BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040F07

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009597488.1|  PREDICTED: F-box protein SKIP5                     313   6e-104   Nicotiana tomentosiformis
ref|XP_009788949.1|  PREDICTED: F-box protein SKIP5                     312   2e-103   Nicotiana sylvestris
ref|NP_001234135.1|  SKIP5-like protein                                 312   2e-103   Solanum lycopersicum
ref|XP_011091828.1|  PREDICTED: F-box protein SKIP5                     311   4e-103   Sesamum indicum [beniseed]
ref|XP_010554478.1|  PREDICTED: F-box protein SKIP5                     309   4e-102   Tarenaya hassleriana [spider flower]
ref|XP_004516505.1|  PREDICTED: F-box protein SKIP5-like                308   6e-102   Cicer arietinum [garbanzo]
ref|XP_003598631.1|  F-box protein SKIP5                                308   7e-102   Medicago truncatula
ref|XP_006350998.1|  PREDICTED: F-box protein SKIP5-like                307   2e-101   Solanum tuberosum [potatoes]
ref|NP_001242768.1|  uncharacterized protein LOC100808414               305   4e-101   
ref|XP_006590332.1|  PREDICTED: uncharacterized protein LOC100808...    306   8e-101   
ref|XP_007148969.1|  hypothetical protein PHAVU_005G029600g             307   8e-101   Phaseolus vulgaris [French bean]
gb|EYU36858.1|  hypothetical protein MIMGU_mgv1a022539mg                303   8e-100   Erythranthe guttata [common monkey flower]
gb|EYU42952.1|  hypothetical protein MIMGU_mgv1a012165mg                302   1e-99    Erythranthe guttata [common monkey flower]
gb|AAG21980.1|  SKP1 interacting partner 5                              302   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566999.1|  SKP1/ASK-interacting protein 5                        302   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002269519.1|  PREDICTED: F-box protein SKIP5 isoform X1          301   2e-99    Vitis vinifera
emb|CDP18131.1|  unnamed protein product                                301   3e-99    Coffea canephora [robusta coffee]
gb|AFK33567.1|  unknown                                                 301   4e-99    Lotus japonicus
ref|XP_006403571.1|  hypothetical protein EUTSA_v10010628mg             301   6e-99    Eutrema salsugineum [saltwater cress]
ref|XP_002877981.1|  skp1-interacting partner 5                         301   9e-99    Arabidopsis lyrata subsp. lyrata
ref|XP_010427150.1|  PREDICTED: F-box protein SKIP5                     300   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010067744.1|  PREDICTED: F-box protein SKIP5                     300   1e-98    Eucalyptus grandis [rose gum]
ref|XP_010504251.1|  PREDICTED: F-box protein SKIP5-like                300   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010515975.1|  PREDICTED: F-box protein SKIP5                     300   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_009116131.1|  PREDICTED: F-box protein SKIP5-like                299   5e-98    Brassica rapa
gb|KHN21305.1|  F-box protein SKIP5                                     298   6e-98    Glycine soja [wild soybean]
ref|XP_006292685.1|  hypothetical protein CARUB_v10018930mg             298   7e-98    Capsella rubella
emb|CDX78238.1|  BnaA09g34330D                                          298   8e-98    
gb|KFK34691.1|  hypothetical protein AALP_AA5G179200                    298   9e-98    Arabis alpina [alpine rockcress]
ref|XP_006420750.1|  hypothetical protein CICLE_v10005678mg             297   1e-97    Citrus clementina [clementine]
ref|XP_002513076.1|  conserved hypothetical protein                     297   1e-97    Ricinus communis
emb|CDX76144.1|  BnaA04g04080D                                          295   2e-96    
gb|EPS72918.1|  hypothetical protein M569_01839                         293   2e-96    Genlisea aurea
gb|KJB74631.1|  hypothetical protein B456_012G017000                    293   3e-96    Gossypium raimondii
gb|KDP40515.1|  hypothetical protein JCGZ_24514                         293   5e-96    Jatropha curcas
ref|XP_010095957.1|  hypothetical protein L484_023946                   293   8e-96    Morus notabilis
ref|XP_008813420.1|  PREDICTED: F-box protein SKIP5                     292   1e-95    Phoenix dactylifera
ref|XP_009139236.1|  PREDICTED: F-box protein SKIP5-like isoform X2     293   3e-95    Brassica rapa
ref|XP_006658920.1|  PREDICTED: F-box protein SKIP5-like                290   6e-95    Oryza brachyantha
ref|XP_008348371.1|  PREDICTED: F-box protein SKIP5 isoform X1          290   6e-95    
ref|XP_004307123.1|  PREDICTED: F-box protein SKIP5 isoform X1          290   7e-95    Fragaria vesca subsp. vesca
ref|XP_007011111.1|  SKP1/ASK-interacting protein 5 isoform 1           290   1e-94    
ref|XP_004958577.1|  PREDICTED: F-box protein SKIP5-like                289   2e-94    Setaria italica
ref|XP_010938589.1|  PREDICTED: F-box protein SKIP5                     289   3e-94    Elaeis guineensis
ref|XP_002461155.1|  hypothetical protein SORBIDRAFT_02g041860          288   5e-94    Sorghum bicolor [broomcorn]
ref|XP_008653434.1|  PREDICTED: F-box protein SKIP5                     288   6e-94    Zea mays [maize]
ref|XP_010999613.1|  PREDICTED: F-box protein SKIP5-like isoform X1     286   1e-93    Populus euphratica
ref|XP_011000542.1|  PREDICTED: F-box protein SKIP5-like                286   2e-93    Populus euphratica
ref|XP_010999614.1|  PREDICTED: F-box protein SKIP5-like isoform X2     287   2e-93    Populus euphratica
ref|XP_009354454.1|  PREDICTED: F-box protein SKIP5 isoform X1          286   3e-93    Pyrus x bretschneideri [bai li]
ref|XP_002299213.2|  SKP1-INTERACTING PARTNER 5 family protein          286   4e-93    
ref|XP_007218829.1|  hypothetical protein PRUPE_ppa010167mg             285   8e-93    Prunus persica
gb|KJB74633.1|  hypothetical protein B456_012G017000                    285   1e-92    Gossypium raimondii
ref|XP_010670456.1|  PREDICTED: F-box protein SKIP5                     284   3e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003559852.1|  PREDICTED: F-box protein SKIP5                     281   2e-91    Brachypodium distachyon [annual false brome]
gb|EEE67747.1|  hypothetical protein OsJ_25443                          291   4e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004142419.1|  PREDICTED: F-box protein SKIP5-like                281   6e-91    Cucumis sativus [cucumbers]
ref|XP_008446937.1|  PREDICTED: F-box protein SKIP5 isoform X1          280   1e-90    Cucumis melo [Oriental melon]
gb|KJB74634.1|  hypothetical protein B456_012G017000                    278   6e-90    Gossypium raimondii
gb|EEC82615.1|  hypothetical protein OsI_27192                          270   4e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_009387040.1|  PREDICTED: F-box protein SKIP5                     273   9e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006830359.1|  hypothetical protein AMTR_s00116p00090490          268   3e-86    Amborella trichopoda
ref|XP_011469379.1|  PREDICTED: F-box protein SKIP5 isoform X2          269   7e-86    Fragaria vesca subsp. vesca
ref|XP_010659170.1|  PREDICTED: F-box protein SKIP5 isoform X2          265   3e-85    Vitis vinifera
ref|XP_008446939.1|  PREDICTED: F-box protein SKIP5 isoform X2          244   3e-77    
emb|CAB77568.1|  putative protein                                       231   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001060527.1|  Os07g0659700                                       229   1e-70    
ref|XP_008348378.1|  PREDICTED: F-box protein SKIP5 isoform X2          226   2e-70    
dbj|BAJ85981.1|  predicted protein                                      226   2e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010999616.1|  PREDICTED: F-box protein SKIP5-like isoform X3     224   2e-69    Populus euphratica
ref|XP_009354455.1|  PREDICTED: F-box protein SKIP5 isoform X2          223   5e-69    Pyrus x bretschneideri [bai li]
gb|ADE75775.1|  unknown                                                 222   1e-67    Picea sitchensis
gb|AFK48081.1|  unknown                                                 213   6e-66    Lotus japonicus
ref|XP_007011112.1|  SKP1/ASK-interacting protein 5 isoform 2           217   6e-66    
gb|AAG40405.1|AF325053_1  T14E10.50                                     207   9e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006494343.1|  PREDICTED: F-box protein SKIP5-like isoform X1     203   3e-62    Citrus sinensis [apfelsine]
ref|XP_006494344.1|  PREDICTED: F-box protein SKIP5-like isoform X2     199   9e-61    Citrus sinensis [apfelsine]
ref|XP_009139235.1|  PREDICTED: F-box protein SKIP5-like isoform X1     201   1e-59    
gb|KJB74632.1|  hypothetical protein B456_012G017000                    196   4e-59    Gossypium raimondii
ref|XP_003598633.1|  F-box protein SKIP5                                187   1e-55    
ref|XP_010659171.1|  PREDICTED: F-box protein SKIP5 isoform X3          183   4e-54    
ref|XP_001765023.1|  predicted protein                                  196   2e-53    
ref|XP_002976942.1|  hypothetical protein SELMODRAFT_175869             183   8e-53    Selaginella moellendorffii
ref|XP_002980686.1|  hypothetical protein SELMODRAFT_178289             182   1e-52    Selaginella moellendorffii
gb|EMT11615.1|  hypothetical protein F775_29980                         181   1e-52    
emb|CDX73477.1|  BnaC08g25260D                                          175   8e-52    
emb|CDY13210.1|  BnaC04g26250D                                          171   5e-50    Brassica napus [oilseed rape]
tpg|DAA63988.1|  TPA: hypothetical protein ZEAMMB73_319872              171   8e-50    
gb|KHG17417.1|  F-box SKIP5 -like protein                               147   2e-39    Gossypium arboreum [tree cotton]
ref|NP_567000.2|  SKP1/ASK-interacting protein 5                        133   2e-35    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA41661.1|  TPA: hypothetical protein ZEAMMB73_083322              132   5e-35    
ref|XP_008246108.1|  PREDICTED: F-box protein SKIP5-like                131   1e-34    
ref|XP_006494345.1|  PREDICTED: F-box protein SKIP5-like isoform X3     130   3e-34    Citrus sinensis [apfelsine]
gb|EYU42992.1|  hypothetical protein MIMGU_mgv1a018998mg                129   6e-34    Erythranthe guttata [common monkey flower]
emb|CDY66691.1|  BnaC04g53050D                                          129   2e-33    Brassica napus [oilseed rape]
emb|CDX73483.1|  BnaC08g25200D                                          129   2e-33    
emb|CDY40005.1|  BnaC05g13100D                                          129   2e-33    Brassica napus [oilseed rape]
ref|XP_003598632.1|  F-box protein SKIP5                                128   3e-33    
gb|AFK39958.1|  unknown                                                 125   6e-32    Medicago truncatula
emb|CDY13209.1|  BnaC04g26260D                                          125   7e-32    Brassica napus [oilseed rape]
ref|XP_006431426.1|  hypothetical protein CICLE_v10002701mg             102   3e-23    
ref|XP_008246248.1|  PREDICTED: F-box protein SKIP5-like              95.9    4e-21    
ref|XP_005651314.1|  hypothetical protein COCSUDRAFT_59281            91.7    2e-18    Coccomyxa subellipsoidea C-169
gb|KIY98094.1|  F-box protein SKIP5                                   92.4    3e-18    Monoraphidium neglectum
gb|EMS52646.1|  hypothetical protein TRIUR3_14698                     88.2    3e-17    Triticum urartu
ref|XP_010497120.1|  PREDICTED: F-box protein SKIP5-like              78.6    2e-15    
ref|XP_010248139.1|  PREDICTED: F-box protein SKIP5-like              77.4    1e-14    
ref|XP_011397893.1|  F-box protein SKIP5                              74.3    1e-12    Auxenochlorella protothecoides
ref|XP_005852278.1|  hypothetical protein CHLNCDRAFT_133681           72.4    2e-11    Chlorella variabilis
ref|XP_006386008.1|  hypothetical protein POPTR_0003s19945g           58.2    2e-07    
ref|XP_008904960.1|  hypothetical protein PPTG_11400                  55.5    2e-05    Phytophthora parasitica INRA-310
ref|WP_038557082.1|  hypothetical protein                             53.9    3e-05    Draconibacterium orientale
gb|ETL94122.1|  hypothetical protein L917_07851                       52.8    1e-04    Phytophthora parasitica
gb|ETK87535.1|  hypothetical protein L915_08027                       52.8    1e-04    Phytophthora parasitica
gb|ETP17406.1|  hypothetical protein F441_08176                       52.8    1e-04    Phytophthora parasitica CJ01A1
gb|ETI47607.1|  hypothetical protein F443_08200                       52.8    1e-04    Phytophthora parasitica P1569
gb|ETL40964.1|  hypothetical protein L916_07950                       52.4    1e-04    Phytophthora parasitica
gb|ETP45417.1|  hypothetical protein F442_08141                       52.4    2e-04    Phytophthora parasitica P10297
gb|ETO76325.1|  hypothetical protein F444_08256                       52.4    2e-04    Phytophthora parasitica P1976
gb|ETM47366.1|  hypothetical protein L914_07913                       52.4    2e-04    Phytophthora parasitica
tpg|DAA63986.1|  TPA: hypothetical protein ZEAMMB73_319872            47.8    4e-04    
ref|XP_002898448.1|  SNF2 family helicase/ATPase and F-box protei...  50.4    8e-04    Phytophthora infestans T30-4



>ref|XP_009597488.1| PREDICTED: F-box protein SKIP5 [Nicotiana tomentosiformis]
Length=262

 Score =   313 bits (803),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHP+LWLRVDRS +D S PG++PN
Sbjct  18   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPQLWLRVDRSAKDLSQPGVYPN  77

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GGSHRVSNI+I+KPLCLIGAGE PDDT L CSR SDSALEF+
Sbjct  78   IEIAVSAARPGDTILIAAGGSHRVSNIKIEKPLCLIGAGESPDDTTLICSRSSDSALEFM  137

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY
Sbjct  138  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  181



>ref|XP_009788949.1| PREDICTED: F-box protein SKIP5 [Nicotiana sylvestris]
Length=262

 Score =   312 bits (799),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCH WRFLACHP+LWLRVDRSV+D S PG++PN
Sbjct  18   INNLDDGCLMHIFSFLSPIPDRYNTALVCHGWRFLACHPQLWLRVDRSVKDLSQPGVYPN  77

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTIL+A GGSHRVSNI+I+KPLCLIGAGE PDDT L CSR SDSALEF+
Sbjct  78   IEIAVSAARPGDTILVAAGGSHRVSNIKIEKPLCLIGAGESPDDTTLICSRSSDSALEFM  137

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY
Sbjct  138  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  181



>ref|NP_001234135.1| SKIP5-like protein [Solanum lycopersicum]
 gb|AAL05932.1| SKIP5-like protein [Solanum lycopersicum]
Length=265

 Score =   312 bits (799),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDR+V+D S PG++PN
Sbjct  21   INSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRAVKDLSQPGVYPN  80

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GGSH VSNIQI+KPLCLIGAGE PDDT L CSRGSDSALEF+
Sbjct  81   IEMAVSAARPGDTILIAAGGSHHVSNIQIEKPLCLIGAGESPDDTTLICSRGSDSALEFM  140

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTVR ELGCCLLHRSG+LT+DGCILQCESNPLDHLSY
Sbjct  141  STCKLANLTVRTELGCCLLHRSGKLTVDGCILQCESNPLDHLSY  184



>ref|XP_011091828.1| PREDICTED: F-box protein SKIP5 [Sesamum indicum]
Length=251

 Score =   311 bits (796),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLM IFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSV+D S PG++P+
Sbjct  22   INNLDDGCLMLIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVKDLSQPGVYPS  81

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IETAVS+ARPGDTILIA GG HR SNIQIKKPLCLIGAGE+PDDT L CSRGS+SALEFL
Sbjct  82   IETAVSAARPGDTILIAAGGIHRTSNIQIKKPLCLIGAGELPDDTTLICSRGSESALEFL  141

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS+
Sbjct  142  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSH  185



>ref|XP_010554478.1| PREDICTED: F-box protein SKIP5 [Tarenaya hassleriana]
Length=274

 Score =   309 bits (792),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 160/183 (87%), Gaps = 7/183 (4%)
 Frame = +1

Query  145  HPTTASELEAAPYYCYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPR  324
             P    ++E+ P +       NNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPR
Sbjct  20   EPRKKQKMESDPLF-------NNLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPR  72

Query  325  LWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGE  504
            LWLRVDRSV+D S PG+FPNIE+AVS+ARPGDTILI  GGSHRVSNIQIKKPLCLIG GE
Sbjct  73   LWLRVDRSVKDLSQPGVFPNIESAVSAARPGDTILIGAGGSHRVSNIQIKKPLCLIGGGE  132

Query  505  IPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLD  684
            +PD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCESNPLD
Sbjct  133  LPDETTLICSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCESNPLD  192

Query  685  HLS  693
            +LS
Sbjct  193  YLS  195



>ref|XP_004516505.1| PREDICTED: F-box protein SKIP5-like [Cicer arietinum]
Length=264

 Score =   308 bits (790),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 158/170 (93%), Gaps = 2/170 (1%)
 Frame = +1

Query  184  YCYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSS  363
            +CYS   INNLDDGCLMHIFSFL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S
Sbjct  29   FCYS--PINNLDDGCLMHIFSFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLS  86

Query  364  LPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGS  543
             PG+FPNIETAVS++RPGDTILIA GG+HRVSNIQI KPLCLIGAG+IPDDT+LTC RGS
Sbjct  87   EPGVFPNIETAVSASRPGDTILIAAGGTHRVSNIQINKPLCLIGAGDIPDDTMLTCPRGS  146

Query  544  DSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            DSALEFLSTCKLANLTV+AELGCCLLHRSGRLTID C+LQCESNPLD LS
Sbjct  147  DSALEFLSTCKLANLTVKAELGCCLLHRSGRLTIDACVLQCESNPLDFLS  196



>ref|XP_003598631.1| F-box protein SKIP5 [Medicago truncatula]
 gb|AES68882.1| F-box SKIP5-like protein [Medicago truncatula]
Length=260

 Score =   308 bits (789),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 157/169 (93%), Gaps = 2/169 (1%)
 Frame = +1

Query  187  CYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL  366
            CYSR  INNLDDGCLMHIFSFLSPIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S 
Sbjct  26   CYSR--INNLDDGCLMHIFSFLSPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLSE  83

Query  367  PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSD  546
            PG+FPNIETAVS++RPGDTILIA GG HRV+NIQI KPLCLIGAGEIPDDT+LTCSRG D
Sbjct  84   PGVFPNIETAVSASRPGDTILIAAGGIHRVANIQINKPLCLIGAGEIPDDTMLTCSRGLD  143

Query  547  SALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            SA EFLS CKL+NLTV+AELGCCLLHRSGRLTIDGC+LQCESNPLD LS
Sbjct  144  SAFEFLSNCKLSNLTVKAELGCCLLHRSGRLTIDGCVLQCESNPLDFLS  192



>ref|XP_006350998.1| PREDICTED: F-box protein SKIP5-like [Solanum tuberosum]
Length=265

 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDR+V+D S PG++PN
Sbjct  21   INRLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRAVKDLSQPGVYPN  80

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GGSH VSNIQI+KPLCLIGAGE PDDT L CSR SDSALEF+
Sbjct  81   IEMAVSAARPGDTILIAAGGSHHVSNIQIEKPLCLIGAGESPDDTTLICSRSSDSALEFM  140

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTVR ELGCCLLHR G+LTIDGCILQCESNPLDHLSY
Sbjct  141  STCKLANLTVRTELGCCLLHRRGKLTIDGCILQCESNPLDHLSY  184



>ref|NP_001242768.1| uncharacterized protein LOC100808414 [Glycine max]
 gb|ACU24216.1| unknown [Glycine max]
Length=227

 Score =   305 bits (781),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIF+FL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV++ S PG+FPN
Sbjct  26   INNLDDGCLMHIFNFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKELSEPGVFPN  85

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IETAVS++RPGDTILIA GG+HRV+NIQI+KPLCLIGAGE+PDDT L CSRGSDSALEFL
Sbjct  86   IETAVSASRPGDTILIAAGGTHRVANIQIRKPLCLIGAGEVPDDTTLVCSRGSDSALEFL  145

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTVRAELGCCLLHR GRLTIDGCILQCESNPLD+LS
Sbjct  146  STCKLANLTVRAELGCCLLHRKGRLTIDGCILQCESNPLDYLS  188



>ref|XP_006590332.1| PREDICTED: uncharacterized protein LOC100808414 isoform X1 [Glycine 
max]
Length=266

 Score =   306 bits (783),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIF+FL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV++ S PG+FPN
Sbjct  26   INNLDDGCLMHIFNFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKELSEPGVFPN  85

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IETAVS++RPGDTILIA GG+HRV+NIQI+KPLCLIGAGE+PDDT L CSRGSDSALEFL
Sbjct  86   IETAVSASRPGDTILIAAGGTHRVANIQIRKPLCLIGAGEVPDDTTLVCSRGSDSALEFL  145

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTVRAELGCCLLHR GRLTIDGCILQCESNPLD+LS
Sbjct  146  STCKLANLTVRAELGCCLLHRKGRLTIDGCILQCESNPLDYLS  188



>ref|XP_007148969.1| hypothetical protein PHAVU_005G029600g, partial [Phaseolus vulgaris]
 gb|ESW20963.1| hypothetical protein PHAVU_005G029600g, partial [Phaseolus vulgaris]
Length=303

 Score =   307 bits (786),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            I NLDDGCLMHIFSFL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV+DSS PG+FPN
Sbjct  64   ITNLDDGCLMHIFSFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDSSEPGVFPN  123

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IETAVS++RPGDTILIA GGSH V+NIQI+KPLCLIGAGE+PDDT L CSRGSDSALEF+
Sbjct  124  IETAVSASRPGDTILIAAGGSHHVANIQIRKPLCLIGAGELPDDTTLVCSRGSDSALEFI  183

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTVRAELGCCLLHR GRLTIDGCILQCESNPLD+LS
Sbjct  184  STCKLANLTVRAELGCCLLHRKGRLTIDGCILQCESNPLDYLS  226



>gb|EYU36858.1| hypothetical protein MIMGU_mgv1a022539mg [Erythranthe guttata]
Length=259

 Score =   303 bits (775),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  DINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFP  381
             IN LDDGCLM IFSFLSPIPDRYNTALVC RWRFLACHP+ WLRVDRSV++ + PG++P
Sbjct  25   QINRLDDGCLMLIFSFLSPIPDRYNTALVCRRWRFLACHPQHWLRVDRSVKELTEPGVYP  84

Query  382  NIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEF  561
            +IETAVS+ARPGDTILIA GG HR SNIQIKKPLCLIGAGEIPDDT L CSRGSDSALEF
Sbjct  85   SIETAVSAARPGDTILIAAGGIHRTSNIQIKKPLCLIGAGEIPDDTTLICSRGSDSALEF  144

Query  562  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS+
Sbjct  145  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSH  189



>gb|EYU42952.1| hypothetical protein MIMGU_mgv1a012165mg [Erythranthe guttata]
Length=259

 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  DINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFP  381
             IN LDDGCLM IFSFLSPIPDRYNTALVC RWRFLACHP+ WLRVDRSV++ + PG++P
Sbjct  25   QINRLDDGCLMLIFSFLSPIPDRYNTALVCRRWRFLACHPQHWLRVDRSVKELTEPGVYP  84

Query  382  NIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEF  561
            +IETAVS+ARPGDTILIA GG HR SNIQIKKPLCLIGAGEIPDDT L CSRGSDSALEF
Sbjct  85   SIETAVSAARPGDTILIAAGGIHRTSNIQIKKPLCLIGAGEIPDDTTLICSRGSDSALEF  144

Query  562  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS+
Sbjct  145  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSH  189



>gb|AAG21980.1| SKP1 interacting partner 5 [Arabidopsis thaliana]
Length=252

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  190  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  369
            YS   +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  8    YSLTSLNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  67

Query  370  GIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  549
            G+F NIE+AVS+ARPGDTILI  GG++RVSNIQIKKPLCL+G GEIPD+T L C+RGSDS
Sbjct  68   GVFLNIESAVSAARPGDTILIVAGGNYRVSNIQIKKPLCLVGGGEIPDETTLVCARGSDS  127

Query  550  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            ALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS
Sbjct  128  ALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLS  175



>ref|NP_566999.1| SKP1/ASK-interacting protein 5 [Arabidopsis thaliana]
 sp|Q94FT2.1|SKIP5_ARATH RecName: Full=F-box protein SKIP5; AltName: Full=SKP1-interacting 
partner 5 [Arabidopsis thaliana]
 gb|AAK61345.1|AF347972_1 SKP1-interacting partner 5 [Arabidopsis thaliana]
 gb|AAM61599.1| SKP1 interacting partner SKIP5 [Arabidopsis thaliana]
 gb|AAO64798.1| At3g54480 [Arabidopsis thaliana]
 dbj|BAE99457.1| SKP1-interacting partner 5 [Arabidopsis thaliana]
 gb|AEE79236.1| SKP1/ASK-interacting protein 5 [Arabidopsis thaliana]
Length=274

 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  190  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  369
            YS   +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  30   YSLTSLNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  89

Query  370  GIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  549
            G+F NIE+AVS+ARPGDTILI  GG++RVSNIQIKKPLCL+G GEIPD+T L C+RGSDS
Sbjct  90   GVFLNIESAVSAARPGDTILIVAGGNYRVSNIQIKKPLCLVGGGEIPDETTLVCARGSDS  149

Query  550  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            ALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS
Sbjct  150  ALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLS  197



>ref|XP_002269519.1| PREDICTED: F-box protein SKIP5 isoform X1 [Vitis vinifera]
 emb|CBI35143.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  208  NNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNI  387
            +NLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+DSS PG+FP+I
Sbjct  26   HNLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPRLWLRVDRSVKDSSEPGVFPSI  85

Query  388  ETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLS  567
            E AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PDDT L CSRGSDSALEFLS
Sbjct  86   EMAVSAARPGDTILIAAGGSHLASNIQIKKPLCLIGGGELPDDTTLLCSRGSDSALEFLS  145

Query  568  TCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            TCK+ANLTV+AELGCCLLHRSGRLTIDGCILQCESNPLD+LS
Sbjct  146  TCKVANLTVKAELGCCLLHRSGRLTIDGCILQCESNPLDYLS  187



>emb|CDP18131.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFL P PDRYNTALVCHRW FLACHPRLWLRVDRSV++ S PG+FP+
Sbjct  21   INNLDDGCLMHIFSFLCPKPDRYNTALVCHRWHFLACHPRLWLRVDRSVKNLSKPGVFPS  80

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IETAV++ARPGDTILIA GGSH  SNIQIKKPLCLIGAGE+PDDT L CSRG DSALEF 
Sbjct  81   IETAVAAARPGDTILIASGGSHLASNIQIKKPLCLIGAGELPDDTTLVCSRGFDSALEFS  140

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTVRAELGCCLLHRSGRL ID CILQCESNPLDHLSY
Sbjct  141  STCKLANLTVRAELGCCLLHRSGRLIIDSCILQCESNPLDHLSY  184



>gb|AFK33567.1| unknown [Lotus japonicus]
Length=268

 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  37   INNLDDGCLMHIFSFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLSQPGVFPN  96

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IETAVS++RPGDTILIA GGSH  SNIQIKKPLCLIGAGE+PDDT L CSRGSDSALE L
Sbjct  97   IETAVSASRPGDTILIAAGGSHHTSNIQIKKPLCLIGAGELPDDTTLICSRGSDSALELL  156

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHR GRLT+DGCILQCESNPLD LS
Sbjct  157  STCKLANLTVKAELGCCLLHRKGRLTVDGCILQCESNPLDFLS  199



>ref|XP_006403571.1| hypothetical protein EUTSA_v10010628mg [Eutrema salsugineum]
 gb|ESQ45024.1| hypothetical protein EUTSA_v10010628mg [Eutrema salsugineum]
Length=272

 Score =   301 bits (771),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG++P+
Sbjct  35   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTKPGVYPS  94

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILI  GG+HRVSNIQIKKPLCLIG GEIPD+T L CSRGSDSALE L
Sbjct  95   IEAAVSAARPGDTILIGAGGNHRVSNIQIKKPLCLIGGGEIPDETTLVCSRGSDSALELL  154

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS
Sbjct  155  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLS  197



>ref|XP_002877981.1| skp1-interacting partner 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54240.1| skp1-interacting partner 5 [Arabidopsis lyrata subsp. lyrata]
Length=274

 Score =   301 bits (770),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  190  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  369
            +S   INNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  30   HSLTSINNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  89

Query  370  GIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  549
            G+F NIE+AVS+ARPGDTILI  GG+HR SNIQIKKPLCL+G GEIPD+T L C+RGSDS
Sbjct  90   GVFHNIESAVSAARPGDTILIGAGGNHRASNIQIKKPLCLVGGGEIPDETTLVCARGSDS  149

Query  550  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            ALE LSTCKLANLTV+AELGCCLLHRSGR+TIDGC+LQCE+NPLDHLS
Sbjct  150  ALELLSTCKLANLTVKAELGCCLLHRSGRVTIDGCVLQCETNPLDHLS  197



>ref|XP_010427150.1| PREDICTED: F-box protein SKIP5 [Camelina sativa]
Length=273

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFL+PIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG+F N
Sbjct  37   LNNLDDGCLMHILSFLAPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTQPGVFRN  96

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  97   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLVGGGEIPDETTLICSRGSDSALELL  156

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLSY
Sbjct  157  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSY  200



>ref|XP_010067744.1| PREDICTED: F-box protein SKIP5 [Eucalyptus grandis]
 gb|KCW65929.1| hypothetical protein EUGRSUZ_G03245 [Eucalyptus grandis]
Length=257

 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSVRDSS PG+FPN
Sbjct  27   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVRDSSEPGVFPN  86

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PD+T+L CSRGSDSALEFL
Sbjct  87   IELAVSAARPGDTILIAAGGSHVASNIQIKKPLCLIGGGELPDETMLLCSRGSDSALEFL  146

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKL+NLTV+AELGCCLLHRSGRL IDGCILQCE++PLD+LS
Sbjct  147  STCKLSNLTVKAELGCCLLHRSGRLIIDGCILQCETDPLDYLS  189



>ref|XP_010504251.1| PREDICTED: F-box protein SKIP5-like [Camelina sativa]
Length=273

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFL+PIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG+F N
Sbjct  37   LNNLDDGCLMHILSFLAPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTQPGVFRN  96

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  97   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLVGGGEIPDETTLICSRGSDSALELL  156

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLSY
Sbjct  157  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSY  200



>ref|XP_010515975.1| PREDICTED: F-box protein SKIP5 [Camelina sativa]
Length=273

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFL+PIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG+F N
Sbjct  37   LNNLDDGCLMHILSFLAPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTQPGVFRN  96

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  97   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLVGGGEIPDETTLICSRGSDSALELL  156

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLSY
Sbjct  157  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSY  200



>ref|XP_009116131.1| PREDICTED: F-box protein SKIP5-like [Brassica rapa]
Length=270

 Score =   299 bits (765),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVD  V+D SLPG+F +
Sbjct  31   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDPFVKDLSLPGVFHS  90

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCLIG+GEIPD+T L CSRGSDSALE L
Sbjct  91   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLIGSGEIPDETTLVCSRGSDSALELL  150

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTVRAELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS
Sbjct  151  STCKLANLTVRAELGCCLLHRSGRLTIDGCVLQCETNPLDHLS  193



>gb|KHN21305.1| F-box protein SKIP5 [Glycine soja]
Length=275

 Score =   298 bits (764),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 8/171 (5%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIF+FL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV++ S PG+FPN
Sbjct  27   INNLDDGCLMHIFNFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKELSEPGVFPN  86

Query  385  IETAVSSAR--------PGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRG  540
            IETAVS++R        PGDTILIA GG+HRV+NIQI+KPLCLIGAGE+PDDT L CSRG
Sbjct  87   IETAVSASRHVELMLFVPGDTILIAAGGTHRVANIQIRKPLCLIGAGEVPDDTTLVCSRG  146

Query  541  SDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            SDSALEFLSTCKLANLTVRAELGCCLLHR GRLTIDGCILQCESNPLD+LS
Sbjct  147  SDSALEFLSTCKLANLTVRAELGCCLLHRKGRLTIDGCILQCESNPLDYLS  197



>ref|XP_006292685.1| hypothetical protein CARUB_v10018930mg [Capsella rubella]
 gb|EOA25583.1| hypothetical protein CARUB_v10018930mg [Capsella rubella]
Length=271

 Score =   298 bits (764),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR  +D + PG+F N
Sbjct  35   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFAKDLTQPGVFHN  94

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AV++ARPGDTILI  GG+H VSNIQIKKPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  95   IESAVAAARPGDTILIGAGGNHHVSNIQIKKPLCLVGGGEIPDETTLICSRGSDSALELL  154

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLSY
Sbjct  155  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLSY  198



>emb|CDX78238.1| BnaA09g34330D [Brassica napus]
Length=270

 Score =   298 bits (763),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVD  V+D SLPG+F +
Sbjct  31   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDPFVKDLSLPGVFHS  90

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCLIG+GEIPD+T L CSRGSDSALE L
Sbjct  91   IESAVSAARPGDTILIGAGGNHHVSNIQIKKPLCLIGSGEIPDETTLVCSRGSDSALELL  150

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS
Sbjct  151  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLS  193



>gb|KFK34691.1| hypothetical protein AALP_AA5G179200 [Arabis alpina]
Length=269

 Score =   298 bits (763),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +++LDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D SLPG+F N
Sbjct  32   LHDLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDPSLPGVFRN  91

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AVS+ARPGDTILI  GGSH VSNIQI+KPLCL+G GEIPD+T L CSRGSDSALE L
Sbjct  92   IESAVSAARPGDTILIGAGGSHHVSNIQIEKPLCLVGGGEIPDETTLVCSRGSDSALELL  151

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE+NPLDHLS
Sbjct  152  STCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCETNPLDHLS  194



>ref|XP_006420750.1| hypothetical protein CICLE_v10005678mg [Citrus clementina]
 gb|ESR33990.1| hypothetical protein CICLE_v10005678mg [Citrus clementina]
Length=258

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMH+FSFLSPIPDRYNTALVCHRW +LACHPRLWLRVD+SV+D S PG+FP+
Sbjct  30   INNLDDGCLMHVFSFLSPIPDRYNTALVCHRWNYLACHPRLWLRVDQSVKDLSEPGVFPD  89

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            ++TAVS ARPGDTILIA GGSH VSNIQIKK LCL+G GE+PD+T L CSRGSDSALEFL
Sbjct  90   LKTAVSVARPGDTILIAAGGSHPVSNIQIKKQLCLVGGGELPDETTLICSRGSDSALEFL  149

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTVRAELGCCLLHRSGRLTIDGC+LQCE+NPLD LS
Sbjct  150  STCKLANLTVRAELGCCLLHRSGRLTIDGCVLQCETNPLDFLS  192



>ref|XP_002513076.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49579.1| conserved hypothetical protein [Ricinus communis]
Length=250

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW FLACHPRLWLRVDRS++D+S PG+FP+
Sbjct  21   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWHFLACHPRLWLRVDRSIKDTSQPGVFPS  80

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILI+ GGSH  SNIQI KPLCLIG GE+PD+T+L CSRGSDSALEFL
Sbjct  81   IEMAVSAARPGDTILISAGGSHLASNIQINKPLCLIGGGELPDETMLLCSRGSDSALEFL  140

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSG+LTID C+LQCES+PLD+LS
Sbjct  141  STCKLANLTVKAELGCCLLHRSGKLTIDSCVLQCESDPLDYLS  183



>emb|CDX76144.1| BnaA04g04080D [Brassica napus]
Length=271

 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S PG+F +
Sbjct  31   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQPGVFHD  90

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCLIG GE PD+T L CSRGSDSALE L
Sbjct  91   IESAVSAARPGDTILIGAGGNHLVSNIQIKKPLCLIGGGETPDETTLVCSRGSDSALELL  150

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSGR+TIDGC+LQCE+NPLDHLS
Sbjct  151  STCKLANLTVKAELGCCLLHRSGRVTIDGCVLQCETNPLDHLS  193



>gb|EPS72918.1| hypothetical protein M569_01839, partial [Genlisea aurea]
Length=246

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            I +LDDGCLM IFSFLSPIPDRYNTALVC RWRFLACHPRLWLRVDRSV+DSS PG++P 
Sbjct  12   IKDLDDGCLMLIFSFLSPIPDRYNTALVCRRWRFLACHPRLWLRVDRSVKDSSFPGVYPT  71

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AV +ARPGDTILIA GG H+ S+IQIKKPLCLIGAGE+PD+T L CS GS+SALEF+
Sbjct  72   IEDAVVAARPGDTILIAAGGVHQASDIQIKKPLCLIGAGELPDETTLVCSNGSESALEFM  131

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCKLANLTV AELGCCLLHRSGRLT+DGC+LQCESNPLDHLS+
Sbjct  132  STCKLANLTVIAELGCCLLHRSGRLTVDGCVLQCESNPLDHLSH  175



>gb|KJB74631.1| hypothetical protein B456_012G017000 [Gossypium raimondii]
Length=252

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  24   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVQDFSEPGVFPN  83

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PD+T + C RGSDSALEFL
Sbjct  84   IEEAVSAARPGDTILIAAGGSHLASNIQIKKPLCLIGGGELPDETTVICLRGSDSALEFL  143

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKL NLTV+AELGCCLLHRSGRL ID CILQCESNPLD+LS
Sbjct  144  STCKLTNLTVKAELGCCLLHRSGRLIIDECILQCESNPLDYLS  186



>gb|KDP40515.1| hypothetical protein JCGZ_24514 [Jatropha curcas]
Length=252

 Score =   293 bits (750),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDR+V+D S PG++P+
Sbjct  23   INTLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPRLWLRVDRAVKDLSEPGVYPS  82

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILI+ GG+H  SNIQI KPLCLIG GE+PD T L CSRGSDSALEFL
Sbjct  83   IEMAVSAARPGDTILISAGGNHVASNIQINKPLCLIGGGELPDQTTLLCSRGSDSALEFL  142

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+ ELGCCLLHRSGRLTIDGCILQCESNPLD+LS
Sbjct  143  STCKLANLTVKTELGCCLLHRSGRLTIDGCILQCESNPLDYLS  185



>ref|XP_010095957.1| hypothetical protein L484_023946 [Morus notabilis]
 gb|EXB62650.1| hypothetical protein L484_023946 [Morus notabilis]
Length=258

 Score =   293 bits (749),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDG LMHIFSFLSPIPDRYNTALVCHRW++LACHPRLWLRVDRSV D S PG FP+
Sbjct  29   INNLDDGSLMHIFSFLSPIPDRYNTALVCHRWKYLACHPRLWLRVDRSVTDLSEPGAFPS  88

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IETAV++AR GDTILIA GG H  SNIQIKKPLCLIG GE+PD+T L CSRGSDSALEFL
Sbjct  89   IETAVAAARAGDTILIAAGGKHLASNIQIKKPLCLIGGGELPDETTLICSRGSDSALEFL  148

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSGRLTID C+LQCESNPLD LS
Sbjct  149  STCKLANLTVKAELGCCLLHRSGRLTIDDCVLQCESNPLDFLS  191



>ref|XP_008813420.1| PREDICTED: F-box protein SKIP5 [Phoenix dactylifera]
Length=258

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++ +++ + PG+F N
Sbjct  23   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEKPMKNIAEPGVFIN  82

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E A+S+ARPGDTILIA GG H  SNIQI+KPLC++G GEIPDDTILTCSRGSDSALEFL
Sbjct  83   LEAAISAARPGDTILIAAGGDHVASNIQIQKPLCIMGGGEIPDDTILTCSRGSDSALEFL  142

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCK+ANLT+RAELGCCLLHRSG+LTI+GCILQCE NPLDHLS+
Sbjct  143  STCKVANLTIRAELGCCLLHRSGKLTIEGCILQCEENPLDHLSF  186



>ref|XP_009139236.1| PREDICTED: F-box protein SKIP5-like isoform X2 [Brassica rapa]
Length=292

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHP LWLRVDR V+D S PG+F +
Sbjct  54   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPLLWLRVDRFVKDLSQPGVFHD  113

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCLIG GE PD+T L CSRGSDSALE L
Sbjct  114  IESAVSAARPGDTILIGAGGNHLVSNIQIKKPLCLIGGGETPDETTLVCSRGSDSALELL  173

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSGR+TIDGC+LQCE+NPLDHLS
Sbjct  174  STCKLANLTVKAELGCCLLHRSGRVTIDGCVLQCETNPLDHLS  216



>ref|XP_006658920.1| PREDICTED: F-box protein SKIP5-like [Oryza brachyantha]
Length=245

 Score =   290 bits (742),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +R+   PG++PN
Sbjct  17   VNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRNIIEPGVYPN  76

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E AVS+ARPGDTILIA GG+H   NIQIKKPLC+IG GE+PDDT+LTCSRGSD+ALEFL
Sbjct  77   LEAAVSAARPGDTILIAAGGTHVACNIQIKKPLCIIGGGELPDDTVLTCSRGSDNALEFL  136

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCK+ NLT+RAELGCCLLHRSGRLTI+ C+LQCE NPLD+LS+
Sbjct  137  STCKIVNLTIRAELGCCLLHRSGRLTIEECLLQCEQNPLDYLSF  180



>ref|XP_008348371.1| PREDICTED: F-box protein SKIP5 isoform X1 [Malus domestica]
Length=263

 Score =   290 bits (743),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D   PG+FPN
Sbjct  34   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWLYLACHPRLWLRVDRSVKDXLEPGVFPN  93

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +ETAV +ARPGDTILIA GG H   NIQIKK LCLIGAGE PD+T + CSRGSDSALE L
Sbjct  94   LETAVEAARPGDTILIAAGGRHLAYNIQIKKRLCLIGAGEQPDETTIYCSRGSDSALELL  153

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSGR+TI+GC+LQCE+NPLDHLS
Sbjct  154  STCKLANLTVKAELGCCLLHRSGRVTIEGCVLQCETNPLDHLS  196



>ref|XP_004307123.1| PREDICTED: F-box protein SKIP5 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=261

 Score =   290 bits (743),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRW FLACHPRLWLRV+RS++D   PG+FP+
Sbjct  32   INKLDDGCLMHIFSFLSPIPDRYNTALVCHRWLFLACHPRLWLRVERSIKDPLEPGVFPS  91

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IETAV++ARPGDTILI+ GG H  S+IQIKKPLCLIG GE+PD+T L CSRG+DSALEFL
Sbjct  92   IETAVAAARPGDTILISAGGRHLASDIQIKKPLCLIGGGELPDETTLICSRGADSALEFL  151

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+ ELGCCLLHRSGRLTIDGC+LQCESNPLD LS
Sbjct  152  STCKLANLTVKTELGCCLLHRSGRLTIDGCVLQCESNPLDFLS  194



>ref|XP_007011111.1| SKP1/ASK-interacting protein 5 isoform 1 [Theobroma cacao]
 gb|EOY19921.1| SKP1/ASK-interacting protein 5 isoform 1 [Theobroma cacao]
Length=263

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN+LDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHP+LWLRVDRS++D S PG+FPN
Sbjct  34   INSLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPQLWLRVDRSLKDFSEPGVFPN  93

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GGSH  SNIQI+KPLCLIG GE+PD+T L C RGSDSALEFL
Sbjct  94   IEEAVSAARPGDTILIAAGGSHLASNIQIRKPLCLIGGGELPDETTLLCLRGSDSALEFL  153

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKL NLTV+AELGCCLLHRSGRL ID CILQCESNPLD+LS
Sbjct  154  STCKLTNLTVKAELGCCLLHRSGRLIIDECILQCESNPLDYLS  196



>ref|XP_004958577.1| PREDICTED: F-box protein SKIP5-like [Setaria italica]
Length=253

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +RD   PG++PN
Sbjct  19   VNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRDVMEPGVYPN  78

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E AVS+ARPGDTIL+A GG+H   NIQIKK +C+IG GE+PDDT+LTCSRGSD+ALEFL
Sbjct  79   LEAAVSAARPGDTILVAAGGTHVACNIQIKKTICIIGGGELPDDTVLTCSRGSDNALEFL  138

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCK+ANLT+RAELGCCLLHRSGRLTI  C+LQCE NPLD+LS+
Sbjct  139  STCKIANLTIRAELGCCLLHRSGRLTIQECLLQCEQNPLDYLSF  182



>ref|XP_010938589.1| PREDICTED: F-box protein SKIP5 [Elaeis guineensis]
Length=258

 Score =   289 bits (739),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLM IFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV+R +++   PG+FPN
Sbjct  24   INNLDDGCLMQIFSFLSPIPDRYNTALVCHRWHYLACHPRLWLRVERPMKNIE-PGVFPN  82

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E A+S+ARPGDTILIA GG+H  SNIQI+KPLC++G GE+PDDTILTCSRGSDSALEFL
Sbjct  83   VEAAISAARPGDTILIAAGGNHVASNIQIQKPLCIMGGGELPDDTILTCSRGSDSALEFL  142

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCK+ANLT+RAELGCCLLHRSG+LTI+GCILQCE NPLD+LS+
Sbjct  143  STCKVANLTIRAELGCCLLHRSGKLTIEGCILQCEENPLDYLSF  186



>ref|XP_002461155.1| hypothetical protein SORBIDRAFT_02g041860 [Sorghum bicolor]
 gb|EER97676.1| hypothetical protein SORBIDRAFT_02g041860 [Sorghum bicolor]
Length=248

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +RD   PG++PN
Sbjct  20   MNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRDVMEPGVYPN  79

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E AVS+ARPGDTILIA GGSH   NIQIKKP+C+IG G++PDDT+LTCSRG D+ALEFL
Sbjct  80   LEAAVSAARPGDTILIAAGGSHVACNIQIKKPICIIGGGDLPDDTVLTCSRGFDNALEFL  139

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCK+ANLT+RAELGCCLLHRSG+LTI  C+LQCE NPLD+LS+
Sbjct  140  STCKIANLTIRAELGCCLLHRSGKLTIQECLLQCEQNPLDYLSF  183



>ref|XP_008653434.1| PREDICTED: F-box protein SKIP5 [Zea mays]
 tpg|DAA63987.1| TPA: hypothetical protein ZEAMMB73_319872 [Zea mays]
Length=254

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +1

Query  169  EAAPYYCYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRS  348
            E AP        +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R 
Sbjct  8    ELAPVVEELISPMNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERP  67

Query  349  VRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILT  528
            +RD+  PG++P++E AVS+ARPGDTILIA GGSH   NIQIKKP+C+IG G++PDDT+LT
Sbjct  68   IRDAMEPGVYPDLEAAVSAARPGDTILIAAGGSHVACNIQIKKPICIIGGGDLPDDTVLT  127

Query  529  CSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            CSRG D+ALEFLSTCK+ANLT+RAELGCCLLHR GRLTI  C+LQCE NPLDHLS+
Sbjct  128  CSRGFDNALEFLSTCKIANLTIRAELGCCLLHRGGRLTIQECLLQCEQNPLDHLSF  183



>ref|XP_010999613.1| PREDICTED: F-box protein SKIP5-like isoform X1 [Populus euphratica]
 ref|XP_010999615.1| PREDICTED: F-box protein SKIP5-like isoform X1 [Populus euphratica]
Length=251

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++S +D S PG+FP+
Sbjct  22   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEQSAKDLSEPGVFPS  81

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GG H  SNIQI KPLCLIG GE+PD+T L CSRGSDSALEF+
Sbjct  82   IEKAVSAARPGDTILIAAGGRHLASNIQINKPLCLIGGGELPDETTLLCSRGSDSALEFI  141

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLH+SGRLTID CILQCE++PLD+LS
Sbjct  142  STCKLANLTVKAELGCCLLHKSGRLTIDSCILQCEASPLDYLS  184



>ref|XP_011000542.1| PREDICTED: F-box protein SKIP5-like [Populus euphratica]
Length=251

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++S +D S PG+FP+
Sbjct  22   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEQSAKDLSEPGVFPS  81

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GG H  SNIQI KPLCLIG GE+PD+T L CSRGSDSALEF+
Sbjct  82   IEKAVSAARPGDTILIAAGGRHLASNIQINKPLCLIGGGELPDETTLLCSRGSDSALEFI  141

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLH+SGRLTID CILQCE++PLD+LS
Sbjct  142  STCKLANLTVKAELGCCLLHKSGRLTIDSCILQCEASPLDYLS  184



>ref|XP_010999614.1| PREDICTED: F-box protein SKIP5-like isoform X2 [Populus euphratica]
Length=268

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++S +D S PG+FP+
Sbjct  39   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEQSAKDLSEPGVFPS  98

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GG H  SNIQI KPLCLIG GE+PD+T L CSRGSDSALEF+
Sbjct  99   IEKAVSAARPGDTILIAAGGRHLASNIQINKPLCLIGGGELPDETTLLCSRGSDSALEFI  158

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLH+SGRLTID CILQCE++PLD+LS
Sbjct  159  STCKLANLTVKAELGCCLLHKSGRLTIDSCILQCEASPLDYLS  201



>ref|XP_009354454.1| PREDICTED: F-box protein SKIP5 isoform X1 [Pyrus x bretschneideri]
Length=263

 Score =   286 bits (733),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRS +D   PG+FPN
Sbjct  34   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWLYLACHPRLWLRVDRSAKDLLEPGVFPN  93

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +ETAV +ARPGDTILI+ GG H   NIQIKK LCLIGAGE PD+T + CSRGSDSALE L
Sbjct  94   LETAVEAARPGDTILISAGGRHLAYNIQIKKRLCLIGAGEQPDETTIYCSRGSDSALELL  153

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            STCKLANLTV+AELGCCLLHRSGR+TI+GC+LQCE+NPLDHLS
Sbjct  154  STCKLANLTVKAELGCCLLHRSGRVTIEGCVLQCETNPLDHLS  196



>ref|XP_002299213.2| SKP1-INTERACTING PARTNER 5 family protein [Populus trichocarpa]
 gb|EEE84018.2| SKP1-INTERACTING PARTNER 5 family protein [Populus trichocarpa]
Length=251

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRV++S +D S PG+FP+
Sbjct  22   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVEQSAKDLSEPGVFPS  81

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GG H  SNIQI KPLCLIG GE+PD+T L CSRGSDSALEF+
Sbjct  82   IEKAVSAARPGDTILIAAGGRHLASNIQINKPLCLIGGGELPDETTLLCSRGSDSALEFI  141

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            +TCKLANLTV+AELGCCLLHRSGRLTID CILQCE++PLD+LS
Sbjct  142  NTCKLANLTVKAELGCCLLHRSGRLTIDSCILQCEASPLDYLS  184



>ref|XP_007218829.1| hypothetical protein PRUPE_ppa010167mg [Prunus persica]
 gb|EMJ20028.1| hypothetical protein PRUPE_ppa010167mg [Prunus persica]
Length=261

 Score =   285 bits (729),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDS-SLPGIFP  381
            INNLDDGCLMHIFSFL PIPDRYNTALVCHRW FLACHPRLWLRV+RSV+D    PG+FP
Sbjct  31   INNLDDGCLMHIFSFLPPIPDRYNTALVCHRWLFLACHPRLWLRVERSVKDRLEEPGVFP  90

Query  382  NIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEF  561
            +IETAV++ARPGDTILIA GG H  SNIQIKK LCLIG GE+PD+T L CSR SDSALE 
Sbjct  91   DIETAVAAARPGDTILIAAGGRHLASNIQIKKRLCLIGGGELPDETTLFCSRASDSALEL  150

Query  562  LSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            LSTCKLANLTV+AELGCCLLHR+GRLTI+GC+LQCESNPLDHLS
Sbjct  151  LSTCKLANLTVKAELGCCLLHRNGRLTIEGCVLQCESNPLDHLS  194



>gb|KJB74633.1| hypothetical protein B456_012G017000 [Gossypium raimondii]
Length=259

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 148/170 (87%), Gaps = 7/170 (4%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  24   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVQDFSEPGVFPN  83

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS-----  549
            IE AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PD+T + C RGSD      
Sbjct  84   IEEAVSAARPGDTILIAAGGSHLASNIQIKKPLCLIGGGELPDETTVICLRGSDRFANFL  143

Query  550  --ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
              ALEFLSTCKL NLTV+AELGCCLLHRSGRL ID CILQCESNPLD+LS
Sbjct  144  TIALEFLSTCKLTNLTVKAELGCCLLHRSGRLIIDECILQCESNPLDYLS  193



>ref|XP_010670456.1| PREDICTED: F-box protein SKIP5 [Beta vulgaris subsp. vulgaris]
Length=278

 Score =   284 bits (727),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDR+++D S PG+F +
Sbjct  47   INTLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRTIKDLSEPGVFSS  106

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            I+ AVS+A+PGDTILIA GG H  SNIQIKKPLCLIGAGE+P++T L CSRGSDSALE+ 
Sbjct  107  IDAAVSAAQPGDTILIAAGGVHITSNIQIKKPLCLIGAGELPEETTLLCSRGSDSALEYF  166

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            ST K+ANLTV+AELGCCLLHRSGRL ID CILQCE++PLD+LS
Sbjct  167  STSKIANLTVKAELGCCLLHRSGRLIIDSCILQCETDPLDYLS  209



>ref|XP_003559852.1| PREDICTED: F-box protein SKIP5 [Brachypodium distachyon]
Length=248

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +1

Query  208  NNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNI  387
            N LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +R+ + PG++ N+
Sbjct  21   NGLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPLRNVTEPGVYANL  80

Query  388  ETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLS  567
            E AVS+ARPGDTILIA GG++  SNIQIKKPLC+IG+G +PDDT+LTCSRGS++ALE LS
Sbjct  81   EAAVSAARPGDTILIAAGGNYVASNIQIKKPLCIIGSGVLPDDTVLTCSRGSENALELLS  140

Query  568  TCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            TCK+ANLT+RAELGCCLLHRSG+LTI+ C+LQCE NP+D+LS+
Sbjct  141  TCKIANLTIRAELGCCLLHRSGKLTIEECLLQCEQNPMDYLSF  183



>gb|EEE67747.1| hypothetical protein OsJ_25443 [Oryza sativa Japonica Group]
Length=586

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +R++  PG++PN
Sbjct  18   VNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRNTIEPGVYPN  77

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E+AVS+ARPGDTILIA GG+H   NIQIKKPLC+IG GE+PDDT+LTCSRGSD+ALEF 
Sbjct  78   LESAVSAARPGDTILIAAGGTHVARNIQIKKPLCIIGGGELPDDTVLTCSRGSDNALEFH  137

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCK+ANLT+RAELGCCLLHRSGRLTI+ C+LQCE NPLD+LS+
Sbjct  138  STCKIANLTIRAELGCCLLHRSGRLTIEECLLQCEQNPLDYLSF  181



>ref|XP_004142419.1| PREDICTED: F-box protein SKIP5-like [Cucumis sativus]
 gb|KGN52308.1| hypothetical protein Csa_5G623720 [Cucumis sativus]
Length=272

 Score =   281 bits (718),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  214  LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIET  393
            LDDGCLMHIFSFLSPIPDRYNTALVCHRWR+LACHPRLWLRV+RS++D S PG+FP IE 
Sbjct  44   LDDGCLMHIFSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVERSIKDLSEPGVFPTIEA  103

Query  394  AVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTC  573
            AV++ARPGDTILIA GG H  SNIQI KPLCLIG GE+P++T L C+RGS+SALEFLST 
Sbjct  104  AVAAARPGDTILIATGGVHSASNIQITKPLCLIGGGELPEETTLFCTRGSESALEFLSTS  163

Query  574  KLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            KL+NLTV+AELGCCLLHR GRL +DGC+LQCESNPLD+LS
Sbjct  164  KLSNLTVKAELGCCLLHRKGRLIVDGCVLQCESNPLDYLS  203



>ref|XP_008446937.1| PREDICTED: F-box protein SKIP5 isoform X1 [Cucumis melo]
Length=272

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  214  LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIET  393
            LDDGCLMHIFSFLSPIPDRYNTALVCHRWR+LACHPRLWLRV+R+++D S PG+FP IE 
Sbjct  44   LDDGCLMHIFSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVERTIKDLSEPGVFPTIEA  103

Query  394  AVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTC  573
            AV++ARPGDTILIA GG H  SNIQI KPLCLIG GE+P++T L C+RGS+SALEFLST 
Sbjct  104  AVAAARPGDTILIATGGVHSASNIQITKPLCLIGGGELPEETTLFCTRGSESALEFLSTS  163

Query  574  KLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            KL+NLTV+AELGCCLLHR GRL +DGC+LQCESNPLD+LS
Sbjct  164  KLSNLTVKAELGCCLLHRKGRLIVDGCVLQCESNPLDYLS  203



>gb|KJB74634.1| hypothetical protein B456_012G017000 [Gossypium raimondii]
Length=279

 Score =   278 bits (712),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 149/190 (78%), Gaps = 27/190 (14%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  24   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVQDFSEPGVFPN  83

Query  385  IETAVSSAR---------------------------PGDTILIAGGGSHRVSNIQIKKPL  483
            IE AVS+AR                           PGDTILIA GGSH  SNIQIKKPL
Sbjct  84   IEEAVSAARYIKLLLICGLGLYGILLRPYLQTLPFRPGDTILIAAGGSHLASNIQIKKPL  143

Query  484  CLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQ  663
            CLIG GE+PD+T + C RGSDSALEFLSTCKL NLTV+AELGCCLLHRSGRL ID CILQ
Sbjct  144  CLIGGGELPDETTVICLRGSDSALEFLSTCKLTNLTVKAELGCCLLHRSGRLIIDECILQ  203

Query  664  CESNPLDHLS  693
            CESNPLD+LS
Sbjct  204  CESNPLDYLS  213



>gb|EEC82615.1| hypothetical protein OsI_27192 [Oryza sativa Indica Group]
Length=184

 Score =   270 bits (691),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +R++  PG++PN
Sbjct  18   VNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRNTIEPGVYPN  77

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E+AVS+ARPGDTILIA GG+H   NIQIKKPLC+IG GE+PDDT+LTCSRGSD+ALEFL
Sbjct  78   LESAVSAARPGDTILIAAGGTHVARNIQIKKPLCIIGGGELPDDTVLTCSRGSDNALEFL  137

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESN  675
            STCK+ANLT+RAELGCCLLHRSGRLTI+ C+L   + 
Sbjct  138  STCKIANLTIRAELGCCLLHRSGRLTIEECLLPVRAK  174



>ref|XP_009387040.1| PREDICTED: F-box protein SKIP5 [Musa acuminata subsp. malaccensis]
Length=279

 Score =   273 bits (697),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            I++LDDGCLMHIFSFL+PIPDRY+ ALVCHRWR L CHPRLWLRV+ S+R+   PG+FPN
Sbjct  50   IHSLDDGCLMHIFSFLTPIPDRYSIALVCHRWRCLVCHPRLWLRVENSIRNMGEPGVFPN  109

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E A+S+ARPGDTILIA G  H   NIQIKKPLCLIG GE PDDT+LTCSRGS+SALEFL
Sbjct  110  LEAAISAARPGDTILIAPGLDHVACNIQIKKPLCLIGGGEHPDDTVLTCSRGSESALEFL  169

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            STCK+ NL +RAELGCCLLHRSGRLTI+GCILQCE NPLD+LS+
Sbjct  170  STCKITNLMIRAELGCCLLHRSGRLTIEGCILQCEENPLDYLSF  213



>ref|XP_006830359.1| hypothetical protein AMTR_s00116p00090490 [Amborella trichopoda]
 gb|ERM97775.1| hypothetical protein AMTR_s00116p00090490 [Amborella trichopoda]
Length=248

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = +1

Query  184  YCYSRHD-INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDS  360
            YC S    +N LDDGCLMHIF+ LSPIPDRYNTALVC RWRFLACHPRLWLRV+ SV+  
Sbjct  12   YCSSSSAPVNALDDGCLMHIFALLSPIPDRYNTALVCRRWRFLACHPRLWLRVEGSVKSQ  71

Query  361  SLPGIFPNIETAVSSARPGDTILI-AGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSR  537
            S PG+FPN+++A+ +ARPGDTILI AG   H  +NIQIKKPLCL+G G++PDDTIL  SR
Sbjct  72   SDPGVFPNLDSAILAARPGDTILISAGEEEHVATNIQIKKPLCLMGGGDLPDDTILVSSR  131

Query  538  GSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            GSDSALEFLSTCK++NLTVR+ELGCCLLHRSGRLT++GCILQC  +PLDHLS
Sbjct  132  GSDSALEFLSTCKVSNLTVRSELGCCLLHRSGRLTVEGCILQCIEHPLDHLS  183



>ref|XP_011469379.1| PREDICTED: F-box protein SKIP5 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=306

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 149/208 (72%), Gaps = 45/208 (22%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN LDDGCLMHIFSFLSPIPDRYNTALVCHRW FLACHPRLWLRV+RS++D   PG+FP+
Sbjct  32   INKLDDGCLMHIFSFLSPIPDRYNTALVCHRWLFLACHPRLWLRVERSIKDPLEPGVFPS  91

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCL-------------------------  489
            IETAV++ARPGDTILI+ GG H  S+IQIKKPLCL                         
Sbjct  92   IETAVAAARPGDTILISAGGRHLASDIQIKKPLCLVCLNVIKTIFACMHLSSSPLLGLNV  151

Query  490  --------------------IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELG  609
                                IG GE+PD+T L CSRG+DSALEFLSTCKLANLTV+ ELG
Sbjct  152  SSPIPWSKPSYEDKLIYFVQIGGGELPDETTLICSRGADSALEFLSTCKLANLTVKTELG  211

Query  610  CCLLHRSGRLTIDGCILQCESNPLDHLS  693
            CCLLHRSGRLTIDGC+LQCESNPLD LS
Sbjct  212  CCLLHRSGRLTIDGCVLQCESNPLDFLS  239



>ref|XP_010659170.1| PREDICTED: F-box protein SKIP5 isoform X2 [Vitis vinifera]
Length=236

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  265  DRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGG  444
            DRYNTALVCHRW +LACHPRLWLRVDRSV+DSS PG+FP+IE AVS+ARPGDTILIA GG
Sbjct  27   DRYNTALVCHRWHYLACHPRLWLRVDRSVKDSSEPGVFPSIEMAVSAARPGDTILIAAGG  86

Query  445  SHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLH  624
            SH  SNIQIKKPLCLIG GE+PDDT L CSRGSDSALEFLSTCK+ANLTV+AELGCCLLH
Sbjct  87   SHLASNIQIKKPLCLIGGGELPDDTTLLCSRGSDSALEFLSTCKVANLTVKAELGCCLLH  146

Query  625  RSGRLTIDGCILQCESNPLDHLS  693
            RSGRLTIDGCILQCESNPLD+LS
Sbjct  147  RSGRLTIDGCILQCESNPLDYLS  169



>ref|XP_008446939.1| PREDICTED: F-box protein SKIP5 isoform X2 [Cucumis melo]
Length=233

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  244  SFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDT  423
            +F     DRYNTALVCHRWR+LACHPRLWLRV+R+++D S PG+FP IE AV++ARPGDT
Sbjct  15   TFAIEFADRYNTALVCHRWRYLACHPRLWLRVERTIKDLSEPGVFPTIEAAVAAARPGDT  74

Query  424  ILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAE  603
            ILIA GG H  SNIQI KPLCLIG GE+P++T L C+RGS+SALEFLST KL+NLTV+AE
Sbjct  75   ILIATGGVHSASNIQITKPLCLIGGGELPEETTLFCTRGSESALEFLSTSKLSNLTVKAE  134

Query  604  LGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            LGCCLLHR GRL +DGC+LQCESNPLD+LS
Sbjct  135  LGCCLLHRKGRLIVDGCVLQCESNPLDYLS  164



>emb|CAB77568.1| putative protein [Arabidopsis thaliana]
Length=262

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 129/182 (71%), Gaps = 40/182 (22%)
 Frame = +1

Query  190  YSRHDINNLDDGCLMHIFSFLSPIP--------------DRYNTALVCHRWRFLACHPRL  327
            YS   +NNLDDGCLMHI SFLSPIP              DRYNTALVCHRWR+LACHPRL
Sbjct  30   YSLTSLNNLDDGCLMHILSFLSPIPVCFNAVLCISCEFADRYNTALVCHRWRYLACHPRL  89

Query  328  WLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEI  507
            WLRVDR V+D S PG+F NIE+AVS+ARPGDTILI  GG++RVSNIQIKKPLCL+G GEI
Sbjct  90   WLRVDRFVKDLSQPGVFLNIESAVSAARPGDTILIVAGGNYRVSNIQIKKPLCLVGGGEI  149

Query  508  PDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDH  687
            PD+T L C+RGSD                          RSGRLTIDGC+LQCE+NPLDH
Sbjct  150  PDETTLVCARGSD--------------------------RSGRLTIDGCVLQCETNPLDH  183

Query  688  LS  693
            LS
Sbjct  184  LS  185



>ref|NP_001060527.1| Os07g0659700 [Oryza sativa Japonica Group]
 dbj|BAF22441.1| Os07g0659700, partial [Oryza sativa Japonica Group]
Length=272

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  295  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  474
            RWRFLACHPRLWLRV+R +R++  PG++PN+E+AVS+ARPGDTILIA GG+H   NIQIK
Sbjct  74   RWRFLACHPRLWLRVERPIRNTIEPGVYPNLESAVSAARPGDTILIAAGGTHVARNIQIK  133

Query  475  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  654
            KPLC+IG GE+PDDT+LTCSRGSD+ALEF STCK+ANLT+RAELGCCLLHRSGRLTI+ C
Sbjct  134  KPLCIIGGGELPDDTVLTCSRGSDNALEFHSTCKIANLTIRAELGCCLLHRSGRLTIEEC  193

Query  655  ILQCESNPLDHLSY  696
            +LQCE NPLD+LS+
Sbjct  194  LLQCEQNPLDYLSF  207



>ref|XP_008348378.1| PREDICTED: F-box protein SKIP5 isoform X2 [Malus domestica]
Length=213

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  295  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  474
            RW +LACHPRLWLRVDRSV+D   PG+FPN+ETAV +ARPGDTILIA GG H   NIQIK
Sbjct  14   RWLYLACHPRLWLRVDRSVKDXLEPGVFPNLETAVEAARPGDTILIAAGGRHLAYNIQIK  73

Query  475  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  654
            K LCLIGAGE PD+T + CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGR+TI+GC
Sbjct  74   KRLCLIGAGEQPDETTIYCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRVTIEGC  133

Query  655  ILQCESNPLDHLS  693
            +LQCE+NPLDHLS
Sbjct  134  VLQCETNPLDHLS  146



>dbj|BAJ85981.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=268

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  295  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  474
            RWRFLACHPRLWLRV+R +RD   PG++PN+E A+S+ARPGDTILIA GG++   NIQIK
Sbjct  64   RWRFLACHPRLWLRVERPLRDVKEPGVYPNLEAAISAARPGDTILIAAGGTYLACNIQIK  123

Query  475  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  654
            KPLC+IG GE+PDDT+LTCSRGSD+ALEFLSTCK+ANLT++AELGCCLLHRSG+LTI  C
Sbjct  124  KPLCIIGGGELPDDTVLTCSRGSDNALEFLSTCKIANLTIKAELGCCLLHRSGKLTIQEC  183

Query  655  ILQCESNPLDHLSY  696
            +LQCE NPLD+LS+
Sbjct  184  LLQCEPNPLDYLSF  197



>ref|XP_010999616.1| PREDICTED: F-box protein SKIP5-like isoform X3 [Populus euphratica]
Length=222

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  295  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  474
            RW +LACHPRLWLRV++S +D S PG+FP+IE AVS+ARPGDTILIA GG H  SNIQI 
Sbjct  23   RWCYLACHPRLWLRVEQSAKDLSEPGVFPSIEKAVSAARPGDTILIAAGGRHLASNIQIN  82

Query  475  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  654
            KPLCLIG GE+PD+T L CSRGSDSALEF+STCKLANLTV+AELGCCLLH+SGRLTID C
Sbjct  83   KPLCLIGGGELPDETTLLCSRGSDSALEFISTCKLANLTVKAELGCCLLHKSGRLTIDSC  142

Query  655  ILQCESNPLDHLS  693
            ILQCE++PLD+LS
Sbjct  143  ILQCEASPLDYLS  155



>ref|XP_009354455.1| PREDICTED: F-box protein SKIP5 isoform X2 [Pyrus x bretschneideri]
Length=213

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  295  RWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIK  474
            RW +LACHPRLWLRVDRS +D   PG+FPN+ETAV +ARPGDTILI+ GG H   NIQIK
Sbjct  14   RWLYLACHPRLWLRVDRSAKDLLEPGVFPNLETAVEAARPGDTILISAGGRHLAYNIQIK  73

Query  475  KPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGC  654
            K LCLIGAGE PD+T + CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGR+TI+GC
Sbjct  74   KRLCLIGAGEQPDETTIYCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRVTIEGC  133

Query  655  ILQCESNPLDHLS  693
            +LQCE+NPLDHLS
Sbjct  134  VLQCETNPLDHLS  146



>gb|ADE75775.1| unknown [Picea sitchensis]
Length=305

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN LDDGCLM I SFLSP+PDRY+ A VC+RWR LA  PR+WLRV++S    S  G+F  
Sbjct  59   INALDDGCLMRILSFLSPLPDRYSAAGVCYRWRHLASDPRMWLRVEKSCNALSESGVFST  118

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            +E AV +ARPGDTILI+ G  H   NIQI KP+CL+G G  PD+T+L C RG DSALEFL
Sbjct  119  VEDAVIAARPGDTILISTGVVHIARNIQIIKPVCLVGGGSSPDETVLVCPRGFDSALEFL  178

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHL  690
            ST K+ANLT++AELG CLLHR+GRLT++ C+LQCE +PL+HL
Sbjct  179  STGKVANLTIKAELGSCLLHRNGRLTVESCVLQCEEHPLEHL  220



>gb|AFK48081.1| unknown [Lotus japonicus]
Length=152

 Score =   213 bits (541),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFL PIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  37   INNLDDGCLMHIFSFLPPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLSQPGVFPN  96

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  549
            IETAVS++RPGDTILIA GGSH  SNIQIKKPLCLIGAGE+PDDT L CSRGSDS
Sbjct  97   IETAVSASRPGDTILIAAGGSHHTSNIQIKKPLCLIGAGELPDDTTLICSRGSDS  151



>ref|XP_007011112.1| SKP1/ASK-interacting protein 5 isoform 2, partial [Theobroma 
cacao]
 gb|EOY19922.1| SKP1/ASK-interacting protein 5 isoform 2, partial [Theobroma 
cacao]
Length=280

 Score =   217 bits (552),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 118/163 (72%), Gaps = 36/163 (22%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            IN+LDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHP+LWLRVDRS++D S PG+FPN
Sbjct  87   INSLDDGCLMHIFSFLSPIPDRYNTALVCHRWHYLACHPQLWLRVDRSLKDFSEPGVFPN  146

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            IE AVS+ARPGDTILIA GGSH  SNIQI+KPLCL                         
Sbjct  147  IEEAVSAARPGDTILIAAGGSHLASNIQIRKPLCL-------------------------  181

Query  565  STCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
                       AELGCCLLHRSGRL ID CILQCESNPLD+LS
Sbjct  182  -----------AELGCCLLHRSGRLIIDECILQCESNPLDYLS  213



>gb|AAG40405.1|AF325053_1 T14E10.50 [Arabidopsis thaliana]
 gb|AAK61344.1|AF347971_1 SKP1-interacting partner 5 [Arabidopsis thaliana]
Length=156

 Score =   207 bits (527),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +1

Query  190  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  369
            YS   +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  30   YSLTSLNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  89

Query  370  GIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSD  546
            G+F NIE+AVS+ARPGDTILI  GG++RVSNIQIKKPLCL+G GEIPD+T L C+RGSD
Sbjct  90   GVFLNIESAVSAARPGDTILIVAGGNYRVSNIQIKKPLCLVGGGEIPDETTLVCARGSD  148



>ref|XP_006494343.1| PREDICTED: F-box protein SKIP5-like isoform X1 [Citrus sinensis]
Length=154

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMH+FSFLSPIPDRYNTALVCHRW +LACHPRLWLRVD+SV+D    G+FP+
Sbjct  30   INNLDDGCLMHVFSFLSPIPDRYNTALVCHRWNYLACHPRLWLRVDQSVKDLFETGVFPD  89

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFL  564
            ++TAVS ARPGDTILIA GGSH VSNIQIKK LCL+G GE+PD+T L CSRGSD  + FL
Sbjct  90   LKTAVSVARPGDTILIAAGGSHPVSNIQIKKQLCLVGGGELPDETTLICSRGSDRFVNFL  149



>ref|XP_006494344.1| PREDICTED: F-box protein SKIP5-like isoform X2 [Citrus sinensis]
Length=147

 Score =   199 bits (506),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMH+FSFLSPIPDRYNTALVCHRW +LACHPRLWLRVD+SV+D    G+FP+
Sbjct  30   INNLDDGCLMHVFSFLSPIPDRYNTALVCHRWNYLACHPRLWLRVDQSVKDLFETGVFPD  89

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSD  546
            ++TAVS ARPGDTILIA GGSH VSNIQIKK LCL+G GE+PD+T L CSRGSD
Sbjct  90   LKTAVSVARPGDTILIAAGGSHPVSNIQIKKQLCLVGGGELPDETTLICSRGSD  143



>ref|XP_009139235.1| PREDICTED: F-box protein SKIP5-like isoform X1 [Brassica rapa]
Length=310

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 128/184 (70%), Gaps = 24/184 (13%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHP LWLRVDR V+D S PG+F +
Sbjct  54   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPLLWLRVDRFVKDLSQPGVFHD  113

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDT---------ILTCSR  537
            IE+AVS+AR  +  L+    S   S ++++  L LI   +    T          + C  
Sbjct  114  IESAVSAARLVEARLLMKPPS---SVLEVQTGLELIFPFKSSSWTCSMSPCLCFFIYCKE  170

Query  538  GSD------------SALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPL  681
             S             SALE LSTCKLANLTV+AELGCCLLHRSGR+TIDGC+LQCE+NPL
Sbjct  171  NSLVYGFFLLLGFLCSALELLSTCKLANLTVKAELGCCLLHRSGRVTIDGCVLQCETNPL  230

Query  682  DHLS  693
            DHLS
Sbjct  231  DHLS  234



>gb|KJB74632.1| hypothetical protein B456_012G017000 [Gossypium raimondii]
Length=183

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 109/157 (69%), Gaps = 27/157 (17%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMHIFSFLSPIPDRYNTALVCHRW +LACHPRLWLRVDRSV+D S PG+FPN
Sbjct  24   INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWCYLACHPRLWLRVDRSVQDFSEPGVFPN  83

Query  385  IETAVSSA---------------------------RPGDTILIAGGGSHRVSNIQIKKPL  483
            IE AVS+A                           RPGDTILIA GGSH  SNIQIKKPL
Sbjct  84   IEEAVSAARYIKLLLICGLGLYGILLRPYLQTLPFRPGDTILIAAGGSHLASNIQIKKPL  143

Query  484  CLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTV  594
            CLIG GE+PD+T + C RGSD    FL+   L  L V
Sbjct  144  CLIGGGELPDETTVICLRGSDRFANFLTMFLLRMLNV  180



>ref|XP_003598633.1| F-box protein SKIP5 [Medicago truncatula]
Length=170

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 2/103 (2%)
 Frame = +1

Query  187  CYSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL  366
            CYSR  INNLDDGCLMHIFSFLSPIPDR+NTALVCHRW +LACHPRLWLRVDRSV+D S 
Sbjct  26   CYSR--INNLDDGCLMHIFSFLSPIPDRFNTALVCHRWNYLACHPRLWLRVDRSVKDLSE  83

Query  367  PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIG  495
            PG+FPNIETAVS++RPGDTILIA GG HRV+NIQI KPLCL+ 
Sbjct  84   PGVFPNIETAVSASRPGDTILIAAGGIHRVANIQINKPLCLVS  126



>ref|XP_010659171.1| PREDICTED: F-box protein SKIP5 isoform X3 [Vitis vinifera]
Length=168

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  394  AVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTC  573
            AVS+ARPGDTILIA GGSH  SNIQIKKPLCLIG GE+PDDT L CSRGSDSALEFLSTC
Sbjct  2    AVSAARPGDTILIAAGGSHLASNIQIKKPLCLIGGGELPDDTTLLCSRGSDSALEFLSTC  61

Query  574  KLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            K+ANLTV+AELGCCLLHRSGRLTIDGCILQCESNPLD+LS
Sbjct  62   KVANLTVKAELGCCLLHRSGRLTIDGCILQCESNPLDYLS  101



>ref|XP_001765023.1| predicted protein [Physcomitrella patens]
 gb|EDQ70239.1| predicted protein [Physcomitrella patens]
Length=1280

 Score =   196 bits (499),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 95/161 (59%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  214  LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIET  393
            LDD CL+ I +FL+P+PDR+N A VC RW+ L    R+WL V   ++ S  P  F +++ 
Sbjct  17   LDDACLVRILTFLTPLPDRFNAARVCQRWQKLVSDKRMWLHVAPGLKSS--PNQFLSLQD  74

Query  394  AVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTC  573
            AV+SARPGDTILIA G +H   NI+I KPL L+G GE  DDT+L C RG DSALEFL+  
Sbjct  75   AVTSARPGDTILIAPGVTHVTPNIRINKPLFLVGGGETADDTVLLCPRGFDSALEFLANG  134

Query  574  KLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            KLANL + AELG CLLHR GRLT+D C LQC  +PLDHLSY
Sbjct  135  KLANLKITAELGSCLLHRKGRLTVDNCALQCVEHPLDHLSY  175



>ref|XP_002976942.1| hypothetical protein SELMODRAFT_175869 [Selaginella moellendorffii]
 gb|EFJ22052.1| hypothetical protein SELMODRAFT_175869 [Selaginella moellendorffii]
Length=271

 Score =   183 bits (464),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 115/171 (67%), Gaps = 5/171 (3%)
 Frame = +1

Query  196  RHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL---  366
            R  IN LDDGCL+ +  FL+P PDR+N A VC RW  L    R+WLRV  +  +SS    
Sbjct  18   RPSINLLDDGCLVRVLGFLAPFPDRFNAASVCSRWHKLIADSRMWLRVQSATANSSYNSF  77

Query  367  --PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRG  540
               G F  ++ AV++ARPGDTI I  G  H V+N+ I KPLCL+G G  P++T+L    G
Sbjct  78   IQSGEFATLQDAVNAARPGDTIFIGPGEVHAVANVAIDKPLCLMGGGSSPEETVLISPSG  137

Query  541  SDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            S+SAL F +  K+ANLT++AELG CLLHR G LT+D C L+CE +PL++LS
Sbjct  138  SESALVFSANGKIANLTIKAELGSCLLHRRGSLTVDRCALECEEHPLEYLS  188



>ref|XP_002980686.1| hypothetical protein SELMODRAFT_178289 [Selaginella moellendorffii]
 gb|EFJ18337.1| hypothetical protein SELMODRAFT_178289 [Selaginella moellendorffii]
Length=271

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 115/171 (67%), Gaps = 5/171 (3%)
 Frame = +1

Query  196  RHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSL---  366
            R  IN LDDGCL+ +  FL+P PDR+N A VC RW  L    R+WLRV  +  +SS    
Sbjct  18   RPSINLLDDGCLVRVLGFLAPFPDRFNAASVCSRWHKLIADSRMWLRVQSATANSSYNSF  77

Query  367  --PGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRG  540
               G F  ++ AV++ARPGDTI I  G  H V+N+ I KPLCL+G G  P++T+L    G
Sbjct  78   IQSGEFATLQDAVNAARPGDTIFIEPGEVHAVANVAIDKPLCLMGGGSSPEETVLISPSG  137

Query  541  SDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            S+SAL F +  K+ANLT++AELG CLLHR G LT+D C L+CE +PL++LS
Sbjct  138  SESALVFSANGKIANLTIKAELGSCLLHRRGSLTVDRCALECEEHPLEYLS  188



>gb|EMT11615.1| hypothetical protein F775_29980 [Aegilops tauschii]
Length=231

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 115/200 (58%), Gaps = 70/200 (35%)
 Frame = +1

Query  169  EAAPYYCYSRHDINNLDDGCLMHIFSFLSPIP------------------------DRYN  276
            EAAP+       +N+LDDGCLMHIFSFLSPIP                        DRYN
Sbjct  7    EAAPWGEAPGSPVNSLDDGCLMHIFSFLSPIPGSTATDGKLVYVRSYSLRTTLSESDRYN  66

Query  277  TALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRV  456
            TALVCHRWRFLACHPRLWLRV+R +RD   PG++P++E A+S+A                
Sbjct  67   TALVCHRWRFLACHPRLWLRVERPLRDVKEPGVYPDLEAAISAA----------------  110

Query  457  SNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGR  636
                                          SALEFLSTCK+ANLT++AELGCCLLHRSG+
Sbjct  111  ------------------------------SALEFLSTCKIANLTIKAELGCCLLHRSGK  140

Query  637  LTIDGCILQCESNPLDHLSY  696
            LTI  C+LQCE NPLD+LS+
Sbjct  141  LTIQECLLQCEPNPLDYLSF  160



>emb|CDX73477.1| BnaC08g25260D [Brassica napus]
Length=111

 Score =   175 bits (443),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVD  V+D SLPG+F +
Sbjct  9    LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDPFVKDLSLPGVFHS  68

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLI  492
            IE+AVS+ARPGDTILI  GGSHRVSNIQIKKPLCL+
Sbjct  69   IESAVSAARPGDTILIGAGGSHRVSNIQIKKPLCLV  104



>emb|CDY13210.1| BnaC04g26250D [Brassica napus]
Length=146

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D   PG+F +
Sbjct  43   LNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLPQPGVFHD  102

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLI  492
            IE+AVS+ARPGDTILI  GG+H VSNIQIKKPLCL+
Sbjct  103  IESAVSAARPGDTILIGAGGNHLVSNIQIKKPLCLV  138



>tpg|DAA63988.1| TPA: hypothetical protein ZEAMMB73_319872 [Zea mays]
Length=135

 Score =   171 bits (432),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            +N+LDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRV+R +RD+  PG++P+
Sbjct  20   MNSLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVERPIRDAMEPGVYPD  79

Query  385  IETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIG  495
            +E AVS+ARPGDTILIA GGSH   NIQIKKP+C++ 
Sbjct  80   LEAAVSAARPGDTILIAAGGSHVACNIQIKKPICIVS  116



>gb|KHG17417.1| F-box SKIP5 -like protein [Gossypium arboreum]
Length=264

 Score =   147 bits (370),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  436  GGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCC  615
             GGSH  SNIQIKKPLCLIG GE+PD+T + C RGSDSALEFLSTCKL NLTV+AELGCC
Sbjct  113  AGGSHLASNIQIKKPLCLIGGGELPDETNVICLRGSDSALEFLSTCKLTNLTVKAELGCC  172

Query  616  LLHRSGRLTIDGCILQCESNPLDHLS  693
            LLHRSGRL ID CILQCESNPLD+LS
Sbjct  173  LLHRSGRLIIDECILQCESNPLDYLS  198


 Score = 43.1 bits (100),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +2

Query  260  SQIGITPHWFATDGVSWHVTRGFGCELTVP*EIHL  364
            ++IGITP  FATDGV WHVT   GCE   P  I L
Sbjct  63   NEIGITPPSFATDGVIWHVTLDCGCESIDPFRIFL  97



>ref|NP_567000.2| SKP1/ASK-interacting protein 5 [Arabidopsis thaliana]
 gb|AEE79237.1| SKP1/ASK-interacting protein 5 [Arabidopsis thaliana]
Length=118

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  190  YSRHDINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLP  369
            YS   +NNLDDGCLMHI SFLSPIPDRYNTALVCHRWR+LACHPRLWLRVDR V+D S P
Sbjct  30   YSLTSLNNLDDGCLMHILSFLSPIPDRYNTALVCHRWRYLACHPRLWLRVDRFVKDLSQP  89

Query  370  GIFPNIETAVSSAR  411
            G+F NIE+AVS+AR
Sbjct  90   GVFLNIESAVSAAR  103



>tpg|DAA41661.1| TPA: hypothetical protein ZEAMMB73_083322, partial [Zea mays]
Length=105

 Score =   132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +1

Query  244  SFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDT  423
            +F+    +RYNT LVCH W FLACHPRLWLRV+R +RD   P ++PN+E  VS+  P   
Sbjct  4    NFIVEPANRYNTVLVCHIWGFLACHPRLWLRVERPIRDVMEPRVYPNLEAVVSAVGPITP  63

Query  424  ILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDS  549
              IA GGSH   NIQI KP+C+IG G +PDDT+LTCSRG D 
Sbjct  64   FFIAAGGSHVACNIQINKPICIIGGGNLPDDTVLTCSRGFDK  105



>ref|XP_008246108.1| PREDICTED: F-box protein SKIP5-like, partial [Prunus mume]
Length=117

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 76/103 (74%), Gaps = 9/103 (9%)
 Frame = +1

Query  241  FSFLSPIP----DRYNTALVCHRWRFLACHPRLWLRVDRSVRDS-SLPGIFPNIETAVSS  405
              FLS I     DRYNTALVCHRW FLACHPRLWLRV+RSV+D    PG+FP+IETAV++
Sbjct  5    LQFLSQIAIEFADRYNTALVCHRWLFLACHPRLWLRVERSVKDRLEEPGVFPDIETAVAA  64

Query  406  ARPGDTILIAGGGSHRVSNIQIKKPLCLIGAG----EIPDDTI  522
            ARPGDTILIA GG H  SNIQIKK LCL+       EIP  T+
Sbjct  65   ARPGDTILIAAGGRHLASNIQIKKRLCLVCLKVLHLEIPIKTV  107



>ref|XP_006494345.1| PREDICTED: F-box protein SKIP5-like isoform X3 [Citrus sinensis]
Length=137

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +1

Query  205  INNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPN  384
            INNLDDGCLMH+FSFLSPIPDRYNTALVCHRW +LACHPRLWLRVD+SV+D    G+FP+
Sbjct  30   INNLDDGCLMHVFSFLSPIPDRYNTALVCHRWNYLACHPRLWLRVDQSVKDLFETGVFPD  89

Query  385  IETAVSSAR----------PGDTILIAGGGSHRVSNIQIKKPLCLI  492
            ++TAVS AR          P   + +    +   S+  I++ LC++
Sbjct  90   LKTAVSVARSVEVSFLMKQPSSVLEVRTEDTFNRSDTLIQQTLCMV  135



>gb|EYU42992.1| hypothetical protein MIMGU_mgv1a018998mg, partial [Erythranthe 
guttata]
Length=102

 Score =   129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 69/96 (72%), Gaps = 18/96 (19%)
 Frame = +1

Query  202  DINNLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFP  381
             IN LDDGCLM IFSFLSPIPDRYNTALVC RWRFLA                   G++P
Sbjct  25   QINRLDDGCLMLIFSFLSPIPDRYNTALVCRRWRFLAS------------------GVYP  66

Query  382  NIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCL  489
             IETAVS+ARPGDTILIA GG HR SNIQIKKPLCL
Sbjct  67   CIETAVSAARPGDTILIAAGGIHRTSNIQIKKPLCL  102



>emb|CDY66691.1| BnaC04g53050D, partial [Brassica napus]
Length=145

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  490  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  669
            IG+GEIPD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  1    IGSGEIPDETTLVCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCE  60

Query  670  SNPLDHLS  693
            +NPLDHLS
Sbjct  61   TNPLDHLS  68



>emb|CDX73483.1| BnaC08g25200D [Brassica napus]
Length=161

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  490  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  669
            IG+GEIPD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  17   IGSGEIPDETTLVCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCE  76

Query  670  SNPLDHLS  693
            +NPLDHLS
Sbjct  77   TNPLDHLS  84



>emb|CDY40005.1| BnaC05g13100D [Brassica napus]
Length=174

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  490  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  669
            IG+GEIPD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  30   IGSGEIPDETTLVCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRLTIDGCVLQCE  89

Query  670  SNPLDHLS  693
            +NPLDHLS
Sbjct  90   TNPLDHLS  97



>ref|XP_003598632.1| F-box protein SKIP5 [Medicago truncatula]
Length=141

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  490  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  669
            IGAGEIPDDT+LTCSRG DSA EFLS CKL+NLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  6    IGAGEIPDDTMLTCSRGLDSAFEFLSNCKLSNLTVKAELGCCLLHRSGRLTIDGCVLQCE  65

Query  670  SNPLDHLS  693
            SNPLD LS
Sbjct  66   SNPLDFLS  73



>gb|AFK39958.1| unknown [Medicago truncatula]
Length=141

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  490  IGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCE  669
            IGA EIPDDT+LTCSRG DSA EFLS CKL+NLTV+AELGCCLLHRSGRLTIDGC+LQCE
Sbjct  6    IGAREIPDDTMLTCSRGLDSAFEFLSNCKLSNLTVKAELGCCLLHRSGRLTIDGCVLQCE  65

Query  670  SNPLDHLS  693
            SNPLD LS
Sbjct  66   SNPLDFLS  73



>emb|CDY13209.1| BnaC04g26260D [Brassica napus]
Length=157

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  487  LIGAGEIPDDTILTCSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQC  666
            LI  GE PD+T L CSRGSDSALE LSTCKLANLTV+AELGCCLLHRSGR+TIDGC+LQC
Sbjct  9    LISGGETPDETTLVCSRGSDSALELLSTCKLANLTVKAELGCCLLHRSGRVTIDGCVLQC  68

Query  667  ESNPLDHLS  693
            E+NPLDHLS
Sbjct  69   ETNPLDHLS  77



>ref|XP_006431426.1| hypothetical protein CICLE_v10002701mg [Citrus clementina]
 gb|ESR44666.1| hypothetical protein CICLE_v10002701mg [Citrus clementina]
Length=167

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 17/111 (15%)
 Frame = +1

Query  361  SLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRG  540
            SL  +F ++E +    +P   + I    +   S+  I++ LC++                
Sbjct  8    SLNLLFRSVEVSFLMKQPSSVLEIRTEDTFNRSDTLIQQTLCMV----------------  51

Query  541  SDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
              SALEFLSTCKLANLTV+AELGCC LHRSGRLTIDGC+LQCE+NPLD LS
Sbjct  52   -HSALEFLSTCKLANLTVKAELGCCFLHRSGRLTIDGCVLQCETNPLDFLS  101



>ref|XP_008246248.1| PREDICTED: F-box protein SKIP5-like [Prunus mume]
Length=124

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  529  CSRGSDSALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLS  693
            CS    SALE LSTCKLANLTV+AELGCCLLHR+GRLTI+GC+LQCESNPLDHLS
Sbjct  3    CSFCLSSALELLSTCKLANLTVKAELGCCLLHRNGRLTIEGCVLQCESNPLDHLS  57



>ref|XP_005651314.1| hypothetical protein COCSUDRAFT_59281 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26770.1| hypothetical protein COCSUDRAFT_59281 [Coccomyxa subellipsoidea 
C-169]
Length=292

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +1

Query  376  FPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSAL  555
            + ++  AV  +RPGD I++  G  H V+++ I  PL L+G G   DDT+L CS+  D  L
Sbjct  19   YHSLRDAVEGSRPGDRIVLEPG-EHDVADVHISWPLHLVGGGITADDTVLRCSKSRDGVL  77

Query  556  EFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHL  690
            +F ++ K+ NLT++++   C+ HR G LT++GC L+C    L+HL
Sbjct  78   DFRASGKVQNLTIQSKANACITHRQGALTVEGCSLRCTGTGLNHL  122



>gb|KIY98094.1| F-box protein SKIP5 [Monoraphidium neglectum]
Length=410

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 88/166 (53%), Gaps = 9/166 (5%)
 Frame = +1

Query  211  NLDDGCLMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWL-----RVDRSVRDSSLPGI  375
            +LDD  L  +  FL P P   N AL C R R +A     WL      VD +   S   G 
Sbjct  23   DLDDALLSKVLLFLDPFPGVANAALTCRRLRRVATDKGRWLVVAPHAVDAAGTPSGRAGP  82

Query  376  -FPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTILTCSRGSDSA  552
             F ++  AV+++RPGDTI +A    H    ++++ PL + GAG     + L  S   ++A
Sbjct  83   RFTSLAGAVAASRPGDTIWLAPHVRHEAPCVRVRWPLHICGAGA---GSTLLASPSGEAA  139

Query  553  LEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHL  690
            L+  ++ K+  + + + LG C+LHR G L ++ C L+C++  LDH+
Sbjct  140  LDIGASAKIIGVAIESRLGPCILHRRGTLHVESCALRCDNGGLDHI  185



>gb|EMS52646.1| hypothetical protein TRIUR3_14698 [Triticum urartu]
Length=330

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  550  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHLSY  696
            ALEFLSTCK+ANLT++AELGCCLLHRSG+LTI  C+LQCE NPLD+LS+
Sbjct  211  ALEFLSTCKIANLTIKAELGCCLLHRSGKLTIQECLLQCEPNPLDYLSF  259



>ref|XP_010497120.1| PREDICTED: F-box protein SKIP5-like, partial [Camelina sativa]
Length=73

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  253  SPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNI  387
            S   DRYNTALVCHRWR+LACHPRLWLRVDR V+D + PG+F NI
Sbjct  29   SECADRYNTALVCHRWRYLACHPRLWLRVDRFVKDLTQPGVFRNI  73



>ref|XP_010248139.1| PREDICTED: F-box protein SKIP5-like, partial [Nelumbo nucifera]
Length=99

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  265  DRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARP  414
            DRYNTALVCHRW FLACHPRLWLRVDRS++D + PG+FP+     S   P
Sbjct  22   DRYNTALVCHRWCFLACHPRLWLRVDRSIKDPTEPGVFPDXFLEESLDHP  71



>ref|XP_011397893.1| F-box protein SKIP5 [Auxenochlorella protothecoides]
 gb|KFM25005.1| F-box protein SKIP5 [Auxenochlorella protothecoides]
Length=248

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (58%), Gaps = 2/107 (2%)
 Frame = +1

Query  376  FPNIETAVSSARPGDTILIAGGGSHRVSN--IQIKKPLCLIGAGEIPDDTILTCSRGSDS  549
            F  +  AV +++PG TIL+ GG  HRVS   + I+  L L+G+G   +  +L    G ++
Sbjct  30   FSTLAEAVQASQPGHTILLQGGQPHRVSGQPVVIRHALRLLGSGGRAEAVVLRGDPGLET  89

Query  550  ALEFLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPLDHL  690
             L F S  +L NL+V +  G CL+H +G L + GCIL+  +  L HL
Sbjct  90   VLLFHSLAQLLNLSVHSVRGACLMHLAGTLRVGGCILESSAAGLPHL  136



>ref|XP_005852278.1| hypothetical protein CHLNCDRAFT_133681 [Chlorella variabilis]
 gb|EFN60176.1| hypothetical protein CHLNCDRAFT_133681 [Chlorella variabilis]
Length=514

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 69/130 (53%), Gaps = 25/130 (19%)
 Frame = +1

Query  376  FPNIETAVSSARPGDTILI-AGGGSHRVSN-IQIKKPLCLIGAGEIPDDTILTCSRGSDS  549
            F  ++ AV+++RPGDTIL+ AG   H VS  + +  P+ ++G G    + +L  S G D+
Sbjct  109  FATLDAAVAASRPGDTILLEAGPAPHAVSAPLAVPHPVLILGGGVEAGECVLQGSPGLDA  168

Query  550  ALEF---------------LSTC--------KLANLTVRAELGCCLLHRSGRLTIDGCIL  660
             L+F               L  C        +LANLT+RA  G C+ H  GRLT+ GC L
Sbjct  169  LLDFRQAGPWQRAAAPGANLRACAQAGRASGRLANLTLRATSGACVAHTRGRLTVQGCNL  228

Query  661  QCESNPLDHL  690
            +C++  L HL
Sbjct  229  ECDARGLPHL  238



>ref|XP_006386008.1| hypothetical protein POPTR_0003s19945g [Populus trichocarpa]
 gb|ERP63805.1| hypothetical protein POPTR_0003s19945g [Populus trichocarpa]
Length=153

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  301  RFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
            R+LACHPR+WLR +RS +D S PG+FP+ ETAVS+A
Sbjct  7    RYLACHPRMWLRDERSAKDLSEPGVFPSTETAVSAA  42


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  559  FLSTCKLANLTVRAELGCCLLHRSGRLTIDGCILQCESNPL  681
            F ST    +      LGCCL H SGRLTID CILQC +NPL
Sbjct  32   FPSTETAVSAASEERLGCCLHHESGRLTIDSCILQCWANPL  72



>ref|XP_008904960.1| hypothetical protein PPTG_11400 [Phytophthora parasitica INRA-310]
 gb|ETN09814.1| hypothetical protein PPTG_11400 [Phytophthora parasitica INRA-310]
Length=2533

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/98 (32%), Positives = 48/98 (49%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S LP    ++   ++  
Sbjct  1633  LHRVMSLLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGLP---VSLAKVLAKV  1689

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1690  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1724



>ref|WP_038557082.1| hypothetical protein [Draconibacterium orientale]
 gb|AHW61731.1| hypothetical protein FH5T_07235 [Draconibacterium orientale]
Length=351

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 1/90 (1%)
 Frame = +1

Query  304  FLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSARPGDTILIAGGGSHRVSNIQIKKPL  483
            FL      W +    V++ +   ++ NI TA+++A  GDT+ I GGG   ++N  I K L
Sbjct  9    FLFLATLSWGQAQFVVQNGTKTEVYNNINTAITNAVAGDTLYIPGGG-FTITNTTIDKTL  67

Query  484  CLIGAGEIPDDTILTCSRGSDSALEFLSTC  573
              +G G  P +T  T     +SAL F   C
Sbjct  68   HWVGHGHYPSETGATMQTRINSALNFTGNC  97



>gb|ETL94122.1| hypothetical protein L917_07851, partial [Phytophthora parasitica]
Length=2550

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETK87535.1| hypothetical protein L915_08027, partial [Phytophthora parasitica]
Length=2550

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETP17406.1| hypothetical protein F441_08176 [Phytophthora parasitica CJ01A1]
Length=2533

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1633  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1689

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1690  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1724



>gb|ETI47607.1| hypothetical protein F443_08200 [Phytophthora parasitica P1569]
Length=2533

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1633  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1689

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1690  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1724



>gb|ETL40964.1| hypothetical protein L916_07950, partial [Phytophthora parasitica]
Length=2550

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETP45417.1| hypothetical protein F442_08141, partial [Phytophthora parasitica 
P10297]
Length=2550

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETO76325.1| hypothetical protein F444_08256, partial [Phytophthora parasitica 
P1976]
Length=2550

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>gb|ETM47366.1| hypothetical protein L914_07913, partial [Phytophthora parasitica]
Length=2550

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 47/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S LSP P+R+   +VC  W   A H  L+++V  S  +S  P    ++   ++  
Sbjct  1650  LHRVMSMLSPYPERHRAQMVCRSWHTAAQHQSLYVKVSASDFESGSP---VSLAKVLAKV  1706

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPDDTI  522
              PGDT+L   G       ++I K L L+ A   PD  +
Sbjct  1707  APGDTVLFGAGVYQLDETLEISKSLRLLAA---PDSHV  1741



>tpg|DAA63986.1| TPA: hypothetical protein ZEAMMB73_319872, partial [Zea mays]
Length=153

 Score = 47.8 bits (112),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  169  EAAPYYCYSRHDINNLDDGCLMHIFSFLSPIPD  267
            E AP        +N+LDDGCLMHIFSFLSPIPD
Sbjct  64   ELAPVVEELISPMNSLDDGCLMHIFSFLSPIPD  96


 Score = 23.5 bits (49),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 8/13 (62%), Positives = 9/13 (69%), Gaps = 0/13 (0%)
 Frame = +2

Query  296  DGVSWHVTRGFGC  334
            DG S H T G+GC
Sbjct  96   DGASLHATLGYGC  108



>ref|XP_002898448.1| SNF2 family helicase/ATPase and F-box protein, putative [Phytophthora 
infestans T30-4]
 gb|EEY63271.1| SNF2 family helicase/ATPase and F-box protein, putative [Phytophthora 
infestans T30-4]
Length=2503

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 30/95 (32%), Positives = 44/95 (46%), Gaps = 6/95 (6%)
 Frame = +1

Query  229   LMHIFSFLSPIPDRYNTALVCHRWRFLACHPRLWLRVDRSVRDSSLPGIFPNIETAVSSA  408
             L  + S L+P P+RY   +VC  W   A H  L+ +V  S  +S  P     +   V++ 
Sbjct  1618  LHRVMSMLTPYPERYRAQMVCRSWHTAAQHQSLYFKVSASDFESGSPTSLAKVLANVAT-  1676

Query  409   RPGDTILIAGGGSHRVSNIQIKKPLCLIGAGEIPD  513
               GDT+L   G       ++I K L L+ A   PD
Sbjct  1677  --GDTVLFGAGVYQLDETLEINKRLRLLAA---PD  1706



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160