFHTPEGAKL  239



>ref|XP_002520094.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF42283.1| oligopeptide transporter, putative [Ricinus communis]
Length=694

 Score =   211 bits (537),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 143/185 (77%), Positives = 156/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+IFE +EVPSWR QLT RAF VSFVL +LF+FIVMKLNLTTGI+P LNVSAGLLGFFF
Sbjct  34   VEQIFEEQEVPSWRKQLTVRAFLVSFVLSILFSFIVMKLNLTTGILPLLNVSAGLLGFFF  93

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +K WT FL K   L  PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMSE++AKQ    
Sbjct  94   LKIWTSFLSKFRLLSQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSETIAKQSA--  151

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             +  + KNP + WMIGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  152  EDKIDHKNPSLPWMIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  211

Query  658  QGAKL  672
             GAKL
Sbjct  212  AGAKL  216



>ref|XP_010276313.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nelumbo 
nucifera]
Length=268

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  121  ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  300
            ER FE KE+P W+NQLT RAF VSF+LG+LFTFIVMK+NLTTGIIPSLNVSAGLLGFFFV
Sbjct  38   ERTFECKEIPPWQNQLTLRAFVVSFLLGILFTFIVMKINLTTGIIPSLNVSAGLLGFFFV  97

Query  301  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXN  480
            K+WTK LEKSG L+ PFTRQENT+IQTCVV  SGIAF GG  SY+ GMS    KQ    N
Sbjct  98   KSWTKLLEKSGMLRQPFTRQENTIIQTCVVAISGIAFSGGVESYILGMSLFEVKQSAEAN  157

Query  481  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQ  660
              +N+KNP + WMIGFLFVV FLGLFS+VPL K++I+DFKL Y  GTATAHL+  FH+ Q
Sbjct  158  AAQNVKNPELGWMIGFLFVVLFLGLFSIVPLHKIVIVDFKLAYSCGTATAHLMNSFHSSQ  217

Query  661  GAKL  672
              + 
Sbjct  218  DVEF  221



>gb|EMT14396.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii]
Length=723

 Score =   211 bits (537),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 126/185 (68%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +ER+F  + VPSWR QLT RAF  SF L V+F  IVMKLNLT G+IPSLNVSAGLLGFFF
Sbjct  59   LERVFADQRVPSWREQLTVRAFVASFFLAVMFNIIVMKLNLTIGVIPSLNVSAGLLGFFF  118

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ G LK PFTRQENTVIQTCVV + GI + GGFG+Y+  MS  +A Q T  
Sbjct  119  VRLWTSAIERMGLLKQPFTRQENTVIQTCVVAAYGIPYSGGFGNYLLAMSGRIASQTTEA  178

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NNP+NIKNP + W+IGFLF+VSF+GLF +VPLRK+MIID+KLTYPSGTATA+LI  FHTP
Sbjct  179  NNPQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKIMIIDYKLTYPSGTATAYLINGFHTP  238

Query  658  QGAKL  672
             GAK+
Sbjct  239  HGAKI  243



>ref|XP_006441429.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
 gb|ESR54669.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
Length=703

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 156/185 (84%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER F+ KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  43   VERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  102

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTKFLE S  L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+ GMS+ +A Q    
Sbjct  103  VKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIALQSEDT  162

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N     KN  + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA+LI  FHTP
Sbjct  163  N--LGYKNLSLTWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHTP  220

Query  658  QGAKL  672
            +GA+L
Sbjct  221  EGARL  225



>ref|XP_002449540.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor]
 gb|EES08528.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor]
Length=722

 Score =   211 bits (537),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 128/185 (69%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER F  + VPSWR QLT RAF VSF L V+F+ IVMKLNLTTGIIPSLN+SAGLLGFFF
Sbjct  59   VERAFADQPVPSWREQLTVRAFVVSFFLAVMFSIIVMKLNLTTGIIPSLNISAGLLGFFF  118

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT+ +E  G L+ PFTRQENTVIQTCVV S G+AF GGFGSY+  MS+ +A  +T  
Sbjct  119  VRLWTRAIESVGLLRQPFTRQENTVIQTCVVASYGLAFSGGFGSYLLAMSDKIAAMVTEA  178

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NN +NIK+P + W+IGFLF+VSF+GLF +VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  179  NNAQNIKDPQLGWIIGFLFLVSFIGLFGLVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  238

Query  658  QGAKL  672
            QGA+L
Sbjct  239  QGARL  243



>ref|XP_008669136.1| PREDICTED: probable metal-nicotianamine transporter YSL13 [Zea 
mays]
 tpg|DAA36870.1| TPA: hypothetical protein ZEAMMB73_694828 [Zea mays]
Length=725

 Score =   210 bits (535),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 127/183 (69%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +1

Query  124  RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  303
            R F  + VPSWR QLT RAF VSF L V+F+ IVMKLNLTTGIIPSLN+SAGLLGFFFV+
Sbjct  64   RAFADQPVPSWREQLTLRAFVVSFFLAVMFSVIVMKLNLTTGIIPSLNISAGLLGFFFVR  123

Query  304  TWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNN  483
             WTK +E  G L+ PFTRQENTVIQTCVV S G++F GGFG+Y+  MS+ +A  +T  NN
Sbjct  124  LWTKAIESVGLLRQPFTRQENTVIQTCVVASYGLSFSGGFGNYLLAMSDKIAAMVTEANN  183

Query  484  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQG  663
             +NIKNP + W+IGFLF+VSF+GLF +VPLRK+MI+D+KLTYPSGTATA+LI  FHTPQG
Sbjct  184  AQNIKNPQLGWIIGFLFLVSFIGLFGLVPLRKIMIVDYKLTYPSGTATAYLINGFHTPQG  243

Query  664  AKL  672
            AKL
Sbjct  244  AKL  246



>ref|XP_002446810.1| hypothetical protein SORBIDRAFT_06g023020 [Sorghum bicolor]
 gb|EES11138.1| hypothetical protein SORBIDRAFT_06g023020 [Sorghum bicolor]
Length=723

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
            N +      VE+ FE K VPSWR QLT RAF V F+L +LF+ IVMKLNLTTGIIPSLNV
Sbjct  52   NAEEEVVASVEQAFEDKPVPSWREQLTVRAFVVGFILSILFSVIVMKLNLTTGIIPSLNV  111

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            SA LLGFF V+ WTK +E  G LK PFTRQENTVIQTCVV + G+AF GGFGSY+FGMS 
Sbjct  112  SASLLGFFLVRLWTKAIESMGLLKQPFTRQENTVIQTCVVSAYGLAFSGGFGSYLFGMSR  171

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
            S+A+Q T  N+ +NIK+P + WMIGF+F+VSF+GLF +VPLRKVMI+D+KLTYPSGTATA
Sbjct  172  SIAEQATEANDAQNIKDPHLGWMIGFMFLVSFVGLFVLVPLRKVMIVDYKLTYPSGTATA  231

Query  631  HLIXXFHTPQGAK  669
            +LI  FHTPQGA+
Sbjct  232  YLINGFHTPQGAE  244



>ref|XP_002452492.1| hypothetical protein SORBIDRAFT_04g026840 [Sorghum bicolor]
 gb|EES05468.1| hypothetical protein SORBIDRAFT_04g026840 [Sorghum bicolor]
Length=728

 Score =   210 bits (535),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 131/185 (71%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F  K +PSWR QLT RAF VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  64   VERVFADKALPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  123

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ GFL+ PFTRQENTVIQTCVV + GIAF GGFGSY+FGMS+ +A Q T  
Sbjct  124  VRMWTAAVERMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIANQATEA  183

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             +  NIK+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  184  KDANNIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTP  243

Query  658  QGAKL  672
            +GAKL
Sbjct  244  EGAKL  248



>dbj|BAJ89062.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   209 bits (533),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 130/191 (68%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            S E   VE++F  K VPSWR QLT RA  VS +L V+F+ IVMKLNLTTGIIPSLNVSAG
Sbjct  44   SPEDASVEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAG  103

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLGFFFV+ WT   E+ G +  PFTRQENTVIQTCVV + GIAF GGFGSY+FGMS+++A
Sbjct  104  LLGFFFVRLWTSAFERMGLIGQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIA  163

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
            KQ T  N+  NIK P + WMIGFLF+VSF+G+F++VP+RK+MI+D+KLTYPSGTATA+LI
Sbjct  164  KQATEANDAWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLI  223

Query  640  XXFHTPQGAKL  672
              FHTP+GAKL
Sbjct  224  NGFHTPEGAKL  234



>dbj|BAJ92335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   209 bits (533),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 130/191 (68%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            S E   VE++F  K VPSWR QLT RA  VS +L V+F+ IVMKLNLTTGIIPSLNVSAG
Sbjct  44   SPEDASVEQVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAG  103

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLGFFFV+ WT   E+ G +  PFTRQENTVIQTCVV + GIAF GGFGSY+FGMS+++A
Sbjct  104  LLGFFFVRLWTSAFERMGLIGQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDTIA  163

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
            KQ T  N+  NIK P + WMIGFLF+VSF+G+F++VP+RK+MI+D+KLTYPSGTATA+LI
Sbjct  164  KQATEANDAWNIKEPHLGWMIGFLFLVSFIGIFALVPMRKIMIVDYKLTYPSGTATAYLI  223

Query  640  XXFHTPQGAKL  672
              FHTP+GAKL
Sbjct  224  NGFHTPEGAKL  234



>ref|XP_003575422.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Brachypodium 
distachyon]
Length=715

 Score =   209 bits (532),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 129/185 (70%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F  K VPSWR QLT RA  VS +L V+F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  54   VERVFADKAVPSWREQLTLRALVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  113

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT   E+ G    PFTRQENTVIQTCVV + GIAF GGFGSY+FGMSE++AKQ T  
Sbjct  114  VRLWTSAFERMGLFHQPFTRQENTVIQTCVVSAYGIAFSGGFGSYIFGMSETIAKQATEA  173

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             + +NIK+P + WMIGFLF+VSF+G+F++VP+RK+MI+D+KLTYPSGTATA+LI  FHTP
Sbjct  174  KDAQNIKDPHLGWMIGFLFLVSFVGIFALVPMRKIMIVDYKLTYPSGTATAYLINGFHTP  233

Query  658  QGAKL  672
            +GAKL
Sbjct  234  EGAKL  238



>ref|XP_003581442.1| PREDICTED: probable metal-nicotianamine transporter YSL13 [Brachypodium 
distachyon]
Length=724

 Score =   209 bits (532),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 125/193 (65%), Positives = 152/193 (79%), Gaps = 0/193 (0%)
 Frame = +1

Query  94   EDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVS  273
            ED   +  VE+ F  + VP+WR QLT RAF VSF L V+F+ IVMKLNLT G+IPSLNVS
Sbjct  52   EDEVAAASVEQAFADQRVPTWREQLTVRAFVVSFFLAVMFSVIVMKLNLTIGVIPSLNVS  111

Query  274  AGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsES  453
            AGLL FFFV+ WT  ++K G L+ PFTRQENTVIQTCVV +  IAF GGFG+Y+  MS+ 
Sbjct  112  AGLLSFFFVRLWTAAIQKVGLLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLLAMSDR  171

Query  454  VAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAH  633
            +A Q T  +NP+NIKNP + W+IGFL +VSF+GLF +VPLRK+MIID+KLTYPSGTATA+
Sbjct  172  IASQSTEADNPQNIKNPHLGWIIGFLLLVSFIGLFGLVPLRKIMIIDYKLTYPSGTATAY  231

Query  634  LIXXFHTPQGAKL  672
            LI  FHTP GAK+
Sbjct  232  LINGFHTPHGAKI  244



>ref|XP_009413131.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=688

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 157/197 (80%), Gaps = 2/197 (1%)
 Frame = +1

Query  88   KNEDSSESG--CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPS  261
            +N    E+G   VER FE + VP WR QLT RA  VSF L V+F+ IVMKLNLTTGIIPS
Sbjct  13   ENPRKEETGPVSVERAFEGQRVPGWREQLTARALVVSFFLSVMFSVIVMKLNLTTGIIPS  72

Query  262  LNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfg  441
            LNV+AGLLGFFFVK WTK LE +G L+ PFTRQENTVIQTCVV + G+AF GGFGSY+FG
Sbjct  73   LNVAAGLLGFFFVKLWTKGLESTGLLRTPFTRQENTVIQTCVVAAYGLAFSGGFGSYIFG  132

Query  442  msESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGT  621
            MS  +A Q T  NN +NIK P + WMIGF+FVVSFLGLFS+VPLRK+MIID+KL YPSGT
Sbjct  133  MSSRIADQATEENNSQNIKEPKLGWMIGFMFVVSFLGLFSLVPLRKIMIIDYKLIYPSGT  192

Query  622  ATAHLIXXFHTPQGAKL  672
            ATA+LI  FHTPQG KL
Sbjct  193  ATAYLINGFHTPQGEKL  209



>ref|XP_004299460.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Fragaria 
vesca subsp. vesca]
Length=711

 Score =   209 bits (531),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 139/185 (75%), Positives = 158/185 (85%), Gaps = 3/185 (2%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE++F  +EVPSW  QLTFRAF +S +L VLF+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  51   VEKLFAKQEVPSWTRQLTFRAFIISGMLSVLFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  110

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V TWTK + K+GFL  PFTRQENTVIQTC+V SSGIAF GGFGSY+FGMS+ +A Q    
Sbjct  111  VSTWTKIVTKAGFLTQPFTRQENTVIQTCIVASSGIAFSGGFGSYLFGMSDRIAAQ---S  167

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            ++  + KNPG+ W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATAHLI  FHTP
Sbjct  168  SDRGDTKNPGLLWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAHLINSFHTP  227

Query  658  QGAKL  672
            +GAKL
Sbjct  228  EGAKL  232



>ref|XP_004500424.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cicer arietinum]
Length=670

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = +1

Query  97   DSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSA  276
            D  E   VER FE K VP+W+ Q+T RA  VS VL VLF+FIVMKLNLTTGIIPSLNVSA
Sbjct  3    DEIEEISVERGFEGKSVPTWQKQVTVRAIFVSMVLSVLFSFIVMKLNLTTGIIPSLNVSA  62

Query  277  GLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESV  456
            GLLGFFFVKTWTK L KSG L  PFTRQENTVIQTCVV +SGIAF GGFGSY+F MS ++
Sbjct  63   GLLGFFFVKTWTKLLAKSGLLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFAMSPAI  122

Query  457  AKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHL  636
            A Q    +   + K+PG+ WMI FLFVVSFLGLFSVVPLRK+MI+DF+LTYPSGTATAHL
Sbjct  123  ADQSPDASTAIDTKSPGLGWMISFLFVVSFLGLFSVVPLRKIMIVDFRLTYPSGTATAHL  182

Query  637  IXXFHTPQGAKL  672
            I  FHT +GAKL
Sbjct  183  INSFHTTEGAKL  194



>emb|CAH67887.1| OSIGBa0153E02-OSIGBa0093I20.16 [Oryza sativa Indica Group]
 gb|EAY94901.1| hypothetical protein OsI_16701 [Oryza sativa Indica Group]
Length=712

 Score =   209 bits (531),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 128/185 (69%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+ F  K VPSWR QLT RAF V F+L ++F  IVMKL+LTTG+IPSLNVSA LLGFF 
Sbjct  50   VEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFFL  109

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ GFLK PFTRQENTVIQTCVV + G+AF GGFGSY+FGMSE++AKQ T  
Sbjct  110  VRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATEA  169

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+P NIKNP + W+IGF+F+VSF+GLF++VP+RKVMI+D+KLTYPSGTATA+LI  FHTP
Sbjct  170  NDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHTP  229

Query  658  QGAKL  672
            +GA L
Sbjct  230  EGADL  234



>sp|Q7X660.1|YSL11_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL11; 
AltName: Full=Protein YELLOW STRIPE LIKE 11; Short=OsYSL11 
[Oryza sativa Japonica Group]
 emb|CAE05635.1| OSJNBa0038O10.1 [Oryza sativa Japonica Group]
 emb|CAI44638.1| OSJNBb0065J09.18 [Oryza sativa Japonica Group]
 gb|EAZ31387.1| hypothetical protein OsJ_15515 [Oryza sativa Japonica Group]
Length=712

 Score =   208 bits (530),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 128/185 (69%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+ F  K VPSWR QLT RAF V F+L ++F  IVMKL+LTTG+IPSLNVSA LLGFF 
Sbjct  50   VEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFFL  109

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ GFLK PFTRQENTVIQTCVV + G+AF GGFGSY+FGMSE++AKQ T  
Sbjct  110  VRLWTAAIERVGFLKQPFTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATEA  169

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+P NIKNP + W+IGF+F+VSF+GLF++VP+RKVMI+D+KLTYPSGTATA+LI  FHTP
Sbjct  170  NDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHTP  229

Query  658  QGAKL  672
            +GA L
Sbjct  230  EGADL  234



>ref|XP_010032362.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=688

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 153/200 (77%), Gaps = 2/200 (1%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G  S+  ED S    VERIFE + VPSWR QL FRAF VSF L V+  F  MKLNLTTGI
Sbjct  13   GSQSRSGEDESNGPSVERIFEGQGVPSWRRQLKFRAFAVSFALSVMLAF--MKLNLTTGI  70

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
             PSLNVSAGLLGFFFVKTWTK LEK G L+ PFT QENTVIQTCVV SSG  F GGFGSY
Sbjct  71   NPSLNVSAGLLGFFFVKTWTKVLEKFGLLRVPFTWQENTVIQTCVVASSGSTFSGGFGSY  130

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            +F MSE VA Q T   +    KNP + WMIGFLFVVSFLGLF+VVPLRK+MIIDFKL YP
Sbjct  131  LFAMSERVANQSTDPQSAYVYKNPSLPWMIGFLFVVSFLGLFAVVPLRKIMIIDFKLMYP  190

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHL   FHTP+GAKL
Sbjct  191  SGTATAHLRNSFHTPEGAKL  210



>emb|CAH67885.1| OSIGBa0153E02-OSIGBa0093I20.14 [Oryza sativa Indica Group]
 gb|EAY94898.1| hypothetical protein OsI_16698 [Oryza sativa Indica Group]
Length=724

 Score =   208 bits (530),  Expect = 6e-59, Method: Composition-based stats.
 Identities = 129/185 (70%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  60   VERVFADRPVPSWREQLTVRAFVVSFFLVIMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  119

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ G L+ PFTRQENTVIQTCVV    IAF GGFG+Y+  MSE +A   T  
Sbjct  120  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAGYDIAFSGGFGNYILSMSERIAGLGTEA  179

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NN +NIKNP + W+IGFLF+VSF+GLF +VPLRKVMIID+KLTYPSGTATA LI  FHTP
Sbjct  180  NNAQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKVMIIDYKLTYPSGTATAFLINGFHTP  239

Query  658  QGAKL  672
             GAK+
Sbjct  240  HGAKI  244



>sp|Q7XKF4.2|YSL13_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL13; 
AltName: Full=Protein YELLOW STRIPE LIKE 13; Short=OsYSL13 
[Oryza sativa Japonica Group]
 emb|CAE05719.2| OSJNBb0065J09.15 [Oryza sativa Japonica Group]
 dbj|BAE44204.1| hypothetical protein [Oryza sativa Japonica Group]
Length=724

 Score =   208 bits (529),  Expect = 9e-59, Method: Composition-based stats.
 Identities = 129/185 (70%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+F  + VPSWR QLT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  60   VERVFADRPVPSWREQLTVRAFVVSFFLVIMFSVIVMKLNLTTGIIPSLNVSAGLLGFFF  119

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ G L+ PFTRQENTVIQTCVV    IAF GGFG+Y+  MSE +A   T  
Sbjct  120  VRLWTAAIERVGLLRQPFTRQENTVIQTCVVAGYDIAFSGGFGNYILSMSERIAGLGTEA  179

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NN +NIKNP + W+IGFLF+VSF+GLF +VPLRKVMIID+KLTYPSGTATA LI  FHTP
Sbjct  180  NNAQNIKNPHLGWIIGFLFLVSFIGLFGLVPLRKVMIIDYKLTYPSGTATAFLINGFHTP  239

Query  658  QGAKL  672
             GAK+
Sbjct  240  HGAKI  244



>ref|XP_006493428.1| PREDICTED: probable metal-nicotianamine transporter YSL5-like 
[Citrus sinensis]
Length=703

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 154/185 (83%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER F+ KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF
Sbjct  43   VERAFDGKEVPSWRKQLTIRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  102

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTKFLE S  L+ PFTRQENTVIQTCVV SSGIAF GGFGSY+ GMS+ +A Q    
Sbjct  103  VKTWTKFLENSRILRQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLGMSDRIAIQSEDT  162

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N     KN  + W+IGFLFVVSFLGLFSVVPLRK+MIIDFKLTYPSGTATA+LI  FHT 
Sbjct  163  N--LGYKNLSLTWIIGFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAYLINSFHTT  220

Query  658  QGAKL  672
             GAKL
Sbjct  221  AGAKL  225



>ref|NP_001185810.1| yellow stripe-like transporter 11 [Zea mays]
 gb|ADO20998.1| yellow stripe-like transporter 11 [Zea mays]
Length=714

 Score =   207 bits (527),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 128/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +1

Query  109  SGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLG  288
            +  VE+ F  + VPSWR QLT RAF V F+L VLF+ IVMKLNLTTG+IPSLNVSA LLG
Sbjct  49   AASVEQAFADEPVPSWREQLTVRAFVVGFILAVLFSVIVMKLNLTTGVIPSLNVSASLLG  108

Query  289  FFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQM  468
            +F V+ WTK +E  G LKHPFTRQENTVIQTCVV + G+AF GGFGSY+FGMS ++A Q 
Sbjct  109  YFLVRLWTKAIESVGLLKHPFTRQENTVIQTCVVSAYGLAFSGGFGSYLFGMSRTIAIQA  168

Query  469  TIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXF  648
            T  N+ +NIK+P + WMIGF+F+VSF+GLF +VPLRKVMI+D+KLTYPSGTATA+LI  F
Sbjct  169  TEANDAQNIKDPQLGWMIGFMFLVSFVGLFVLVPLRKVMIVDYKLTYPSGTATAYLINGF  228

Query  649  HTPQGAK  669
            HTPQGA+
Sbjct  229  HTPQGAE  235



>gb|KEH34580.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=696

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
            N+D  E   +E+ FE K VP+W+ Q+T RA  VS +L V+FTFIVMKLNLTTGIIPSLNV
Sbjct  27   NDDQPEEFSIEKGFEGKLVPTWQKQVTVRALFVSLMLSVMFTFIVMKLNLTTGIIPSLNV  86

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            SAGLLGFFFVKTWTK LEK+G+L  PF+RQENTVIQTCVV SSGIAF GGFGSY+FGM+ 
Sbjct  87   SAGLLGFFFVKTWTKLLEKAGWLTQPFSRQENTVIQTCVVASSGIAFSGGFGSYLFGMTP  146

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
            ++AKQ+   +   ++K  G+ WMI FLFVVSFLGLFSV+PLRK+MI+DF LTYPSGTATA
Sbjct  147  TIAKQIPEFDGSNDVKILGLGWMIAFLFVVSFLGLFSVLPLRKIMIVDFGLTYPSGTATA  206

Query  631  HLIXXFHTPQGAKL  672
            HLI  FHT +GAKL
Sbjct  207  HLINSFHTSEGAKL  220



>dbj|BAE91891.1| hypothetical protein [Oryza sativa Japonica Group]
Length=712

 Score =   206 bits (525),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 127/185 (69%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE+ F  K VPSWR QLT RAF V F+L ++F  IVMKL+LTTG+IPSLNVSA LLGFF 
Sbjct  50   VEQAFADKPVPSWREQLTVRAFVVGFLLSIMFNIIVMKLSLTTGVIPSLNVSASLLGFFL  109

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +E+ GFLK P TRQENTVIQTCVV + G+AF GGFGSY+FGMSE++AKQ T  
Sbjct  110  VRLWTAAIERVGFLKQPLTRQENTVIQTCVVSAYGVAFSGGFGSYLFGMSETIAKQATEA  169

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+P NIKNP + W+IGF+F+VSF+GLF++VP+RKVMI+D+KLTYPSGTATA+LI  FHTP
Sbjct  170  NDPMNIKNPHLGWIIGFMFLVSFVGLFALVPMRKVMIVDYKLTYPSGTATAYLINGFHTP  229

Query  658  QGAKL  672
            +GA L
Sbjct  230  EGADL  234



>ref|XP_009384580.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   206 bits (523),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 132/185 (71%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER FE + VP WR QLT RA  VSF+L V+F+ IVMKLNLTTGIIPSLNV+AGLLGFFF
Sbjct  33   VERTFERQRVPPWREQLTARALAVSFLLSVMFSVIVMKLNLTTGIIPSLNVAAGLLGFFF  92

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK WTK LE +G L+ PFTRQENTVIQT VV + G+AF GGFGSY+FGMS  +A Q T  
Sbjct  93   VKVWTKALEHAGLLRTPFTRQENTVIQTSVVAAYGLAFSGGFGSYLFGMSSKIANQTTEA  152

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+ +NIK+P + WMIGF+FVVSFLGLFS+VPLR++MIID+KL YPSGTATA+LI  FHTP
Sbjct  153  NDSQNIKDPKLGWMIGFMFVVSFLGLFSLVPLREIMIIDYKLIYPSGTATAYLINGFHTP  212

Query  658  QGAKL  672
            QG KL
Sbjct  213  QGEKL  217



>ref|XP_002448760.1| hypothetical protein SORBIDRAFT_06g032720 [Sorghum bicolor]
 gb|EES13088.1| hypothetical protein SORBIDRAFT_06g032720 [Sorghum bicolor]
Length=688

 Score =   204 bits (520),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 134/186 (72%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+FE  EVP WR Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  19   VERVFEGWEVPGWREQVTVRALMVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  78

Query  298  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTI  474
            + +WTK L ++GF    PFTRQENTV+QTCVV  SGIAF GGFGSYMF MS+ +++Q   
Sbjct  79   LTSWTKLLAQAGFTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSDRISEQSGE  138

Query  475  XNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHT  654
              +P NIKNPG+ WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLI  FHT
Sbjct  139  TWDPHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHT  198

Query  655  PQGAKL  672
            PQGAKL
Sbjct  199  PQGAKL  204



>ref|XP_008805741.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Phoenix 
dactylifera]
Length=683

 Score =   203 bits (516),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 131/183 (72%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +E+ FESKEVPSW +QLTFRAF VS +LG  F+FIV+KL+LTTGIIPSLNVSAGLLGFFF
Sbjct  18   LEQHFESKEVPSWTDQLTFRAFAVSLMLGFFFSFIVIKLSLTTGIIPSLNVSAGLLGFFF  77

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK LEK+G LK PFTRQENTVIQT VV  SGIAF GGFGSY+ GMS++VA  +   
Sbjct  78   VKTWTKILEKAGLLKQPFTRQENTVIQTSVVALSGIAFSGGFGSYILGMSKNVANDLNEG  137

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
                  K P + WMIGFLF VSF+GLF++VPLRK+MI+ +KLTYPSGTATA+LI  FHTP
Sbjct  138  YTARYTKEPSLGWMIGFLFTVSFVGLFTIVPLRKIMILGYKLTYPSGTATAYLINSFHTP  197

Query  658  QGA  666
            QGA
Sbjct  198  QGA  200



>ref|XP_007146944.1| hypothetical protein PHAVU_006G083800g [Phaseolus vulgaris]
 gb|ESW18938.1| hypothetical protein PHAVU_006G083800g [Phaseolus vulgaris]
Length=680

 Score =   202 bits (515),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 133/181 (73%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +1

Query  130  FESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTW  309
            FE K VP W  Q+T RA  VS VL VLFTFIVMKLNLTTGIIPSLN+SAGLLGFFFVK W
Sbjct  26   FEGKVVPRWEKQITLRAMVVSLVLAVLFTFIVMKLNLTTGIIPSLNISAGLLGFFFVKIW  85

Query  310  TKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNPE  489
            T  L K G L  PFTRQENTVIQTCVV SSGIAF GGFGSY+F MS  +A Q    N P 
Sbjct  86   TSLLTKMGMLVQPFTRQENTVIQTCVVASSGIAFSGGFGSYIFAMSSEIANQSPEANGPL  145

Query  490  NIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGAK  669
            +IKNP + WMI F+ VVSFLGLFSVVPLRK+MI+DFKL YPSGTATAHLI  FHT +GAK
Sbjct  146  DIKNPTLGWMIAFVSVVSFLGLFSVVPLRKIMIVDFKLIYPSGTATAHLINSFHTTEGAK  205

Query  670  L  672
            L
Sbjct  206  L  206



>gb|KEH34582.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=690

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
             ++  E   VE+ FE   VP+W+ Q+T RA   S +L V+FTFIVMKLNLTTGIIPSLNV
Sbjct  21   KDEQLEEISVEKGFEGTSVPTWQKQVTVRAIFASLMLSVMFTFIVMKLNLTTGIIPSLNV  80

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            SAGLLGFFFVKTWTK LEK+G+L  PFTRQENTVIQTCVV +SGIAF GGFGSY+FGMS 
Sbjct  81   SAGLLGFFFVKTWTKLLEKAGWLNQPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSP  140

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
            ++AKQ+   ++  ++K+ G+ WMI FLFVVSFLGLFSV+PLRK+MI+DF LTYPSGTATA
Sbjct  141  TIAKQIPEFDSANDVKSLGLGWMIAFLFVVSFLGLFSVLPLRKIMIVDFGLTYPSGTATA  200

Query  631  HLIXXFHTPQGAKL  672
            HLI  FHT +GAKL
Sbjct  201  HLINSFHTSEGAKL  214



>ref|XP_008779403.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Phoenix 
dactylifera]
Length=680

 Score =   202 bits (515),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 131/185 (71%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +E++FE KEVP WR QLTFRA  V+  L ++F+FIVMKL LTTGI+PSLN++AGLLGFFF
Sbjct  13   IEKVFEGKEVPPWREQLTFRALAVAAFLAIMFSFIVMKLGLTTGIVPSLNIAAGLLGFFF  72

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WTK L+ +G L+ PFTRQENTVIQTCVV +SGIAF GGFGSY+FGMS  +A Q T  
Sbjct  73   VRLWTKALQMTGCLQKPFTRQENTVIQTCVVAASGIAFSGGFGSYLFGMSGRIAGQATED  132

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N+ +NIK+P + W+IGFLFVVSFLGLFS+VPLRK+MIID+KL YPSGTATA LI  FHTP
Sbjct  133  NDAQNIKDPRLGWIIGFLFVVSFLGLFSLVPLRKIMIIDYKLIYPSGTATAFLINGFHTP  192

Query  658  QGAKL  672
            QGAKL
Sbjct  193  QGAKL  197



>ref|XP_010940749.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Elaeis 
guineensis]
Length=690

 Score =   202 bits (514),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +E++FESKEVPSW +QLTFRAF VS +LG   +FIVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  17   MEQLFESKEVPSWSDQLTFRAFFVSSILGFFLSFIVMKLNLTTGIIPSLNVSAGLLGFFL  76

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VKTWTK L+++ FL  PFTRQENTVIQTCVV  +G+AF GGFGSY   MSE+VA      
Sbjct  77   VKTWTKILQRADFLMQPFTRQENTVIQTCVVACAGVAFSGGFGSYFLAMSETVANDFNEA  136

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N   + K P   WM+ FLF+VSF+GLFSVVPLRK+MI+ +KLTYPSG ATA+LI  FHTP
Sbjct  137  NTKVDTKEPSFGWMVAFLFIVSFIGLFSVVPLRKIMILRYKLTYPSGMATAYLINSFHTP  196

Query  658  QGAKL  672
            QGA L
Sbjct  197  QGALL  201



>sp|Q0J932.2|YSL10_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL10; 
AltName: Full=Protein YELLOW STRIPE LIKE 10; Short=OsYSL10 
[Oryza sativa Japonica Group]
 dbj|BAE91890.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAG91535.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61895.1| hypothetical protein OsJ_16603 [Oryza sativa Japonica Group]
Length=686

 Score =   200 bits (509),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 131/201 (65%), Positives = 156/201 (78%), Gaps = 1/201 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G + +  E+ +    VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGI
Sbjct  5    GRERRDQEEEAAVVSVERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGI  64

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfgs  429
            IPSLNVSAGLLGFF + +WTK L+K+G     PFTRQENTV+QTCVV  SGIAF GGFGS
Sbjct  65   IPSLNVSAGLLGFFLLTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSGGFGS  124

Query  430  ymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTY  609
            Y+F MS+ ++ Q     +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL Y
Sbjct  125  YIFAMSDRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIY  184

Query  610  PSGTATAHLIXXFHTPQGAKL  672
            PSGTATAHLI  FHTPQGAKL
Sbjct  185  PSGTATAHLINSFHTPQGAKL  205



>gb|AFW59877.1| hypothetical protein ZEAMMB73_955581 [Zea mays]
Length=695

 Score =   200 bits (509),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 132/184 (72%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = +1

Query  124  RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  303
            R+FE +EVP WR Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF + 
Sbjct  22   RVFEGREVPGWREQVTARALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLT  81

Query  304  TWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXN  480
            +WTK L K+G     PFTRQENTV+QTCVV  SGIAF GGFGSYMF MSE +++Q     
Sbjct  82   SWTKLLAKAGLTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSERISEQSGETW  141

Query  481  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQ  660
            +  NIKNPG+ WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLI  FHTPQ
Sbjct  142  DAHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHTPQ  201

Query  661  GAKL  672
            GAKL
Sbjct  202  GAKL  205



>ref|NP_001054241.1| Os04g0674600 [Oryza sativa Japonica Group]
 dbj|BAF16155.1| Os04g0674600, partial [Oryza sativa Japonica Group]
Length=708

 Score =   200 bits (509),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 131/201 (65%), Positives = 156/201 (78%), Gaps = 1/201 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G + +  E+ +    VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGI
Sbjct  27   GRERRDQEEEAAVVSVERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGI  86

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfgs  429
            IPSLNVSAGLLGFF + +WTK L+K+G     PFTRQENTV+QTCVV  SGIAF GGFGS
Sbjct  87   IPSLNVSAGLLGFFLLTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSGGFGS  146

Query  430  ymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTY  609
            Y+F MS+ ++ Q     +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL Y
Sbjct  147  YIFAMSDRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIY  206

Query  610  PSGTATAHLIXXFHTPQGAKL  672
            PSGTATAHLI  FHTPQGAKL
Sbjct  207  PSGTATAHLINSFHTPQGAKL  227



>ref|XP_004976284.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like 
[Setaria italica]
Length=712

 Score =   199 bits (507),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 129/189 (68%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = +1

Query  106  ESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLL  285
            E+  VE+ F  K VPSWR QLT RAF V  +L VLF+ IVMKLNLTTGIIPSLNVSA LL
Sbjct  46   ETVSVEQAFAGKPVPSWREQLTVRAFVVGALLSVLFSVIVMKLNLTTGIIPSLNVSASLL  105

Query  286  GFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQ  465
             +F V  WTK +E  G LK PFTRQENTVIQTCVV + GIAF GGFGSY+FGMS ++AKQ
Sbjct  106  SYFLVSLWTKAIESMGLLKQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSSTIAKQ  165

Query  466  MTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXX  645
             T  N+  NIK+P + WMIGF+F+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LI  
Sbjct  166  ATEANDALNIKDPHLGWMIGFMFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLING  225

Query  646  FHTPQGAKL  672
            FHTP+GA+L
Sbjct  226  FHTPEGAEL  234



>ref|XP_009392235.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Musa 
acuminata subsp. malaccensis]
Length=680

 Score =   199 bits (506),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 128/195 (66%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = +1

Query  88   KNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLN  267
            + E   +   VER+F+ +EVP W  QLT R+  VS +LG   +FIVMKLNLT GIIPSLN
Sbjct  8    EREHGDDEQSVERMFDCQEVPPWTQQLTLRSLAVSAILGFFLSFIVMKLNLTAGIIPSLN  67

Query  268  VSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgms  447
            VSAGLLGFF VKTWT  LEK+G L  PFTRQENTVIQTCVV  SGIAF GGFGSY+ GMS
Sbjct  68   VSAGLLGFFMVKTWTTLLEKTGLLNQPFTRQENTVIQTCVVACSGIAFSGGFGSYILGMS  127

Query  448  ESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTAT  627
            + VA Q    +   N+K P + W+I FL  VSF+GLFSVVPLR++MII +KLTYPSGTAT
Sbjct  128  KKVADQFGEADTGVNMKEPSLGWLICFLLAVSFVGLFSVVPLRRIMIIAYKLTYPSGTAT  187

Query  628  AHLIXXFHTPQGAKL  672
            AHLI  FHTPQGA L
Sbjct  188  AHLINSFHTPQGALL  202



>gb|EMT24509.1| Putative metal-nicotianamine transporter YSL12 [Aegilops tauschii]
Length=723

 Score =   199 bits (506),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 7/186 (4%)
 Frame = +1

Query  136  SKEVPSWRNQ-------LTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  294
            +K VP+WR         LT RAF VSF L ++F+ IVMKLNLTTGIIPSLNVSAGLLGFF
Sbjct  61   AKPVPTWREAADAPRLVLTLRAFVVSFFLAIMFSVIVMKLNLTTGIIPSLNVSAGLLGFF  120

Query  295  FVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTI  474
            FV+ WT  +E+ GFL+ PFTRQENTVIQTCVV +  IAF GGFG+Y+F MS +VA Q T 
Sbjct  121  FVRLWTSAIERMGFLRQPFTRQENTVIQTCVVAAYDIAFSGGFGNYLFAMSGTVASQATE  180

Query  475  XNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHT  654
             N+ +N+K+P + WMIGFLF+VSF+GLF++VPLRK+MI+D+KLTYPSGTATA+LI  FHT
Sbjct  181  ANDAQNVKDPHIGWMIGFLFLVSFVGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHT  240

Query  655  PQGAKL  672
            P+GAKL
Sbjct  241  PEGAKL  246



>emb|CBG76262.1| OO_Ba0005L10-OO_Ba0081K17.13 [Oryza officinalis]
Length=691

 Score =   197 bits (501),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 130/193 (67%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = +1

Query  97   DSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSA  276
            D +    VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSA
Sbjct  14   DEAAVESVERVFEGRVVPEWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSA  73

Query  277  GLLGFFFVKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfgsymfgmsES  453
            GLLGFF + +WTK L K+G     PFTRQENTV+QTCVV  SGIAF GGFGSY+F MS+ 
Sbjct  74   GLLGFFLLTSWTKLLHKAGVAGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDR  133

Query  454  VAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAH  633
            ++ Q     +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAH
Sbjct  134  ISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAH  193

Query  634  LIXXFHTPQGAKL  672
            LI  FHTPQGAKL
Sbjct  194  LINSFHTPQGAKL  206



>gb|EMT24510.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii]
Length=727

 Score =   197 bits (502),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 125/199 (63%), Positives = 147/199 (74%), Gaps = 14/199 (7%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER F  + VPSWR QLT RAF  SF L  +F+ IVMKLNLT GIIPSLNVSAGLL FFF
Sbjct  49   VERAFADQRVPSWREQLTVRAFVASFFLATMFSVIVMKLNLTVGIIPSLNVSAGLLSFFF  108

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+ WT  +EK G L+ PFTRQENTVIQTCVV + GI+F GGFG+Y+  MS+ +A Q    
Sbjct  109  VRLWTAAMEKVGLLRQPFTRQENTVIQTCVVAAYGISFSGGFGNYLLAMSDRIASQADEA  168

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRK--------------VMIIDFKLTYPS  615
            NNP+NIKNP + W+IGFL +VSF+GLF +VPLRK              +MIID+KLTYPS
Sbjct  169  NNPQNIKNPHLGWIIGFLLLVSFIGLFGLVPLRKQPCAYHFNQISTVQIMIIDYKLTYPS  228

Query  616  GTATAHLIXXFHTPQGAKL  672
            GTATA+LI  FHTP GAK+
Sbjct  229  GTATAYLINGFHTPHGAKI  247



>ref|XP_006653020.1| PREDICTED: probable metal-nicotianamine transporter YSL10-like 
[Oryza brachyantha]
Length=694

 Score =   197 bits (501),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 130/186 (70%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+FE + VP W+ Q+T RA  VS VLG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  20   VERVFEGRVVPEWKEQVTVRALAVSAVLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  79

Query  298  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTI  474
            + +WTK L K+G     PFTRQENTV+QTCVV  SGIAF GGFGSY+F MS+ ++ Q   
Sbjct  80   LTSWTKLLHKAGVAGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSGE  139

Query  475  XNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHT  654
              +  NIKNP ++WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLI  FHT
Sbjct  140  VRDEHNIKNPSLSWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHT  199

Query  655  PQGAKL  672
            PQGAKL
Sbjct  200  PQGAKL  205



>emb|CAN70906.1| hypothetical protein VITISV_043868 [Vitis vinifera]
Length=697

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  163  QLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLK  342
             LT RAF VSFVLGVL TFIVMKLNLTTGIIPSLNVSAGLLGFFFVK+W KF+EKSG LK
Sbjct  53   SLTIRAFVVSFVLGVLLTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKSWAKFMEKSGMLK  112

Query  343  HPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMI  522
             PFTRQENTVIQTCVV +SGIAF GGFGSY+FGMS  VA Q     + +N K+P + W+I
Sbjct  113  QPFTRQENTVIQTCVVATSGIAFSGGFGSYLFGMSSIVAGQSAKSIDAQNTKDPRLPWII  172

Query  523  gflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            GFLF VSFLGLFSV+PLRK+M+ID+KLTYPSGTATAHLI  FHTPQGAKL
Sbjct  173  GFLFAVSFLGLFSVLPLRKIMVIDYKLTYPSGTATAHLINSFHTPQGAKL  222



>ref|XP_011072202.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=691

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            D K+     E   VERI E  EVPSWR QLT RAF VSF+L V+F F+VMKL+LTTGIIP
Sbjct  17   DVKEERKEDEELSVERISEG-EVPSWRKQLTLRAFAVSFLLSVMFCFVVMKLSLTTGIIP  75

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            S NVSAGLLGFFF++TWTK + +SG L+ PFT QENTVIQTCV+ SSG+AF GGFGSY+F
Sbjct  76   SFNVSAGLLGFFFIQTWTKLIAQSGMLRQPFTCQENTVIQTCVIASSGVAFSGGFGSYLF  135

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMSE +A+Q     +  + KNP + WMI FLFVVSF+GLF+VVP+RK++I+DFKL Y  G
Sbjct  136  GMSERIAEQSEDRKDAFDYKNPALGWMISFLFVVSFIGLFAVVPMRKIIILDFKLKYARG  195

Query  619  TATAHLIXXFHTPQGAKL  672
            T TAHLI  FHTP+GAKL
Sbjct  196  TETAHLINSFHTPEGAKL  213



>ref|XP_004148573.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
 gb|KGN58517.1| hypothetical protein Csa_3G654470 [Cucumis sativus]
Length=684

 Score =   194 bits (494),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 131/208 (63%), Positives = 154/208 (74%), Gaps = 10/208 (5%)
 Frame = +1

Query  79   DSKKNEDSSESG----------CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVM  228
            +S K E+  ESG           VE  F++ EVPSWRNQ+TFRA   SF+L ++F FIV 
Sbjct  4    NSSKKENEGESGSGTDGGGERIVVEDAFKNLEVPSWRNQITFRALFTSFILSIVFNFIVC  63

Query  229  KLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgia  408
            KLNLTTG+IPSLNV+AGLLGF  +K +T  L++ G +K PFTRQENTVIQTCVV SSGIA
Sbjct  64   KLNLTTGVIPSLNVAAGLLGFAILKGYTSILDQLGLMKQPFTRQENTVIQTCVVASSGIA  123

Query  409  fxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMI  588
            F  G  SY+ GMS  +A Q    N P NIK   V WMIGFLFVVSF+GLFS+VPLRK+MI
Sbjct  124  FSSGTASYLLGMSAKIAAQAEEGNMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMI  183

Query  589  IDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            I +KLTYPSGTATA+LI  FHTP+GAKL
Sbjct  184  IKYKLTYPSGTATAYLINSFHTPKGAKL  211



>ref|XP_004163304.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=691

 Score =   194 bits (494),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 131/208 (63%), Positives = 154/208 (74%), Gaps = 10/208 (5%)
 Frame = +1

Query  79   DSKKNEDSSESG----------CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVM  228
            +S K E+  ESG           VE  F++ EVPSWRNQ+TFRA   SF+L ++F FIV 
Sbjct  4    NSSKKENEGESGSGTDGGGERIVVEDAFKNLEVPSWRNQITFRALFTSFILSIVFNFIVC  63

Query  229  KLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgia  408
            KLNLTTG+IPSLNV+AGLLGF  +K +T  L++ G +K PFTRQENTVIQTCVV SSGIA
Sbjct  64   KLNLTTGVIPSLNVAAGLLGFAILKGYTSILDQLGLMKQPFTRQENTVIQTCVVASSGIA  123

Query  409  fxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMI  588
            F  G  SY+ GMS  +A Q    N P NIK   V WMIGFLFVVSF+GLFS+VPLRK+MI
Sbjct  124  FSSGTASYLLGMSAKIAAQAEEGNMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMI  183

Query  589  IDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            I +KLTYPSGTATA+LI  FHTP+GAKL
Sbjct  184  IKYKLTYPSGTATAYLINSFHTPKGAKL  211



>emb|CAE03239.2| OSJNBa0018M05.14 [Oryza sativa Japonica Group]
Length=695

 Score =   193 bits (491),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 127/210 (60%), Positives = 152/210 (72%), Gaps = 10/210 (5%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G + +  E+ +    VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGI
Sbjct  5    GRERRDQEEEAAVVSVERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGI  64

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfg-  426
            IPSLNVSAGLLGFF + +WTK L+K+G     PFTRQENTV+QTCVV  SGIAF      
Sbjct  65   IPSLNVSAGLLGFFLLTSWTKLLDKAGVASVRPFTRQENTVVQTCVVACSGIAFSDADLC  124

Query  427  --------symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKV  582
                    SY+F MS+ ++ Q     +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+
Sbjct  125  TGGTGGFGSYIFAMSDRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKI  184

Query  583  MIIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            MIID+KL YPSGTATAHLI  FHTPQGAKL
Sbjct  185  MIIDYKLIYPSGTATAHLINSFHTPQGAKL  214



>ref|XP_008461864.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Cucumis 
melo]
Length=684

 Score =   192 bits (488),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 126/185 (68%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F++ EVPSWRNQ+TFRA   SFVL ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  27   VEDAFKNLEVPSWRNQITFRALFTSFVLSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  86

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +K +T  LE+ G +K PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS  +A Q    
Sbjct  87   LKGYTSILEQLGLMKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQAEEG  146

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N P NIK   V WMIGFLFVVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LI  FHTP
Sbjct  147  NMPINIKKLSVGWMIGFLFVVSFVGLFSIVPLRKMMILKYKLTYPSGTATAYLINSFHTP  206

Query  658  QGAKL  672
            +GAKL
Sbjct  207  KGAKL  211



>emb|CAJ86097.1| H0103C06.1 [Oryza sativa Indica Group]
 emb|CAH68189.1| H0403D02.17 [Oryza sativa Indica Group]
Length=700

 Score =   192 bits (487),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 126/195 (65%), Positives = 146/195 (75%), Gaps = 10/195 (5%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VER+FE + VP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  21   VERVFEGRVVPGWKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  80

Query  298  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfg---------symfgms  447
            + +WTKFL+K G     PFTRQENTV+QTCVV  SGIAF              SY+F MS
Sbjct  81   LTSWTKFLDKVGVASVRPFTRQENTVVQTCVVACSGIAFSDADLCTGGTGGFGSYIFAMS  140

Query  448  ESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTAT  627
            + ++ Q     +  NIKNP + WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTAT
Sbjct  141  DRISDQSGEARDEHNIKNPSLGWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTAT  200

Query  628  AHLIXXFHTPQGAKL  672
            AHLI  FHTPQGAKL
Sbjct  201  AHLINSFHTPQGAKL  215



>ref|XP_008441627.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL5 [Cucumis melo]
Length=590

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 151/185 (82%), Gaps = 2/185 (1%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VERIFE++EVPSW+NQLT RAF +SF L VLFTFIVMKLNLTTGIIPSLNVSAG LGFFF
Sbjct  39   VERIFEAQEVPSWQNQLTVRAFAMSFGLSVLFTFIVMKLNLTTGIIPSLNVSAGFLGFFF  98

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            V+TWTK L+KSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+  MS+ + K     
Sbjct  99   VETWTKLLKKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLLAMSQRINKLSEAK  158

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
             N  + KN  + W+IGFLF+VSFLG   V+ L K+MIIDFKLTYPSGTATAHLI  FHT 
Sbjct  159  GN--DFKNLSLGWIIGFLFIVSFLGPLLVLHLPKIMIIDFKLTYPSGTATAHLINSFHTS  216

Query  658  QGAKL  672
            +GAKL
Sbjct  217  RGAKL  221



>gb|KDO52778.1| hypothetical protein CISIN_1g044922mg [Citrus sinensis]
Length=684

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 123/198 (62%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            + + ++   E   +E  F+  EVPSWR Q+TFRA   S +L ++F FIV KLNLTTG+IP
Sbjct  14   EEEGDDHDGEKLVMEDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIP  73

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNV+AGLLGF  VK WT  LEK G LK PFTRQENTVIQTCVV SSGIAF  G  SY+ 
Sbjct  74   SLNVAAGLLGFAIVKAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLL  133

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMS  VA      N P N+K   + WM GFLF VSF+GLFS+VPLRK+MI+ +KLTYPSG
Sbjct  134  GMSTRVAALADSGNTPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSG  193

Query  619  TATAHLIXXFHTPQGAKL  672
            TATA+LI  FHTP+GAKL
Sbjct  194  TATAYLINSFHTPKGAKL  211



>ref|XP_006484586.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Citrus sinensis]
Length=684

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 123/198 (62%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            + + ++   E   +E  F+  EVPSWR Q+TFRA   S +L ++F FIV KLNLTTG+IP
Sbjct  14   EEEGDDHDGEKLVMEDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIP  73

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNV+AGLLGF  VK WT  LEK G LK PFTRQENTVIQTCVV SSGIAF  G  SY+ 
Sbjct  74   SLNVAAGLLGFAIVKAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLL  133

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMS  VA      N P N+K   + WM GFLF VSF+GLFS+VPLRK+MI+ +KLTYPSG
Sbjct  134  GMSTRVAALADSGNTPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSG  193

Query  619  TATAHLIXXFHTPQGAKL  672
            TATA+LI  FHTP+GAKL
Sbjct  194  TATAYLINSFHTPKGAKL  211



>ref|XP_006437555.1| hypothetical protein CICLE_v10030879mg [Citrus clementina]
 gb|ESR50795.1| hypothetical protein CICLE_v10030879mg [Citrus clementina]
Length=684

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 123/198 (62%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            + + ++   E   +E  F+  EVPSWR Q+TFRA   S +L ++F FIV KLNLTTG+IP
Sbjct  14   EEEGDDHDGEKLVMEDAFKDVEVPSWRKQITFRAMVTSLLLSIVFNFIVCKLNLTTGVIP  73

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNV+AGLLGF  VK WT  LEK G LK PFTRQENTVIQTCVV SSGIAF  G  SY+ 
Sbjct  74   SLNVAAGLLGFAIVKAWTSLLEKFGVLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLL  133

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GMS  VA      N P N+K   + WM GFLF VSF+GLFS+VPLRK+MI+ +KLTYPSG
Sbjct  134  GMSTRVAALADSGNTPANVKQLSLGWMFGFLFAVSFVGLFSIVPLRKMMILKYKLTYPSG  193

Query  619  TATAHLIXXFHTPQGAKL  672
            TATA+LI  FHTP+GAKL
Sbjct  194  TATAYLINSFHTPKGAKL  211



>ref|XP_002446812.1| hypothetical protein SORBIDRAFT_06g023040 [Sorghum bicolor]
 gb|EES11140.1| hypothetical protein SORBIDRAFT_06g023040 [Sorghum bicolor]
Length=753

 Score =   190 bits (483),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 127/208 (61%), Positives = 159/208 (76%), Gaps = 12/208 (6%)
 Frame = +1

Query  73   GIDSKKNEDSSES---GC------VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIV  225
            G D++++ ++  S    C      +ER+FES+ VP WR Q+T RA   S  L VLF+ IV
Sbjct  37   GTDAEEDNEAGRSPPGACCEVTDSIERVFESEPVPPWREQVTVRALVTSLFLAVLFSVIV  96

Query  226  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgi  405
            MKL+LTTGIIPSLNVSAGLLGFF ++ WT  ++     K PFTRQENTV+QTCVV + GI
Sbjct  97   MKLSLTTGIIPSLNVSAGLLGFFLLRVWTAAVKDP---KRPFTRQENTVVQTCVVAAYGI  153

Query  406  afxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  585
            AF GGFGSY+FGMSE++A Q    NN +N+K P +AWMIGFLF+VSF+GLF++VPLRKVM
Sbjct  154  AFSGGFGSYLFGMSETIASQAAEENNADNVKEPRLAWMIGFLFLVSFVGLFALVPLRKVM  213

Query  586  IIDFKLTYPSGTATAHLIXXFHTPQGAK  669
            IID++LTYPSGTATAHLI  FHTP G++
Sbjct  214  IIDYRLTYPSGTATAHLINGFHTPDGSE  241



>ref|XP_009592956.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=384

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = +1

Query  70   LGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTG  249
            +G++S  NE +      E  F  KEVP W+ Q+T R+     +L ++F FIV KLNLTTG
Sbjct  1    MGVESGDNEST------EYAFRDKEVPPWKKQITLRSMVTGLILSIVFNFIVCKLNLTTG  54

Query  250  IIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgs  429
            +IPSLNV+AGLLGF  +++WT  +EK G LK PFTRQENTVIQTCVV SSGIAF  G  S
Sbjct  55   VIPSLNVAAGLLGFAMIRSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTAS  114

Query  430  ymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTY  609
            YM GMS  +A Q    N P N K   ++WM+ FL VVSF GLFS+V LRK+MI+ +KLTY
Sbjct  115  YMLGMSPFIAAQADAGNTPNNTKKLDISWMLPFLLVVSFAGLFSIVALRKLMIMKYKLTY  174

Query  610  PSGTATAHLIXXFHTPQGAKL  672
            PSGTATA+LI  FHTP+GAKL
Sbjct  175  PSGTATAYLINCFHTPKGAKL  195



>ref|XP_011022272.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
 ref|XP_011015703.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
Length=699

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTT  246
            D G D   + D  E   VE  F+  EVP W  Q+T RA   S VL ++F FIV KLNLTT
Sbjct  19   DGGEDQVSSADEKEEVMVEEGFKDTEVPPWAKQITLRAMLTSLVLSIVFNFIVCKLNLTT  78

Query  247  GIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfg  426
            G+IPSLNV+AGLLGF  +K WT  L K+GFLK PFTRQENTV+QTCVV SSGIAF  G  
Sbjct  79   GVIPSLNVAAGLLGFAILKFWTSLLGKAGFLKQPFTRQENTVVQTCVVASSGIAFSSGTA  138

Query  427  symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            SY+ GM+  +A Q    N P N+K   + WMIGFLF VSF+GLFS+VPLRK+MI+ +KLT
Sbjct  139  SYLLGMTPRIANQSEGGNTPANMKELHLGWMIGFLFAVSFVGLFSIVPLRKLMILKYKLT  198

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YPSGTATA+LI  FHTP+GAKL
Sbjct  199  YPSGTATAYLINSFHTPKGAKL  220



>gb|KHG05118.1| putative metal-nicotianamine transporter YSL7 -like protein [Gossypium 
arboreum]
 gb|KHG05773.1| putative metal-nicotianamine transporter YSL7 -like protein [Gossypium 
arboreum]
Length=700

 Score =   188 bits (478),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 145/194 (75%), Gaps = 0/194 (0%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
            ++ S++   VE  F+   VP W  Q+T RA   S VL ++F FIV KLNLTTG+IPSLNV
Sbjct  25   DQQSTDKVLVEAAFKGTPVPPWNKQITVRAVVTSLVLSLVFNFIVCKLNLTTGVIPSLNV  84

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            +AGLLGF  VKTWT  LEK G LK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS 
Sbjct  85   AAGLLGFAVVKTWTTVLEKLGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSP  144

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
             VA Q    N PEN+K   + WMIGFLF+VSF+GLFS+V LRK+MI+ +KLTYPSGTATA
Sbjct  145  LVAGQGDSGNTPENVKRLSLGWMIGFLFIVSFVGLFSIVTLRKIMILKYKLTYPSGTATA  204

Query  631  HLIXXFHTPQGAKL  672
            +LI  FHTP+GAKL
Sbjct  205  YLINSFHTPKGAKL  218



>ref|XP_007043321.1| YELLOW STRIPE like 7 [Theobroma cacao]
 gb|EOX99152.1| YELLOW STRIPE like 7 [Theobroma cacao]
Length=694

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 143/185 (77%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F + +VPSW NQ+T RA   S +L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  29   VEDAFRNTQVPSWTNQITLRAVVTSLLLSLVFNFIVCKLNLTTGVIPSLNVAAGLLGFAI  88

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK WT  L K GFLK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS  VA Q    
Sbjct  89   VKAWTTTLAKVGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPLVAGQGDSG  148

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N PEN+K   + WM+GFLFVVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LI  FHTP
Sbjct  149  NTPENVKKLSIGWMMGFLFVVSFVGLFSIVPLRKIMILKYKLTYPSGTATAYLINSFHTP  208

Query  658  QGAKL  672
            +GAKL
Sbjct  209  KGAKL  213



>ref|XP_006484556.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Citrus sinensis]
Length=669

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F++  VP W  Q+TFRA   S VL V+F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  2    VEEAFKNVPVPPWTKQITFRAMATSAVLSVIFNFIVCKLNLTTGVIPSLNVAAGLLGFAL  61

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK+WT  LEK G LK PFTRQENTVIQTC+V SSGIAF  G  SYM GMS  +A Q    
Sbjct  62   VKSWTTLLEKFGLLKQPFTRQENTVIQTCIVASSGIAFSSGTASYMLGMSPKIASQADGG  121

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N P NIK+  + WM+ FLF VSFLGLFS+VPLRKVMI+ +KLTYPSGTATA+LI  FHTP
Sbjct  122  NTPANIKSLSIGWMMAFLFAVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHTP  181

Query  658  QGAKL  672
            +GA+L
Sbjct  182  KGAQL  186



>gb|KJB79884.1| hypothetical protein B456_013G070800 [Gossypium raimondii]
Length=700

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 145/194 (75%), Gaps = 0/194 (0%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
            ++ S++   VE  F+   VP W  Q+T RA   S VL ++F FIV KLNLTTG+IPSLNV
Sbjct  25   DQQSTDKVLVEAAFKGTPVPPWNKQITVRAVVTSLVLSLVFNFIVCKLNLTTGVIPSLNV  84

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            +AGLLGF  VKTWT  LEK G LK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS 
Sbjct  85   AAGLLGFAVVKTWTTVLEKLGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSP  144

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
             V+ Q    N PEN+K   + WMIGFLFVVSF+GLFS+V LRK+MI+ +KLTYPSGTATA
Sbjct  145  LVSGQGDSGNTPENVKRLSLGWMIGFLFVVSFVGLFSIVTLRKIMILKYKLTYPSGTATA  204

Query  631  HLIXXFHTPQGAKL  672
            +LI  FHTP+GAKL
Sbjct  205  YLINSFHTPKGAKL  218



>ref|XP_008663726.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL10 [Zea mays]
Length=722

 Score =   187 bits (474),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 133/211 (63%), Positives = 150/211 (71%), Gaps = 28/211 (13%)
 Frame = +1

Query  124  RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  303
            R+FE +EVP WR Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF + 
Sbjct  22   RVFEGREVPGWREQVTARALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLT  81

Query  304  TWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXN  480
            +WTK L K+G     PFTRQENTV+QTCVV  SGIAF GGFGSYMF MSE +++Q     
Sbjct  82   SWTKLLAKAGLTGVRPFTRQENTVVQTCVVACSGIAFSGGFGSYMFAMSERISEQSGETW  141

Query  481  NPENIKNPGVAWMIgflfvvsflglfsvvplRKV--------------------------  582
            +  NIKNPG+ WMIGFLF+VSFLGLFSVVPLRKV                          
Sbjct  142  DAHNIKNPGLGWMIGFLFIVSFLGLFSVVPLRKVRTHAHPNSVSDVYSSHHDMMPAGCVQ  201

Query  583  -MIIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
             MIID+KL YPSGTATAHLI  FHTPQGAKL
Sbjct  202  IMIIDYKLIYPSGTATAHLINSFHTPQGAKL  232



>ref|XP_006437556.1| hypothetical protein CICLE_v10030844mg [Citrus clementina]
 gb|ESR50796.1| hypothetical protein CICLE_v10030844mg [Citrus clementina]
Length=704

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F++  VP W  Q+TFRA   S VL V+F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  37   VEEAFKNVPVPPWTKQITFRAMATSAVLSVIFNFIVCKLNLTTGVIPSLNVAAGLLGFAL  96

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK+WT  LEK G LK PFTRQENTVIQTC+V SSGIAF  G  SYM GMS  +A Q    
Sbjct  97   VKSWTTLLEKFGLLKQPFTRQENTVIQTCIVASSGIAFSSGTASYMLGMSPKIASQADGG  156

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N P NIK+  + WM+ FLF VSFLGLFS+VPLRKVMI+ +KLTYPSGTATA+LI  FHTP
Sbjct  157  NTPANIKSLSIGWMMAFLFAVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHTP  216

Query  658  QGAKL  672
            +GA+L
Sbjct  217  KGAQL  221



>emb|CDP01725.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  226  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgi  405
            MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSG LK PFTRQENTVIQTCVV +SGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGLLKQPFTRQENTVIQTCVVATSGI  60

Query  406  afxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  585
            AF GGFGSY+FGMSE VAKQ    N  +NIK P + WM GFLF+VSFLGLFSVVPLRK+M
Sbjct  61   AFSGGFGSYIFGMSEVVAKQSGEDNFAQNIKIPSLGWMFGFLFLVSFLGLFSVVPLRKIM  120

Query  586  IIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            IIDFKLTYPSGTATA+LI  FHTPQGAKL
Sbjct  121  IIDFKLTYPSGTATAYLINSFHTPQGAKL  149



>ref|XP_002532101.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF30280.1| oligopeptide transporter, putative [Ricinus communis]
Length=694

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  79   DSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIP  258
            D  + E  ++   VE  F+   VP W  Q+TFRA   SF L ++F FIV KLNLTTG+IP
Sbjct  17   DDGEGEGGNKVVMVEEAFKDTVVPPWTKQITFRAIATSFFLSIVFNFIVCKLNLTTGVIP  76

Query  259  SLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymf  438
            SLNV+AGLLGF  +K WT  L K+GFLK PFTRQENTVIQTCVV SSGIAF  G  SY+ 
Sbjct  77   SLNVAAGLLGFGILKFWTTLLGKTGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLL  136

Query  439  gmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSG  618
            GM   +A Q    N P N+K+  + WM+ FLF+VSF+GLFS+VPLRK+MI+ +KLTYPSG
Sbjct  137  GMIPRIAAQSDGGNTPANVKHLSLGWMMAFLFIVSFVGLFSIVPLRKLMILKYKLTYPSG  196

Query  619  TATAHLIXXFHTPQGAKL  672
            TATA+LI  FHTP+GAKL
Sbjct  197  TATAYLINSFHTPKGAKL  214



>ref|XP_008340452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Malus 
domestica]
Length=705

 Score =   186 bits (472),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 119/185 (64%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F++  VP W  Q+T R+   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  32   VEEAFKATAVPPWTKQITVRSMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  91

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK +T  ++K GFLK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS  +A Q  + 
Sbjct  92   VKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQGDLG  151

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N P NIK   V WMIGFLF VSF+GLFS++PLRK+MI+ +KLTYPSGTATA+LI  FHTP
Sbjct  152  NTPINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKMMILKYKLTYPSGTATAYLINSFHTP  211

Query  658  QGAKL  672
            +GAKL
Sbjct  212  KGAKL  216



>gb|EYU39420.1| hypothetical protein MIMGU_mgv1a002450mg [Erythranthe guttata]
Length=673

 Score =   186 bits (471),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 118/196 (60%), Positives = 145/196 (74%), Gaps = 0/196 (0%)
 Frame = +1

Query  85   KKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSL  264
            +K+ED  +   +E+ FE   VPSW+NQ+T RA   S +L  +F  IV KLNL+TG+IPSL
Sbjct  5    EKHEDDEDVASLEKAFEETAVPSWQNQITIRAMVTSVLLSAVFNVIVCKLNLSTGVIPSL  64

Query  265  NVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgm  444
            NV+AGLLGF  VK +T  ++K G+LK PFTRQENTVIQTCVV SSGIAF  G  SY+ GM
Sbjct  65   NVAAGLLGFAMVKGYTVLIQKCGYLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGM  124

Query  445  sESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTA  624
            S   A Q    N P N+K   + WM+ FLF VSF+GLFS+VPLRKVMI+ +KLTYPSGTA
Sbjct  125  SPITAAQAETGNTPINVKQLSIGWMMTFLFTVSFVGLFSIVPLRKVMILRYKLTYPSGTA  184

Query  625  TAHLIXXFHTPQGAKL  672
            TA+LI  FHTP+GA+L
Sbjct  185  TAYLINSFHTPKGARL  200



>emb|CAN76934.1| hypothetical protein VITISV_024664 [Vitis vinifera]
Length=218

 Score =   176 bits (445),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  115  CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  294
             VERIFESKEVPSWR QLT RAF VS V+GVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF
Sbjct  45   SVERIFESKEVPSWREQLTVRAFVVSLVVGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  104

Query  295  FVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTI  474
            F   WTKFL+ SG LK PFTRQENTVIQTCVV  SGIAF GGFGSY+FGMSE VAK+   
Sbjct  105  FTSGWTKFLDNSGLLKQPFTRQENTVIQTCVVAISGIAFSGGFGSYLFGMSEVVAKESED  164

Query  475  XNNPENIKNPGVAWMI  522
              + ++ KNP + WMI
Sbjct  165  VQSSQDYKNPAIGWMI  180



>ref|XP_010245475.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nelumbo 
nucifera]
Length=680

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 125/194 (64%), Positives = 149/194 (77%), Gaps = 0/194 (0%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
            N  SS +   E+ FE++ VPSW++Q+TFRA   S VL V F FIVMKLNLTTGIIPSLNV
Sbjct  12   NVSSSSNQASEKAFENEIVPSWKDQVTFRAILASAVLSVAFCFIVMKLNLTTGIIPSLNV  71

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            +AGLLGFFF++ +T  LE+ G LK PFTRQENTVIQT VV +SGIAF GG+GSY+ GM  
Sbjct  72   AAGLLGFFFIRVYTWVLERFGLLKQPFTRQENTVIQTAVVAASGIAFSGGYGSYILGMMP  131

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
             VA Q        N+K+  + W+ GFLF VSF+GLFS+VPLRK+MIID+KLTYPSGTATA
Sbjct  132  KVAAQAQDGATTNNVKHLSLGWLYGFLFAVSFVGLFSIVPLRKIMIIDYKLTYPSGTATA  191

Query  631  HLIXXFHTPQGAKL  672
             LI  FHTP+GAKL
Sbjct  192  FLINSFHTPKGAKL  205



>gb|EMS55053.1| putative metal-nicotianamine transporter YSL10 [Triticum urartu]
Length=706

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 130/205 (63%), Positives = 154/205 (75%), Gaps = 20/205 (10%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +ER+FE +EVP W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF 
Sbjct  18   IERVFEGQEVPDWKEQVTARALAVSALLGFMFSVIVMKLNLTTGIIPSLNVSAGLLGFFL  77

Query  298  VKTWTKFLEKSGFLK-HPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTI  474
            + +WT+ L+K+G     PFTRQENTV+QTCVV  SGIAF GGFGSYMFGMSE +++Q   
Sbjct  78   LHSWTRLLDKAGIPGVKPFTRQENTVVQTCVVACSGIAFSGGFGSYMFGMSERISEQSGE  137

Query  475  XNNPENIKNPGVAWMIgflfvvsflglfsvvplRK-------------------VMIIDF  597
              + ++IKNP + WMIGFLF+VSFLGLFSVVPLRK                   +MIID+
Sbjct  138  VRDEDSIKNPSLGWMIGFLFIVSFLGLFSVVPLRKACTSHHSTDLYSQHFDFTNIMIIDY  197

Query  598  KLTYPSGTATAHLIXXFHTPQGAKL  672
            KL YPSGTATAHLI  FHTPQGAKL
Sbjct  198  KLIYPSGTATAHLINSFHTPQGAKL  222



>ref|XP_002306389.2| hypothetical protein POPTR_0005s09670g [Populus trichocarpa]
 gb|EEE93385.2| hypothetical protein POPTR_0005s09670g [Populus trichocarpa]
Length=698

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 144/200 (72%), Gaps = 0/200 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G D   + D  E   VE  F+  EVP W  Q+T RA   S VL ++F FIV KLNLTTG+
Sbjct  20   GEDQVSSADEKEEVMVEEGFKDTEVPPWAKQITLRAMLTSLVLSIVFNFIVCKLNLTTGV  79

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNV+AGLLGF  +K WT  L K+G LK PFTRQENTV+QTCVV SSGIAF  G  SY
Sbjct  80   IPSLNVAAGLLGFAILKFWTSLLGKAGILKQPFTRQENTVVQTCVVASSGIAFSSGTASY  139

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            + GM+  +A Q    N P N+K   + WMIGFLF VSF+GLFS+VPLRK+MI+ +KLTYP
Sbjct  140  LLGMTPRIANQSEGGNTPANMKELHLGWMIGFLFAVSFVGLFSIVPLRKLMILKYKLTYP  199

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATA+LI  FHTP+GAKL
Sbjct  200  SGTATAYLINSFHTPKGAKL  219



>ref|XP_009402082.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=719

 Score =   184 bits (467),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 114/174 (66%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  148  PSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEK  327
            P WR QLT RA  VSF L V+F+ IVMKLNLTTGIIPSLN +AGLLGFF VK WTK LE 
Sbjct  77   PPWREQLTVRAMVVSFALSVMFSVIVMKLNLTTGIIPSLNAAAGLLGFFLVKLWTKALEH  136

Query  328  SGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNPENIKNPG  507
             G L+ PFTRQEN VIQTCV+ + G+ F GGFG+Y+FGMS  +A Q    N+ +NIK+P 
Sbjct  137  VGLLRTPFTRQENAVIQTCVIAAYGLVFSGGFGNYLFGMSSKIASQAAEANDSDNIKDPS  196

Query  508  VAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGAK  669
            + WMIG++F++ FLGLFS+VPLRK++IID+KL YPSGTA A+LI  FHTPQG K
Sbjct  197  LGWMIGYMFIIGFLGLFSLVPLRKILIIDYKLIYPSGTAAAYLINGFHTPQGEK  250



>gb|EYU27872.1| hypothetical protein MIMGU_mgv1a019282mg [Erythranthe guttata]
Length=681

 Score =   184 bits (467),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 117/180 (65%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +E+ FE   VPSWRNQ+T R+  VS +L  +F  IV KLNL+TG+IPSLNV+AGLLGF  
Sbjct  25   LEKEFEEMAVPSWRNQITIRSVVVSVILSAVFNVIVCKLNLSTGVIPSLNVAAGLLGFAM  84

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK WT  +EK+G+LK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS   A Q    
Sbjct  85   VKGWTVLMEKAGYLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSPITAAQADTG  144

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NNP NIK   + WM+ +LF VSFLGLFS+VPLRKVMI+ +KLTYPSGTATA+LI  FHTP
Sbjct  145  NNPMNIKQLSIGWMMAYLFTVSFLGLFSIVPLRKVMILKYKLTYPSGTATAYLINSFHTP  204



>ref|XP_010253872.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nelumbo 
nucifera]
Length=710

 Score =   184 bits (467),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 121/196 (62%), Positives = 148/196 (76%), Gaps = 0/196 (0%)
 Frame = +1

Query  85   KKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSL  264
            + +  SS+    E+ FE++ VPSW+ QLTFRAF  S VL V F FIVMKL+LTTGIIPSL
Sbjct  28   ENDNSSSKEASTEKAFENEIVPSWKEQLTFRAFLASAVLSVAFCFIVMKLSLTTGIIPSL  87

Query  265  NVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgm  444
            NV+AGLLGFFF++ ++  L+K G LK PF+RQENTVIQT VV +SGIAF  G+GSY+ GM
Sbjct  88   NVAAGLLGFFFIRVYSFALQKFGLLKQPFSRQENTVIQTAVVAASGIAFSSGYGSYILGM  147

Query  445  sESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTA  624
               +A Q    N   N+K   + WM GF+F VSF+GLFS+VPLRK+MIID+KLTYPSGTA
Sbjct  148  MPKIASQAEDGNTVNNMKPLSLGWMYGFVFAVSFVGLFSIVPLRKIMIIDYKLTYPSGTA  207

Query  625  TAHLIXXFHTPQGAKL  672
            TA LI  FHT +GAKL
Sbjct  208  TAFLINSFHTSKGAKL  223



>ref|XP_009758111.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=659

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = +1

Query  76   IDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGII  255
            +++  NE  S     E  F+ KEVP W+ Q+T RA     +L V+F FIV KLNLTTG+I
Sbjct  2    VEAADNELLST----EYAFKDKEVPPWKKQITLRAMVTGLILSVVFNFIVCKLNLTTGVI  57

Query  256  PSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsym  435
            PSLNV+AGLLGF  +++WT  +EK G LK PFTRQENTVIQTCVV SSGIAF  G  SYM
Sbjct  58   PSLNVAAGLLGFAMIRSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYM  117

Query  436  fgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPS  615
             GMS  +A Q    N P N K   ++WM+ +L VVSF GLFS+V LRK+MI+ +KLTYPS
Sbjct  118  LGMSPLIAAQADAGNTPNNTKKLAISWMLSYLLVVSFAGLFSIVALRKMMIMKYKLTYPS  177

Query  616  GTATAHLIXXFHTPQGAKL  672
            GTATA+LI  FHTP+GAKL
Sbjct  178  GTATAYLINCFHTPKGAKL  196



>gb|EEC78242.1| hypothetical protein OsI_17899 [Oryza sativa Indica Group]
Length=691

 Score =   183 bits (465),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 123/174 (71%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = +1

Query  154  WRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSG  333
            W+ Q+T RA  VS +LG +F+ IVMKLNLTTGIIPSLNVSAGLLGFF + +WTKFL+K G
Sbjct  33   WKEQVTLRALAVSALLGAMFSVIVMKLNLTTGIIPSLNVSAGLLGFFLLTSWTKFLDKVG  92

Query  334  FLK-HPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNPENIKNPGV  510
                 PFTRQENTV+QTCVV  SGIAF GGFGSY+F MS+ ++ Q     +  NIKNP +
Sbjct  93   VASVRPFTRQENTVVQTCVVACSGIAFSGGFGSYIFAMSDRISDQSGEARDEHNIKNPSL  152

Query  511  AWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
             WMIGFLF+VSFLGLFSVVPLRK+MIID+KL YPSGTATAHLI  FHTPQGAKL
Sbjct  153  GWMIGFLFIVSFLGLFSVVPLRKIMIIDYKLIYPSGTATAHLINSFHTPQGAKL  206



>ref|XP_008221041.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Prunus 
mume]
Length=700

 Score =   183 bits (465),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 119/185 (64%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F++  VP W  Q+T RA   SF+L ++F FIV KLNLTTG+IPSLNV+AGL+GF  
Sbjct  28   VEEAFKTTPVPPWTKQITVRAMVTSFLLSIVFNFIVCKLNLTTGVIPSLNVAAGLMGFAV  87

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK +T  +EK G LK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS  +A Q    
Sbjct  88   VKGYTAMIEKCGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYILGMSPKIAAQGDEG  147

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N P NIK+  V WMIGFLF VSF+GLFS++ LRK+MII +KLTYPSGTATA+LI  FHTP
Sbjct  148  NTPINIKHLDVGWMIGFLFAVSFVGLFSIMALRKMMIIKYKLTYPSGTATAYLINSFHTP  207

Query  658  QGAKL  672
            +GAKL
Sbjct  208  KGAKL  212



>ref|XP_011463452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Fragaria 
vesca subsp. vesca]
Length=702

 Score =   183 bits (464),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 121/185 (65%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F ++ VP W  Q+T RA   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  24   VEAAFRNQAVPPWTKQITVRAMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  83

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            +K +T  L K G LK PFTRQEN VIQTCVV SSGIAF  G  SY+ GMS  +A Q    
Sbjct  84   LKFYTAILTKIGLLKQPFTRQENCVIQTCVVASSGIAFSSGTASYVLGMSGVIAAQGDGA  143

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N P NIKNP V WM+GFLF VSFLGLFS++PLRKVMI+ +KLTYPSGTATA+LI  FHTP
Sbjct  144  NTPLNIKNPHVGWMMGFLFAVSFLGLFSIMPLRKVMIMKYKLTYPSGTATAYLINSFHTP  203

Query  658  QGAKL  672
            +GAKL
Sbjct  204  KGAKL  208



>ref|XP_004978146.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Setaria italica]
Length=705

 Score =   183 bits (464),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 125/196 (64%), Positives = 158/196 (81%), Gaps = 7/196 (4%)
 Frame = +1

Query  97   DSSESGC-----VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPS  261
            +++  GC     +E +FES+ VPSWR Q+T RA  VS +L V+F+ IVMKL+LTTGIIPS
Sbjct  23   EAAGGGCEVTDSIEWVFESEPVPSWREQVTPRALAVSLLLAVVFSLIVMKLSLTTGIIPS  82

Query  262  LNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfg  441
            LNVSAGLLGFFF++ WT  ++  G  + PFTRQENTV+QTCVV + GIAF GGFGSY+FG
Sbjct  83   LNVSAGLLGFFFLRVWTAPVKNPG--RRPFTRQENTVVQTCVVAAYGIAFSGGFGSYLFG  140

Query  442  msESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGT  621
            MSE++A Q    NN +N+K P ++WMIGFLF+VSF+GLF++VPLRKVMI+D+KLTYPSGT
Sbjct  141  MSETIAAQAAEENNADNVKEPRLSWMIGFLFLVSFVGLFALVPLRKVMIVDYKLTYPSGT  200

Query  622  ATAHLIXXFHTPQGAK  669
            ATAHLI  FHTP G++
Sbjct  201  ATAHLINGFHTPDGSE  216



>gb|AFW58894.1| hypothetical protein ZEAMMB73_605066 [Zea mays]
Length=737

 Score =   183 bits (464),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 120/184 (65%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +ER+FE++ VP W  Q+T RA   S  L VLF+ IVMKL+LTTGIIPSLNVSAGLLGFF 
Sbjct  71   IERVFEAEPVPPWPQQVTPRALVTSLFLAVLFSVIVMKLSLTTGIIPSLNVSAGLLGFFL  130

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            ++ WT  ++     + PFTRQENTV+QTCVV + GIAF GGFGSY+FGMSE++A Q    
Sbjct  131  LRVWTAAVKDP---RRPFTRQENTVVQTCVVSAYGIAFSGGFGSYLFGMSETIASQAAEE  187

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            NN  N+K P +AWMIGFLF+VSF+GLF++VPLRKVMIID++LTYPSGTATAHLI  FHTP
Sbjct  188  NNAGNVKEPRLAWMIGFLFLVSFVGLFALVPLRKVMIIDYRLTYPSGTATAHLINGFHTP  247

Query  658  QGAK  669
             G++
Sbjct  248  DGSE  251



>ref|XP_007225160.1| hypothetical protein PRUPE_ppa002368mg [Prunus persica]
 gb|EMJ26359.1| hypothetical protein PRUPE_ppa002368mg [Prunus persica]
Length=680

 Score =   182 bits (462),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F++  VP W  Q+T RA   SF+L ++F FIV KLNLTTG+IPSLNV+AGL+GF  
Sbjct  8    VEEAFKTTPVPPWTKQITVRAMVTSFLLSIVFNFIVCKLNLTTGVIPSLNVAAGLMGFAV  67

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK +T  +EK G LK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS  +A Q    
Sbjct  68   VKGYTAMIEKCGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYILGMSPKIAAQGDEG  127

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N P NIK+  + WMIGFLF VSF+GLFS++ LRK+MII +KLTYPSGTATA+LI  FHTP
Sbjct  128  NTPINIKHLDLGWMIGFLFAVSFVGLFSIMALRKMMIIKYKLTYPSGTATAYLINSFHTP  187

Query  658  QGAKL  672
            +GAKL
Sbjct  188  KGAKL  192



>ref|XP_009351712.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Pyrus 
x bretschneideri]
Length=701

 Score =   182 bits (462),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 118/185 (64%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            VE  F++  VP W  Q+T R+   SF+L ++F FIV KLNLTTG+IPSLNV+AGLLGF  
Sbjct  28   VEEAFKATAVPPWTKQITVRSMVTSFILSIVFNFIVCKLNLTTGVIPSLNVAAGLLGFAV  87

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK +T  ++K GFLK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS  +A Q  + 
Sbjct  88   VKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSAKIAAQGDLG  147

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N   NIK   V WMIGFLF VSF+GLFS++PLRK+MI+ +KLTYPSGTATA+LI  FHTP
Sbjct  148  NTLINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKMMILKYKLTYPSGTATAYLINSFHTP  207

Query  658  QGAKL  672
            +GAKL
Sbjct  208  KGAKL  212



>ref|XP_009593227.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=658

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 137/193 (71%), Gaps = 0/193 (0%)
 Frame = +1

Query  94   EDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVS  273
            E  +E    E  F+ KEVP W  Q+T RA     +L V+F FIV KLNLTTG+IPSLNV+
Sbjct  3    EADNEVLSTEYAFKDKEVPPWEKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVA  62

Query  274  AGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsES  453
            AGLLGF  +++WT  +EK G LK PFTRQENTVIQTCVV SSGIAF  G  SYM GM   
Sbjct  63   AGLLGFAMIRSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMDPF  122

Query  454  VAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAH  633
            +A Q    N P N K   + WM+ +L VVSF GLFS+V LRK+MI+ +KLTYPSGTATA+
Sbjct  123  IAAQADAGNTPNNTKKLAIGWMLPYLLVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAY  182

Query  634  LIXXFHTPQGAKL  672
            LI  FHTP+GAKL
Sbjct  183  LINCFHTPKGAKL  195



>ref|XP_008360015.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7 [Malus domestica]
Length=705

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 149/210 (71%), Gaps = 10/210 (5%)
 Frame = +1

Query  73   GIDSKK-NEDSSESGC---------VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFI  222
            G D++  N D+ + G          VE  F+   VP W  Q+T R+   SF+L ++F FI
Sbjct  8    GSDTQSDNSDAKQKGTAGNTQKKVNVEEAFKYTAVPPWTKQITVRSMVTSFILSIVFNFI  67

Query  223  VMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssg  402
            V KLNLTTG+IPSLNV+AGLLGF  VK +T  ++K GFLK PFTRQENTVIQTCVV SSG
Sbjct  68   VCKLNLTTGVIPSLNVAAGLLGFAVVKGYTAMIDKCGFLKQPFTRQENTVIQTCVVASSG  127

Query  403  iafxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKV  582
            IAF  G  SY+ GMS  +A Q    N P NIK   V WMIGFLF VSF+GLFS++PLRK+
Sbjct  128  IAFSSGTASYLLGMSAKIAAQGDEGNTPINIKKLDVGWMIGFLFAVSFVGLFSIMPLRKM  187

Query  583  MIIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            MI+ +KLTYPSGTATA+LI  FHTP+GAKL
Sbjct  188  MIMKYKLTYPSGTATAYLINSFHTPKGAKL  217



>emb|CBI27130.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 145/202 (72%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTT  246
            D  ++ +  E   E   VE++F++ EVPSWR Q+T RA   S VL  +F F++ KL+LTT
Sbjct  27   DYNVNGRNIERIVEPETVEQVFKNLEVPSWRKQITIRAMVTSIVLSFVFNFVICKLSLTT  86

Query  247  GIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfg  426
            GIIPS NV+AGLLGF FVK W   +EK G LK PFTRQENTVIQTCVV +SGIAF  G  
Sbjct  87   GIIPSFNVAAGLLGFAFVKAWVSLIEKFGLLKQPFTRQENTVIQTCVVAASGIAFNNGTS  146

Query  427  symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            SY+  MS  VA Q    + P N+K+  + W+IGFL  VSF+GLF +VPL ++MII +KLT
Sbjct  147  SYLLAMSSIVADQAD-RDIPTNVKSLSLGWIIGFLLTVSFVGLFLMVPLTEMMIIKYKLT  205

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YP+GTATA+LI  FHTP+GAKL
Sbjct  206  YPTGTATAYLINSFHTPRGAKL  227



>gb|ADN33682.1| oligopeptide transporter [Cucumis melo subsp. melo]
Length=160

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            + ES  VERIFE++EVPSW+NQLT RAF VSF L VLFTFIVMKLNLTTGIIPSLNVSAG
Sbjct  42   AEESMSVERIFEAQEVPSWQNQLTVRAFVVSFGLSVLFTFIVMKLNLTTGIIPSLNVSAG  101

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVV  390
            LLGFFFVKTWTK LEKSGFLK PFTRQENTVIQTCVV
Sbjct  102  LLGFFFVKTWTKLLEKSGFLKQPFTRQENTVIQTCVV  138



>ref|XP_009768859.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=656

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 141/194 (73%), Gaps = 0/194 (0%)
 Frame = +1

Query  91   NEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNV  270
            + +S ++   E  F+ KEVP W+ Q+T R+     +L V+F FIV KLNLTTG+IPSLNV
Sbjct  2    DVESGDNESTEYAFKDKEVPPWKKQITLRSMVTGLILSVVFNFIVCKLNLTTGVIPSLNV  61

Query  271  SAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsE  450
            +AGLLGF  +++WT  +EK G LK PFTRQENTVIQTCVV SSGIAF  G  SYM GMS 
Sbjct  62   AAGLLGFAMIRSWTAVIEKFGKLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSP  121

Query  451  SVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATA  630
             +A Q    N P N     ++WM+ FL VVSF GLFS+V LRK+MII +KLTYPSGTATA
Sbjct  122  FIAAQADAGNTPNNTMKLDISWMLPFLLVVSFAGLFSIVALRKLMIIKYKLTYPSGTATA  181

Query  631  HLIXXFHTPQGAKL  672
            +LI  FHTP+GAKL
Sbjct  182  YLINCFHTPKGAKL  195



>gb|KDP43290.1| hypothetical protein JCGZ_24211 [Jatropha curcas]
Length=671

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTT  246
            D+  + K    +S    VE  ++  EVP W  Q+T RA   S +L ++FTFIV KLNLTT
Sbjct  12   DVEGEEKFKPTNSNKILVEEAYKHIEVPPWTQQVTVRAMVTSIILSLVFTFIVCKLNLTT  71

Query  247  GIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfg  426
            G+IPSLNV+AGLLGF  +K WTK LEK+GFLK  FTRQENTVIQT VV +SGIAF  G  
Sbjct  72   GVIPSLNVAAGLLGFGMLKFWTKLLEKTGFLKQQFTRQENTVIQTFVVAASGIAFSSGTA  131

Query  427  symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            SY+ GMS  +A +    N P+N+K   + WMIGF F+VSF+GLFS++ LRK+MI+D KLT
Sbjct  132  SYILGMSPRMAAESEGGNTPDNVKTLSLGWMIGFNFLVSFVGLFSILALRKIMILDLKLT  191

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YPSGTATA+LI  FHTP+GAKL
Sbjct  192  YPSGTATAYLINSFHTPKGAKL  213



>emb|CAN62811.1| hypothetical protein VITISV_041555 [Vitis vinifera]
Length=692

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 145/202 (72%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTT  246
            D  ++ +  E   E   VE++F++ EVPSWR Q+T RA   S VL  +F F++ KL+LTT
Sbjct  27   DYNVNGRNIERIVEPETVEQVFKNLEVPSWRKQITIRAMVTSIVLSFVFNFVICKLSLTT  86

Query  247  GIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfg  426
            GIIPS NV+AGLLGF FVK W   +EK G LK PFTRQENTVIQTCVV +SGIAF  G  
Sbjct  87   GIIPSFNVAAGLLGFAFVKAWVSLIEKFGLLKQPFTRQENTVIQTCVVAASGIAFNNGTS  146

Query  427  symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            SY+  MS  VA Q    + P N+K+  + W+IGFL  VSF+GLF +VPL ++MII +KLT
Sbjct  147  SYLLAMSSIVADQAD-RDIPTNVKSLSLGWIIGFLLTVSFVGLFLMVPLTEMMIIKYKLT  205

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YP+GTATA+LI  FHTP+GAKL
Sbjct  206  YPTGTATAYLINSFHTPRGAKL  227



>ref|XP_010650300.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=712

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 145/202 (72%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   DLGIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTT  246
            D  ++ +  E   E   VE++F++ EVPSWR Q+T RA   S VL  +F F++ KL+LTT
Sbjct  27   DYNVNGRNIERIVEPETVEQVFKNLEVPSWRKQITIRAMVTSIVLSFVFNFVICKLSLTT  86

Query  247  GIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfg  426
            GIIPS NV+AGLLGF FVK W   +EK G LK PFTRQENTVIQTCVV +SGIAF  G  
Sbjct  87   GIIPSFNVAAGLLGFAFVKAWVSLIEKFGLLKQPFTRQENTVIQTCVVAASGIAFNNGTS  146

Query  427  symfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
            SY+  MS  VA Q    + P N+K+  + W+IGFL  VSF+GLF +VPL ++MII +KLT
Sbjct  147  SYLLAMSSIVADQAD-RDIPTNVKSLSLGWIIGFLLTVSFVGLFLMVPLTEMMIIKYKLT  205

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YP+GTATA+LI  FHTP+GAKL
Sbjct  206  YPTGTATAYLINSFHTPRGAKL  227



>gb|KCW65044.1| hypothetical protein EUGRSUZ_G02568 [Eucalyptus grandis]
Length=674

 Score =   177 bits (450),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 119/191 (62%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            + E   VE  F+  EVP WR QLT RA     +L ++F FIV KLNLTTG+IPSLNV+AG
Sbjct  5    ADEKIVVEEAFKDTEVPPWRQQLTVRALVSGLLLSLVFNFIVCKLNLTTGVIPSLNVAAG  64

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLGF  VK W   LE+ G L+ PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS  +A
Sbjct  65   LLGFAMVKAWASLLERCGLLRQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSSLIA  124

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
             Q    N P N+KN  + W+I FLF VSF+GLFS+VPLRK MI+ +KLTYPSGTATA LI
Sbjct  125  AQSDGGNTPVNVKNLSLGWIIAFLFTVSFVGLFSIVPLRKTMIMKYKLTYPSGTATAFLI  184

Query  640  XXFHTPQGAKL  672
              FHTP+GAKL
Sbjct  185  NSFHTPKGAKL  195



>emb|CBI35268.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +1

Query  226  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgi  405
            MKLNLTTGIIPSLNVSAGLLGFFFV  WTKFL+KSG LK PFTRQENTVIQTCVV SSGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFVSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGI  60

Query  406  afxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  585
            AF GGFGSY+FGMS+++AKQ       E  KNP VAWMIGFLFVVSFLGLFSVVPLRK+M
Sbjct  61   AFSGGFGSYLFGMSQAIAKQSENAGGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIM  120

Query  586  IIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            I+DFKLTYPSGTATAHLI  FHTPQGAKL
Sbjct  121  IVDFKLTYPSGTATAHLINSFHTPQGAKL  149



>emb|CAN61174.1| hypothetical protein VITISV_009380 [Vitis vinifera]
Length=170

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  115  CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  294
             VERIFE KEVPSWR QLT RAF VSFVL VLFTFIVMKLNLTTGIIPSLNVSAGLLGFF
Sbjct  40   SVERIFEGKEVPSWREQLTVRAFVVSFVLSVLFTFIVMKLNLTTGIIPSLNVSAGLLGFF  99

Query  295  FVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQ  465
            FV  WTKFL+KSG LK PFTRQENTVIQTCVV SSGIAF GGFGSY+FGMS+++AKQ
Sbjct  100  FVSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGSYLFGMSQAIAKQ  156



>emb|CDP18194.1| unnamed protein product [Coffea canephora]
Length=682

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +1

Query  145  VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLE  324
            +P W++Q+TFR   VS +LGVLF  I  KLNLT GIIPSLNV+AGLLGFFFVK+WT FL 
Sbjct  38   IPDWKHQITFRGLLVSALLGVLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVKSWTAFLS  97

Query  325  KSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQM---TIXNNPENI  495
            K G   HPFTRQENTVIQTCVV   G+AF GGFGSYM  M E   K +      N  E++
Sbjct  98   KLGLSVHPFTRQENTVIQTCVVACYGLAFSGGFGSYMLSMDEKTYKLIGEDYPGNRAEDV  157

Query  496  KNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            KNPG+ WM+GF FVVSFLGLFS+VPLRKVM++D+KLTYPSGTATA LI  FHT  GA+L
Sbjct  158  KNPGLLWMMGFTFVVSFLGLFSLVPLRKVMVLDYKLTYPSGTATAMLINSFHTSSGAEL  216



>ref|XP_002446811.1| hypothetical protein SORBIDRAFT_06g023030 [Sorghum bicolor]
 gb|EES11139.1| hypothetical protein SORBIDRAFT_06g023030 [Sorghum bicolor]
Length=744

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = +1

Query  94   EDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVS  273
            E +  S  VE+ F  + VPSWR QLT RAF V  VL V+F  I+MK++LTTGI PSLNV 
Sbjct  54   ELAPPSSSVEQAFADQPVPSWREQLTVRAFVVGAVLSVVFNVILMKIDLTTGINPSLNVC  113

Query  274  AGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsES  453
            A LL +F ++TWT+ +  +G LK PFTRQENT+IQTCVV + GI F GGF SY++GMS +
Sbjct  114  ASLLSYFLLRTWTRAIGCTGLLKQPFTRQENTMIQTCVVSAYGITFTGGFSSYLYGMSGA  173

Query  454  VAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAH  633
            +AK+ T  N+P++IK+P + WMIGF+F+VSF+GLF++VPLRKVMI+D+KLTYPSG ATA+
Sbjct  174  IAKK-TESNDPQDIKDPHLGWMIGFMFLVSFVGLFALVPLRKVMIVDYKLTYPSGAATAY  232

Query  634  LIXXFHTPQGAK  669
            L+  FH PQG +
Sbjct  233  LLNGFHAPQGTE  244



>emb|CBI35280.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +1

Query  226  MKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgi  405
            MKLNLTTGIIPSLNVSAGLLGFFFV  WTKFL+KSG LK PFTRQENTVIQTCVV SSGI
Sbjct  1    MKLNLTTGIIPSLNVSAGLLGFFFVSVWTKFLDKSGLLKQPFTRQENTVIQTCVVASSGI  60

Query  406  afxggfgsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVM  585
            AF GGFGSY+FGMS+++AKQ       E  KNP VAWMIGFLFVVSFLGLFSVVPLRK+M
Sbjct  61   AFSGGFGSYLFGMSQAIAKQSENAGGNEEYKNPAVAWMIGFLFVVSFLGLFSVVPLRKIM  120

Query  586  IIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            I+DFKLTYPSGTATAHLI  FHTPQGAKL
Sbjct  121  IVDFKLTYPSGTATAHLINSFHTPQGAKL  149



>ref|XP_004289490.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Fragaria 
vesca subsp. vesca]
Length=697

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 144/200 (72%), Gaps = 2/200 (1%)
 Frame = +1

Query  79   DSKKNEDSSESG--CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            DS   +D ++     +E+ FE  EVP W  Q+T R+    F+L ++F FIV KLNLTTGI
Sbjct  5    DSDNYQDGNQKAEDSIEKAFEDTEVPPWTKQITIRSMVTGFLLSIVFNFIVCKLNLTTGI  64

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsy  432
            IPSLNV+AGLLGF  +K +T  L+K G LK PFTRQENTV+QTCVV SSGIAF  G GSY
Sbjct  65   IPSLNVAAGLLGFALLKVYTALLQKFGLLKQPFTRQENTVVQTCVVASSGIAFSSGMGSY  124

Query  433  mfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYP  612
            + GMS  VA Q    N   NIK   + WM G+LF+VSF+GLFS++ LRK+MIID KLTYP
Sbjct  125  LLGMSPLVAAQADAGNTLINIKKLAIPWMTGYLFLVSFVGLFSIIALRKMMIIDRKLTYP  184

Query  613  SGTATAHLIXXFHTPQGAKL  672
            SGTATAHLI  FHT +GAK+
Sbjct  185  SGTATAHLINSFHTRKGAKV  204



>ref|XP_006350378.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=650

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 137/183 (75%), Gaps = 0/183 (0%)
 Frame = +1

Query  124  RIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  303
            + F+ + +P+W+ Q+T RA     +L V+F FIV KLNLTTG+IPSLNV+AGLLGF  ++
Sbjct  13   KAFKEEYIPAWQKQITLRAMVTGLILSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAGIR  72

Query  304  TWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNN  483
            TWT  ++K G LK PFTRQENTVIQTCVV SSGIAF  G  SYM GMS  +A Q    N 
Sbjct  73   TWTAVIDKFGMLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLGMSPYIASQADAGNT  132

Query  484  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQG  663
            P N K   + WM+ +LFVVSF GLFS+V LRK+MI+ +KLTYPSGTATA+LI  FHTP+G
Sbjct  133  PNNTKKLSITWMLPYLFVVSFAGLFSIVALRKMMIMKYKLTYPSGTATAYLINCFHTPKG  192

Query  664  AKL  672
            AKL
Sbjct  193  AKL  195



>gb|EPS65244.1| hypothetical protein M569_09533, partial [Genlisea aurea]
Length=616

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = +1

Query  133  ESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWT  312
             ++EVPSW+NQ+T RA  VS +L  LF  IV KLNL+TG+IPSLNV+AGLLGF  VK+WT
Sbjct  7    AAEEVPSWKNQITVRAVVVSVLLSFLFNVIVCKLNLSTGVIPSLNVAAGLLGFAMVKSWT  66

Query  313  KFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXNNPEN  492
              + K G LK PFTRQENTVIQTCVV SSGIAF  G  SY+  MS   A Q+   NNP N
Sbjct  67   YLISKFGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLAMSPYTAAQVDAGNNPIN  126

Query  493  IKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQGAKL  672
            +K   + WMI FLF++SF+GLFS+ P+RK+MI+ +KLTYPSGTATA LI  FHT +GAKL
Sbjct  127  VKPLSLGWMIAFLFIMSFVGLFSIAPMRKLMILKYKLTYPSGTATACLINSFHTSRGAKL  186



>ref|XP_004978145.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like 
[Setaria italica]
Length=725

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  76   IDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGII  255
            + S+  +       VE  F    VPSWR QLT RAF V  +L V+F  I+MK++LTTGI 
Sbjct  49   VRSRAGKQEPAPPSVEEAFADLPVPSWREQLTVRAFVVGSLLAVVFNVILMKIDLTTGIN  108

Query  256  PSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsym  435
            PSLNV A LL +F V+ WTK +E  G L+ PFTRQENT+IQTCVV + GI F GGF SY+
Sbjct  109  PSLNVCASLLSYFLVRVWTKAIEGMGLLRQPFTRQENTMIQTCVVSAYGITFTGGFSSYL  168

Query  436  fgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPS  615
            FGMS ++A + T  N+ +NIK P + WMIGF+F+VSF+GLF++VPLRKVMI+D+KLTYPS
Sbjct  169  FGMSGTIANKATEANDAQNIKEPHLGWMIGFMFLVSFVGLFALVPLRKVMIVDYKLTYPS  228

Query  616  GTATAHLIXXFHTPQGAK  669
            GTATA+LI  FH P G++
Sbjct  229  GTATAYLINGFHAPHGSE  246



>ref|XP_010101178.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
 gb|EXC45314.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
Length=669

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = +1

Query  121  ERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFV  300
            E  F    VP W  Q+T R+   S VL V+F FIV KLNLTTG+IPSLNV+AGLLGF  V
Sbjct  34   EEAFVDTAVPPWTKQITVRSMVTSLVLSVVFNFIVCKLNLTTGVIPSLNVAAGLLGFAVV  93

Query  301  KTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIXN  480
            K +T  L+K+G LK PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS ++A Q    N
Sbjct  94   KGYTAVLDKAGLLKQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSANIAAQGEEGN  153

Query  481  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQ  660
             P N+K   + WMIG+LFVVSF+GLFS+VPLRK+MI+ +KLTYPSGTATA+LI  FHTP+
Sbjct  154  TPINVKQLSLGWMIGYLFVVSFVGLFSIVPLRKMMIMKYKLTYPSGTATAYLINSFHTPK  213

Query  661  GAKL  672
            GAKL
Sbjct  214  GAKL  217



>emb|CDP16865.1| unnamed protein product [Coffea canephora]
Length=688

 Score =   176 bits (445),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 116/185 (63%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = +1

Query  118  VERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFF  297
            +E++F++ EVP WR Q+TFR+   S VL  +F  +V KLNLTTG+IPSLNV+AGLLGF F
Sbjct  28   IEQVFKNIEVPPWRKQITFRSVFTSAVLSFVFNVVVCKLNLTTGVIPSLNVAAGLLGFGF  87

Query  298  VKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX  477
            VK +T  ++K G LK PFTRQENTVIQTCVV SSGIAF  G  SYM  MS  VA Q  + 
Sbjct  88   VKFYTTLVQKWGMLKQPFTRQENTVIQTCVVASSGIAFSSGTASYMLAMSSRVAAQADVG  147

Query  478  NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTP  657
            N P N+    + W+ GFLF VSF+GLFS+VPLRK+MI+ +KLTYPSGTATA LI  FHTP
Sbjct  148  NAPINVMKLELGWIYGFLFAVSFIGLFSIVPLRKMMIMKYKLTYPSGTATAFLINSFHTP  207

Query  658  QGAKL  672
            +GAKL
Sbjct  208  KGAKL  212



>ref|XP_010068802.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=697

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            + E   VE  F+  EVP WR QLT RA     +L ++F FIV KLNLTTG+IPSLNV+AG
Sbjct  28   ADEKIVVEEAFKDTEVPPWRQQLTVRALVSGLLLSLVFNFIVCKLNLTTGVIPSLNVAAG  87

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLGF  VK W   LE+ G L+ PFTRQENTVIQTCVV SSGIAF  G  SY+ GMS  +A
Sbjct  88   LLGFAMVKAWASLLERCGLLRQPFTRQENTVIQTCVVASSGIAFSSGTASYLLGMSSLIA  147

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
             Q    N P N+KN  + W+I FLF VSF+GLFS+VPLRK MI+ +KLTYPSGTATA LI
Sbjct  148  AQSDGGNTPVNVKNLSLGWIIAFLFTVSFVGLFSIVPLRKTMIMKYKLTYPSGTATAFLI  207

Query  640  XXFHTPQGAKL  672
              FHTP+GAKL
Sbjct  208  NSFHTPKGAKL  218



>ref|XP_006359441.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=655

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 140/203 (69%), Gaps = 4/203 (2%)
 Frame = +1

Query  76   IDSKKNEDSSESG----CVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLT  243
            + +   ED    G      E  F+ + VP W+ Q+  RA     +L V+F FIV KLNLT
Sbjct  2    VRNGDEEDEERGGMRVESTEDAFKDEYVPPWQKQIALRAMVTGLILSVVFNFIVCKLNLT  61

Query  244  TGIIPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggf  423
            TG+IPSLNV+AGLLGF  V++WT  ++K G LK PFTRQENTVIQTCVV SSGIAF  G 
Sbjct  62   TGVIPSLNVAAGLLGFAGVRSWTVVIDKFGMLKQPFTRQENTVIQTCVVASSGIAFSSGT  121

Query  424  gsymfgmsESVAKQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKL  603
             SYM GMS  +A Q    N P N K   ++WM  +LFVVSF GLFS+V LRK+MII +KL
Sbjct  122  ASYMLGMSPYIATQSGAGNTPNNTKTLSISWMFPYLFVVSFAGLFSIVALRKLMIIKYKL  181

Query  604  TYPSGTATAHLIXXFHTPQGAKL  672
            TYPSGTATA+LI  FHTP+GAKL
Sbjct  182  TYPSGTATAYLINCFHTPKGAKL  204



>ref|XP_010249085.1| PREDICTED: probable metal-nicotianamine transporter YSL6 [Nelumbo 
nucifera]
Length=677

 Score =   175 bits (444),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 121/184 (66%), Positives = 140/184 (76%), Gaps = 5/184 (3%)
 Frame = +1

Query  136  SKE--VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTW  309
            SKE  +P W++Q+T R   VS  LG LF  I  KLNLT GIIPSLNV+AGLLGFFFVK+W
Sbjct  29   SKEMPIPPWKDQITIRGLVVSMFLGTLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVKSW  88

Query  310  TKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX---N  480
            T FL K GF   PFTRQENTVIQTCVV   G+AF GGFGSYM  M E   K + +    N
Sbjct  89   TGFLSKLGFSIAPFTRQENTVIQTCVVACYGLAFSGGFGSYMLAMDERTYKLIGVDYPGN  148

Query  481  NPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQ  660
              E+IKNP ++WMIGF+FVVSFLGLFS+VPLRKVM++D+KLTYPSGTATA LI  FHT +
Sbjct  149  RAEDIKNPALSWMIGFMFVVSFLGLFSLVPLRKVMVMDYKLTYPSGTATAMLINSFHTTK  208

Query  661  GAKL  672
            GA+L
Sbjct  209  GAEL  212



>ref|XP_011000961.1| PREDICTED: probable metal-nicotianamine transporter YSL6 [Populus 
euphratica]
Length=669

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 146/202 (72%), Gaps = 11/202 (5%)
 Frame = +1

Query  76   IDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGII  255
            +DSK   ++ +S        ++ +P W++Q+T R   VS VLGVLF  I  KLNLT GII
Sbjct  11   VDSKDKINTVDS--------TEIIPEWKDQITIRGLVVSAVLGVLFCIITHKLNLTVGII  62

Query  256  PSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsym  435
            PSLNV+AGLLGFFFVK+WT FL + GF   PFT+QENTVIQTCVV   G+AF GGFGSY+
Sbjct  63   PSLNVAAGLLGFFFVKSWTGFLSRLGFSVSPFTKQENTVIQTCVVACYGLAFSGGFGSYL  122

Query  436  fgmsESVAKQMTI---XNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLT  606
              + E   K +      N  E++KNPG+ WMIGFLFVVSFLGLFS+ PLRKVM++D+KLT
Sbjct  123  IALDEKTYKLIGTDYPGNRAEDVKNPGLGWMIGFLFVVSFLGLFSLAPLRKVMVMDYKLT  182

Query  607  YPSGTATAHLIXXFHTPQGAKL  672
            YPSGTATA LI  FHT  GA+L
Sbjct  183  YPSGTATAMLINSFHTNTGAEL  204



>ref|XP_010099817.1| putative metal-nicotianamine transporter YSL5 [Morus notabilis]
 gb|EXC44900.1| putative metal-nicotianamine transporter YSL5 [Morus notabilis]
Length=252

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 3/145 (2%)
 Frame = +1

Query  88   KNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLN  267
            ++ D      VE++FE++EVPSWR QLT RAF VSF L +LF+FIVMK +LT G++PSLN
Sbjct  48   EDHDDGTGLSVEQMFENQEVPSWRKQLTVRAFVVSFALSILFSFIVMKFSLTVGVVPSLN  107

Query  268  VSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgms  447
            VSAGLLGFFFVKTWTK +E+SG LK PFTRQENTVIQTCVV SSG+AF GGFGSY+FGMS
Sbjct  108  VSAGLLGFFFVKTWTKLVERSGMLKQPFTRQENTVIQTCVVASSGLAFSGGFGSYLFGMS  167

Query  448  ESVAKQMTIXNNPENIKNPGVAWMI  522
            ES AKQ +   +  + KNP + WMI
Sbjct  168  ESAAKQSS---DTSDFKNPALGWMI  189



>gb|KHG22766.1| putative metal-nicotianamine transporter YSL6 -like protein [Gossypium 
arboreum]
Length=625

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 136/183 (74%), Gaps = 3/183 (2%)
 Frame = +1

Query  133  ESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWT  312
            ES+ VP W++Q+T R   VS +LG LF  I  KLNLT GIIPSLNV AGLLGFFFVK+WT
Sbjct  23   ESELVPEWKDQITIRGLVVSALLGTLFCIITHKLNLTVGIIPSLNVGAGLLGFFFVKSWT  82

Query  313  KFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTI---XNN  483
             FL K GF   PFT+QENTVIQTCVV   G+AF GGFGSYM  M E   K +      N 
Sbjct  83   GFLTKLGFQVSPFTKQENTVIQTCVVACYGLAFSGGFGSYMIAMDERTYKLIGADYPGNR  142

Query  484  PENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHTPQG  663
             E+IKNPG+ WM GFLFVVSFLGLFS+ PLRKVM++D+KLTYPSGTATA LI  FHT  G
Sbjct  143  AEDIKNPGLGWMTGFLFVVSFLGLFSLTPLRKVMVLDYKLTYPSGTATAMLINSFHTHSG  202

Query  664  AKL  672
            A+L
Sbjct  203  AEL  205



>ref|XP_006847868.1| hypothetical protein AMTR_s00029p00088380 [Amborella trichopoda]
 gb|ERN09449.1| hypothetical protein AMTR_s00029p00088380 [Amborella trichopoda]
Length=119

 Score =   162 bits (411),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +1

Query  73   GIDSKKNEDSSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGI  252
            G++  + E+  ES  VE+IFESK VP W+ QLTFRAF VSFVLG++F+ IVM+ NLTTGI
Sbjct  14   GLEDNRGEEERESLSVEQIFESKSVPPWQEQLTFRAFFVSFVLGIMFSVIVMRFNLTTGI  73

Query  253  IPSLNVSAGLLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCV  387
            IPSLNVSAGLLGFFFVK+WTKFLEK G LK PFTRQENTVIQTCV
Sbjct  74   IPSLNVSAGLLGFFFVKSWTKFLEKVGALKQPFTRQENTVIQTCV  118



>ref|XP_004158539.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=678

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 140/191 (73%), Gaps = 6/191 (3%)
 Frame = +1

Query  100  SSESGCVERIFESKEVPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAG  279
            + ES  VE+ +ES+E+  WR QLT RAF VS  L  LFTFIVM +NLTTG+IP LNVSA 
Sbjct  2    AEESSSVEKSYESEELLPWRXQLTARAFVVSLFLSALFTFIVMNINLTTGLIPPLNVSAA  61

Query  280  LLGFFFVKTWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVA  459
            LLG+ F+K WTKF  KS     PFTRQENTVIQTCVV S  +AF GGFGSY+  MS+ + 
Sbjct  62   LLGYVFLKIWTKFHHKS----LPFTRQENTVIQTCVVASVSVAFTGGFGSYLLAMSQRIN  117

Query  460  KQMTIXNNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLI  639
            +     +N  + KNP + WMIGFLF+VSFLG F V+  RK MI+DFKLTYPSGTATAHLI
Sbjct  118  ELSEAKDN--DFKNPSLGWMIGFLFIVSFLGPFLVLLFRKRMIMDFKLTYPSGTATAHLI  175

Query  640  XXFHTPQGAKL  672
              FHT +GAKL
Sbjct  176  NSFHTSRGAKL  186



>ref|XP_010556294.1| PREDICTED: probable metal-nicotianamine transporter YSL6 [Tarenaya 
hassleriana]
Length=676

 Score =   174 bits (441),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 120/186 (65%), Positives = 141/186 (76%), Gaps = 4/186 (2%)
 Frame = +1

Query  127  IFESKE-VPSWRNQLTFRAFCVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVK  303
            +F+S E VP W+ Q+T R   VS +LG LF  I  KLNLT GIIPSLNV+AGLLGFFFVK
Sbjct  25   VFDSDERVPGWKEQITVRGLAVSALLGTLFCIITHKLNLTVGIIPSLNVAAGLLGFFFVK  84

Query  304  TWTKFLEKSGFLKHPFTRQENTVIQTCVVxssgiafxggfgsymfgmsESVAKQMTIX--  477
            +WT FL K GF   PFT+QENTVIQTCVV   G+AF GGFGSY+  M E   K + +   
Sbjct  85   SWTGFLSKLGFSVKPFTKQENTVIQTCVVACYGLAFSGGFGSYLIAMDEKTYKLIGVDYP  144

Query  478  -NNPENIKNPGVAWMIgflfvvsflglfsvvplRKVMIIDFKLTYPSGTATAHLIXXFHT  654
             N+ E++KNPG+ WM GFLFVVSFLGLFS+VPLRKVM++D+KLTYPSGTATA LI  FHT
Sbjct  145  GNHAEDVKNPGLWWMTGFLFVVSFLGLFSLVPLRKVMVLDYKLTYPSGTATAMLINSFHT  204

Query  655  PQGAKL  672
              GA+L
Sbjct  205  NTGAEL  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600