BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040E20

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006350963.1|  PREDICTED: mitogen-activated protein kinase ...  97.1    2e-19   Solanum tuberosum [potatoes]
ref|NP_001234485.1|  MAP3Ka                                           88.2    2e-16   Solanum lycopersicum
ref|XP_009625680.1|  PREDICTED: mitogen-activated protein kinase ...  85.9    1e-15   Nicotiana tomentosiformis
ref|XP_009765252.1|  PREDICTED: mitogen-activated protein kinase ...  83.2    9e-15   Nicotiana sylvestris
emb|CDP04692.1|  unnamed protein product                              79.3    1e-13   Coffea canephora [robusta coffee]
gb|AAS78639.1|  MAP3Ka                                                77.0    8e-13   Nicotiana benthamiana
ref|XP_011099741.1|  PREDICTED: mitogen-activated protein kinase ...  72.4    3e-11   Sesamum indicum [beniseed]
ref|XP_003526863.1|  PREDICTED: mitogen-activated protein kinase ...  62.8    4e-08   Glycine max [soybeans]
ref|XP_006432223.1|  hypothetical protein CICLE_v10000585mg           62.4    4e-08   
ref|XP_006432224.1|  hypothetical protein CICLE_v10000585mg           62.0    7e-08   Citrus clementina [clementine]
gb|KDO50298.1|  hypothetical protein CISIN_1g040472mg                 61.2    1e-07   Citrus sinensis [apfelsine]
ref|XP_004502938.1|  PREDICTED: mitogen-activated protein kinase ...  60.5    2e-07   
ref|XP_007137724.1|  hypothetical protein PHAVU_009G150500g           59.7    4e-07   Phaseolus vulgaris [French bean]
ref|XP_010090849.1|  Mitogen-activated protein kinase kinase kina...  59.3    6e-07   Morus notabilis
ref|XP_009371492.1|  PREDICTED: mitogen-activated protein kinase ...  57.0    3e-06   Pyrus x bretschneideri [bai li]
gb|KHG01918.1|  Mitogen-activated protein kinase kinase kinase 2      56.6    5e-06   Gossypium arboreum [tree cotton]
ref|XP_008355073.1|  PREDICTED: mitogen-activated protein kinase ...  56.2    6e-06   
ref|XP_009347263.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    8e-06   Pyrus x bretschneideri [bai li]
ref|XP_002280682.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    8e-06   Vitis vinifera
gb|ADI52619.1|  mitogen-activated protein kinase kinase kinase        55.5    1e-05   Gossypium hirsutum [American cotton]
ref|XP_004288333.1|  PREDICTED: mitogen-activated protein kinase ...  55.1    1e-05   Fragaria vesca subsp. vesca
ref|XP_003523226.1|  PREDICTED: mitogen-activated protein kinase ...  55.1    2e-05   Glycine max [soybeans]
gb|KJB75259.1|  hypothetical protein B456_012G034500                  54.3    3e-05   Gossypium raimondii
gb|KJB75261.1|  hypothetical protein B456_012G034500                  54.3    3e-05   Gossypium raimondii
gb|KJB75262.1|  hypothetical protein B456_012G034500                  54.3    3e-05   Gossypium raimondii
gb|KHN31145.1|  Mitogen-activated protein kinase kinase kinase 2      54.3    3e-05   Glycine soja [wild soybean]
gb|KJB75260.1|  hypothetical protein B456_012G034500                  53.9    3e-05   Gossypium raimondii
ref|XP_007048387.1|  Mitogen-activated protein kinase kinase kina...  53.5    5e-05   
gb|KJB46890.1|  hypothetical protein B456_008G000500                  52.4    1e-04   Gossypium raimondii
gb|KJB46894.1|  hypothetical protein B456_008G000500                  52.4    1e-04   Gossypium raimondii
ref|XP_008358959.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    1e-04   
ref|XP_008363405.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    2e-04   
gb|EYU18037.1|  hypothetical protein MIMGU_mgv1a002756mg              50.4    5e-04   Erythranthe guttata [common monkey flower]
ref|XP_007213592.1|  hypothetical protein PRUPE_ppa002709mg           50.1    8e-04   Prunus persica



>ref|XP_006350963.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum tuberosum]
Length=614

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 109/184 (59%), Gaps = 17/184 (9%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTsrd  303
            MP WWG+KS K    DPQ         VK +  ++  +PRS  E+     +RNSPRTS+D
Sbjct  1    MPAWWGKKSTKN--KDPQ---------VKEKEREKYVKPRSFDELL----SRNSPRTSKD  45

Query  304  fssargssgsasaf--MDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvsssasCDDH  477
            FS +        +   ++K  PLP PSVSS GND G+  G GS S S +S S S+     
Sbjct  46   FSGSGSGFSGFDSGSSLEKAHPLPMPSVSSLGNDHGVVLGCGSVSVSSTSSSGSSDGGGA  105

Query  478  NRIDRVQFTSLRGVGDNKQSPVSQSPVRSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKS  657
               D+ Q  + RG+GDN+ SP+S+SPVRSR  TT SSP HP     NLDSPTG++D+ +S
Sbjct  106  VNTDQAQLDTFRGLGDNRLSPLSRSPVRSRGTTTTSSPLHPRFSSLNLDSPTGKLDDVRS  165

Query  658  ECHR  669
            ECH+
Sbjct  166  ECHQ  169



>ref|NP_001234485.1| MAP3Ka [Solanum lycopersicum]
 gb|AAS78640.1| MAP3Ka [Solanum lycopersicum]
Length=614

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 106/184 (58%), Gaps = 17/184 (9%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTsrd  303
            MP WWG+KS K    D Q          K +  ++  +PRS  E+     +RNSPRTS+D
Sbjct  1    MPAWWGKKSTKN--KDLQ---------AKEKEREKYVKPRSFDELL----SRNSPRTSKD  45

Query  304  fssargssgsasaf--MDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvsssasCDDH  477
            FS +        +   ++K  PLP PSVSS GND G+  G GS S S +S S S+     
Sbjct  46   FSGSGSGFSGFDSGSSLEKAHPLPMPSVSSLGNDHGVVLGCGSVSVSSTSSSGSSDGGGP  105

Query  478  NRIDRVQFTSLRGVGDNKQSPVSQSPVRSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKS  657
               D+ Q  + RG+GDN+ SP+S+SPVRSR  TT SSP HP     NLDS TG++D+ +S
Sbjct  106  VNTDQAQLDTFRGLGDNRLSPLSRSPVRSRGTTTTSSPLHPRFSSLNLDSSTGKLDDVRS  165

Query  658  ECHR  669
            ECH+
Sbjct  166  ECHQ  169



>ref|XP_009625680.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Nicotiana tomentosiformis]
Length=608

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 94/184 (51%), Gaps = 17/184 (9%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTsrd  303
            MP WWG+KS K           K   S + ER ++  +PRS  EV      RNS   +  
Sbjct  1    MPAWWGKKSTKN----------KETQSKEKER-EKYVKPRSFDEVLCRNSPRNSKDLNFG  49

Query  304  fssargssgsasafMDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvsssasCDDHNR  483
             S +  S   + + +DK  PLP+PSV +    +         S S S  S        N 
Sbjct  50   GSGSGFSGFDSGSSLDKAHPLPRPSVGNDQGVVLGCGSVSVSSTSSSGSSDGPV----NT  105

Query  484  IDRVQF-TSLRGVGDNKQSPVSQSPVRSRAPTTNSSPRHPHCGGANLDSPTGRMD-EWKS  657
             D+ QF T  RG GDN+ SP+S+SPVRSR  TT SSP HP     NLDSPTG++D + +S
Sbjct  106  TDQAQFDTLFRGHGDNRLSPLSRSPVRSRGTTTTSSPLHPRFSSINLDSPTGKLDNDMRS  165

Query  658  ECHR  669
            ECH+
Sbjct  166  ECHQ  169



>ref|XP_009765252.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana sylvestris]
Length=613

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 98/193 (51%), Gaps = 30/193 (16%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTsr-  300
            MP WWG+KS K           K   S + ER D+  +PRS  EV      RNSPR S+ 
Sbjct  1    MPAWWGKKSTKN----------KETQSKEKER-DKYVKPRSFDEVL----CRNSPRNSKD  45

Query  301  --------dfssargssgsasafMDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvss  456
                     FS +  S   + + +DK  PLP+PSV +    +         S S S  S 
Sbjct  46   LNFGGSGCGFSGSGFSGFDSGSSLDKAHPLPRPSVGNDQGVVLGCGSVSVSSTSSSGSSD  105

Query  457  sasCDDHNRIDRVQF-TSLRGVGDNKQSPVSQSPVRSRAPTTNSSPRHPHCGGANLDSPT  633
                   N  D+ QF T  RG GDN+ SP+S+SPVRSR  TT SSP HP     NLDSPT
Sbjct  106  GPV----NTTDQAQFDTLFRGNGDNRLSPLSRSPVRSRGTTTTSSPLHPRFSSINLDSPT  161

Query  634  GRMD-EWKSECHR  669
            G++D + +SECH+
Sbjct  162  GKLDNDVRSECHQ  174



>emb|CDP04692.1| unnamed protein product [Coffea canephora]
Length=623

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 111/195 (57%), Gaps = 15/195 (8%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTs--  297
            MP WWGRKS K  + DPQ NS  S  S  N+     +  R    VSG+  ARNSPR S  
Sbjct  1    MPAWWGRKSTK--SKDPQNNSQNSSGSNNNKATSIKNDKR---RVSGIDFARNSPRKSPD  55

Query  298  rdfssargssgsasafMDKGLPLPQPSVssfgnd--------lglgfgfgsgsdsgssvs  453
                ++  S   +S+ +D+  PLP+PSVSS            +GLG G GS S SGSSVS
Sbjct  56   FGGGASGFSGFDSSSSLDRVYPLPRPSVSSNDQSHGGGVGGVVGLGSGLGSASLSGSSVS  115

Query  454  ssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPVRSRAPTTNSSPRHPHCGGANLDSPT  633
            SSAS DDH+ +D  Q    RG GD K S +      SR  TT +SP HP   G +LDSPT
Sbjct  116  SSASSDDHSNLDHGQMAFFRGQGDGKLSQLPSPGPASRGGTTTTSPLHPRLSGLSLDSPT  175

Query  634  GRMDEWKSECHRLPL  678
            GR+++ + ECHRLPL
Sbjct  176  GRLEDGRGECHRLPL  190



>gb|AAS78639.1| MAP3Ka [Nicotiana benthamiana]
Length=611

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 96/193 (50%), Gaps = 30/193 (16%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTsr-  300
            MP WWG+KS K           K   S + ER D+  +PRS  EV      RNSPR S+ 
Sbjct  1    MPAWWGKKSTKN----------KETQSKEKER-DKYVKPRSFDEVL----CRNSPRNSKD  45

Query  301  --------dfssargssgsasafMDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvss  456
                     FS +  S   + + +DK  PLP+PSV +    +         S S S  S 
Sbjct  46   LNLGGSGSGFSGSGFSGFDSGSSLDKAHPLPRPSVGNDQGVVLGCGSVSVSSTSSSGSSD  105

Query  457  sasCDDHNRIDRVQFTSL-RGVGDNKQSPVSQSPVRSRAPTTNSSPRHPHCGGANLDSPT  633
                   N  D+ QF  L RG GDN+ SP+S+SPVRSR  TT SSP HP     NLDSPT
Sbjct  106  GPV----NTTDQAQFDILFRGNGDNRLSPLSRSPVRSRGTTTTSSPLHPRFSSMNLDSPT  161

Query  634  GRMD-EWKSECHR  669
            G++D +  SE H+
Sbjct  162  GKLDNDVSSESHQ  174



>ref|XP_011099741.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Sesamum indicum]
Length=625

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 110/199 (55%), Gaps = 21/199 (11%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNE--RIDRSD-RPRSLGEVSGMVDARNSPRT  294
            MP WWG+ S +   ++    +    SSVKNE  R+  SD + RS  EV      RNSPR 
Sbjct  1    MPAWWGKISGRSKDSE----TSAKGSSVKNEKKRVKESDNKARSFDEVLLQQQPRNSPRN  56

Query  295  srdfssargssgs----------asafMDKGLPLPQPSVssfgndlglgfgfgsgsdsgs  444
            SRDFS+A    G           +++ +D+G PLP+P   S  +  G+G G GSGS S  
Sbjct  57   SRDFSAAGRELGGGNSSGFSGFDSASSLDRGHPLPRPLEPSNDHVHGVGSGSGSGSVSSD  116

Query  445  svsssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPVRS-RAPTTNSSPRHPHCGGANL  621
            S S S+   +H  +D   +   RG G+N+ SP+ +SP R  +  TT +SP H    G NL
Sbjct  117  SSSGSSDDPNHVAVDHAAY---RGHGENRSSPLLRSPGRGLKCTTTATSPLHARLSGINL  173

Query  622  DSPTGRMDEWKSECHRLPL  678
            DSP  ++++ +SECH+LPL
Sbjct  174  DSPAAKLEDGRSECHKLPL  192



>ref|XP_003526863.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=616

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 96/198 (48%), Gaps = 29/198 (15%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPK--------SPSSVKNERIDRSDRPR------SLGEVS  261
            MP WWG+KS+K     PQ +           + +SV N   ++ ++PR      S  +V 
Sbjct  1    MPTWWGKKSSKSKDQQPQEDHHHPPHGGGGGAATSVLNFNFNKLNKPRPDRPSKSFDDV-  59

Query  262  GMVDARNSPRTsrdfssargssgsasafMDKGLPLPQPSVssfgndlglgfgfgsgsdsg  441
                 RNSPR SRDFSS+  ++      +D+GLPLP+PSVSS  +               
Sbjct  60   ----VRNSPRCSRDFSSSAAAA------VDQGLPLPRPSVSSTQSFGIEQGLVFGSGSVS  109

Query  442  ssvsssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPRHPHCGGAN  618
             S  SS+   D +     Q  + RG GD K    S+SP   SR PT+ +SP HP     +
Sbjct  110  GSSVSSSGSYDDHPTCHSQINASRGQGDTKFYARSKSPGPGSRGPTSPTSPLHPKLHVLS  169

Query  619  LDSPTGRMDEWKSECHRL  672
            LDSPTGR +    ECH L
Sbjct  170  LDSPTGRQE---GECHPL  184



>ref|XP_006432223.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
 gb|ESR45463.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
Length=526

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 109/200 (55%), Gaps = 20/200 (10%)
 Frame = +1

Query  124  MPGWWGRKSAKKI--TNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTs  297
            MP WWG+KS+K    ++ PQ N         +++ +++DRPRS     G++  R+SPR S
Sbjct  1    MPAWWGKKSSKNKDESHSPQGNHFNFIKFSGDKKKEKNDRPRSF---DGVIFTRSSPRES  57

Query  298  rdfssargssgsas-----afMDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvsssa  462
            +D+  A   S   S     +   KG PLP+P           G G GSGS S SSVSSS 
Sbjct  58   KDYGIAGAGSSGFSGFDSDSGEKKGHPLPRP--LDSIMQSDHGNGLGSGSGSVSSVSSSG  115

Query  463  sCDDHN-RIDRVQFTSLRGVGD------NKQSPVSQSPVR-SRAPTTNSSPRHPHCGGAN  618
            S +DH    D+ QF   R  GD       K + + +SP   SR PT+ +SP H    G +
Sbjct  116  SSEDHVIGSDQGQFGGSRSYGDPRVNGDIKFNLMPKSPCAGSRGPTSPTSPLHARLSGMS  175

Query  619  LDSPTGRMDEWKSECHRLPL  678
            +DSPTG++++ KS+CH+LPL
Sbjct  176  VDSPTGKVEDGKSQCHKLPL  195



>ref|XP_006432224.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
 ref|XP_006464984.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Citrus sinensis]
 gb|ESR45464.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
Length=628

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 109/200 (55%), Gaps = 20/200 (10%)
 Frame = +1

Query  124  MPGWWGRKSAKKI--TNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTs  297
            MP WWG+KS+K    ++ PQ N         +++ +++DRPRS     G++  R+SPR S
Sbjct  1    MPAWWGKKSSKNKDESHSPQGNHFNFIKFSGDKKKEKNDRPRSF---DGVIFTRSSPRES  57

Query  298  rdfssargssgsas-----afMDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvsssa  462
            +D+  A   S   S     +   KG PLP+P           G G GSGS S SSVSSS 
Sbjct  58   KDYGIAGAGSSGFSGFDSDSGEKKGHPLPRP--LDSIMQSDHGNGLGSGSGSVSSVSSSG  115

Query  463  sCDDHN-RIDRVQFTSLRGVGD------NKQSPVSQSPVR-SRAPTTNSSPRHPHCGGAN  618
            S +DH    D+ QF   R  GD       K + + +SP   SR PT+ +SP H    G +
Sbjct  116  SSEDHVIGSDQGQFGGSRSYGDPRVNGDIKFNLMPKSPCAGSRGPTSPTSPLHARLSGMS  175

Query  619  LDSPTGRMDEWKSECHRLPL  678
            +DSPTG++++ KS+CH+LPL
Sbjct  176  VDSPTGKVEDGKSQCHKLPL  195



>gb|KDO50298.1| hypothetical protein CISIN_1g040472mg [Citrus sinensis]
Length=628

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 109/200 (55%), Gaps = 20/200 (10%)
 Frame = +1

Query  124  MPGWWGRKSAKKI--TNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTs  297
            MP WWG+KS+K    ++ PQ N         +++ +++DRPRS     G++  R+SPR S
Sbjct  1    MPAWWGKKSSKNKDESHSPQGNHFNFIKFSGDKKKEKNDRPRSF---DGVIFRRSSPRES  57

Query  298  rdfssargssgsas-----afMDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvsssa  462
            +D+  A   S   S     +   KG PLP+P           G G GSGS S SSVSSS 
Sbjct  58   KDYGIAGAGSSGFSGFDSDSGEKKGHPLPRP--LDSIMQSDHGNGLGSGSGSVSSVSSSG  115

Query  463  sCDDHN-RIDRVQFTSLRGVGD------NKQSPVSQSPVR-SRAPTTNSSPRHPHCGGAN  618
            S +DH    D+ QF   R  GD       K + + +SP   SR PT+ +SP H    G +
Sbjct  116  SSEDHVIGSDQGQFGGSRSYGDPRVNGDIKFNLMPKSPCAGSRGPTSPTSPLHARLSGMS  175

Query  619  LDSPTGRMDEWKSECHRLPL  678
            +DSPTG++++ KS+CH+LPL
Sbjct  176  VDSPTGKIEDGKSQCHKLPL  195



>ref|XP_004502938.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cicer arietinum]
Length=631

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 96/198 (48%), Gaps = 18/198 (9%)
 Frame = +1

Query  124  MPGWWGRKSAKK--------ITNDPQLNSPKSPSSVKNE-RIDRSDRPRSLGEVSGMVDA  276
            MP WW +KS K          T    L+   + S ++N    +  ++P+S  +VS     
Sbjct  1    MPTWWSKKSIKTKEHPRGGTTTAGTVLHFNFTKSPIRNSTNTNNVEKPKSFDDVSAF---  57

Query  277  RNSPRTsrdfssargssgsasafMDK------GLPLPQPSVssfgndlglgfgfgsgsds  438
            RNSPR SRDF+S+  ++  +S+  D       G+PLP+PSV    +           +  
Sbjct  58   RNSPRPSRDFTSSTSAAAGSSSCCDSDAGDKIGIPLPRPSVYPTQSLSNDQGLTFGSTSV  117

Query  439  gssvsssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPVRSRAPTTNSSPRHPHCGGAN  618
             SS  SS    D       Q  S RG  D K +   +SPV SR PT+ +SP HP     +
Sbjct  118  SSSSVSSNGSYDDPSTCNSQINSARGQCDTKFNGRPRSPVGSRRPTSPTSPLHPRLQVLS  177

Query  619  LDSPTGRMDEWKSECHRL  672
            LDSPTGR ++ +SECH L
Sbjct  178  LDSPTGRQEDGRSECHPL  195



>ref|XP_007137724.1| hypothetical protein PHAVU_009G150500g [Phaseolus vulgaris]
 gb|ESW09718.1| hypothetical protein PHAVU_009G150500g [Phaseolus vulgaris]
Length=612

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 88/187 (47%), Gaps = 11/187 (6%)
 Frame = +1

Query  124  MPGWWGRKSAKKITND---PQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRT  294
            MP WWG+KS+K    +   P        S ++   I    RP    E    V  RNSPR 
Sbjct  1    MPTWWGKKSSKSKDQEDHHPHGGGGGGTSVLQFNFIKPKTRPNKSFEEPAHV--RNSPRA  58

Query  295  srdfssargssgsasafMDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvsssasCDD  474
            +RDF+ +   S        +GLPLP+PSVSS  +           +    S  SS    +
Sbjct  59   TRDFTLSAADSDE-----KRGLPLPRPSVSSIQSFGNDQGLVFGSASVSGSSVSSNGSYE  113

Query  475  HNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEW  651
             +     Q T+ RG G+ K    S+SP   SR PT+ +SP HP     +LDSPTGR ++ 
Sbjct  114  DHPTYHSQITAARGQGEVKFHVRSKSPGPGSRGPTSPTSPLHPKLLILSLDSPTGRQEDG  173

Query  652  KSECHRL  672
            + ECH L
Sbjct  174  RGECHPL  180



>ref|XP_010090849.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
 gb|EXB40974.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
Length=616

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 108/206 (52%), Gaps = 28/206 (14%)
 Frame = +1

Query  124  MPGWWGRKSAK-KITNDPQLNSP---------KSPSSVKNERIDRSDRPRSLGEVSGMVD  273
            MP WWGRKS+K K  N  Q NSP          SP+   ++R  + ++ +S   V     
Sbjct  1    MPAWWGRKSSKHKEENQVQPNSPSNNHHHGFFNSPARTADKRKGK-EKTKSFDGVL----  55

Query  274  ARNSPR-----TsrdfssargssgsasafMD----KGLPLPQPSVssf-gndlglgfgfg  423
             R SPR     ++       G   SA +  D    +GLPLP+PSVSS  G     G G G
Sbjct  56   TRGSPRRSREFSAGGGGGGGGGPSSAFSGFDSDGCRGLPLPRPSVSSTPGLGNDHGVGLG  115

Query  424  sgsdsgssvsssasCDDHNRI-DRVQFTSLRGVGDNKQSPVSQSPVRSRAPTTNSSPRHP  600
            SGS S SSVSSS S +DH  + +  QF + RG  D K     +SP      T+ +SP HP
Sbjct  116  SGSASVSSVSSSGSSEDHANVHENGQFGAFRGHADAKFKTRPRSP--GPGSTSPTSPLHP  173

Query  601  HCGGANLDSPTGRMDEWKSECHRLPL  678
               G +++SPTGR ++ KS+CHRLPL
Sbjct  174  MLSGMSMESPTGRQEDAKSQCHRLPL  199



>ref|XP_009371492.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009371493.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
Length=642

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 94/208 (45%), Gaps = 27/208 (13%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKN--------------ERIDRSDRPRSLGEVS  261
            MP WWGRKS+K      +    K+P S +N              ++ ++ +RPRS  E  
Sbjct  1    MPAWWGRKSSKSKEEQEKAVQHKNPYSNRNSSNFVNKSSVSNDIKKKEKDERPRSFDEQV  60

Query  262  GMVDARNSPRTsrdfssargssgsasafMD------KGLPLPQPSVssfgndlgl--gfg  417
                 R SPR SR+ +   G S S     D         PLP+PSVSS            
Sbjct  61   ----TRGSPRASRELTGVVGVSSSGFLGFDSDGGERAAHPLPRPSVSSLQGLALGNDQVN  116

Query  418  fgsgsdsgssvsssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPR  594
                  +  S  SS+  DD         +S R +GD K S + +SP  RSR PT+ +SP 
Sbjct  117  GLGSGSASVSSVSSSGSDDPLVAQCGAASSYRCIGDPKVSMMPKSPGPRSRGPTSPTSPL  176

Query  595  HPHCGGANLDSPTGRMDEWKSECHRLPL  678
            HP      L+SPTG+ ++ KS CH LPL
Sbjct  177  HPRLCPMGLESPTGKQEDGKSVCHPLPL  204



>gb|KHG01918.1| Mitogen-activated protein kinase kinase kinase 2 [Gossypium arboreum]
Length=661

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 113/229 (49%), Gaps = 46/229 (20%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERID-------------------------R  228
            MPGWWG+KS+K   + P+  +P+  +SV   +                            
Sbjct  1    MPGWWGKKSSKNKEDSPRNQTPRG-TSVGFLKFSPTKTDAATAAAAGKKKAPAATPDDKN  59

Query  229  SDRPRSLGEVSGMV-DARNSPRTsrdfssargssgsasafM-----------DKGLPLPQ  372
            ++ P+   +  G+V   R+SPR SRDF    G+  S S               +G+PLP 
Sbjct  60   NNYPKGCDDGGGLVFSTRSSPRVSRDFGVGGGAVVSGSGSSGFSGFDSDSGEKRGIPLPT  119

Query  373  PSVssfgndlglgfgfgsgsdsgssvsssasCDDHNRIDRVQFTS------LRGVGDNKQ  534
            PSVSS  +D  +G G GS S    S S S+  D+    D VQF +      +RG G+N+ 
Sbjct  120  PSVSSLQSDHVVGLGSGSPSVCSFSSSGSSE-DNQIPNDPVQFIAYRSYNDMRGQGENRS  178

Query  535  SPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKSECHRLPL  678
            +  S+SP  RSR PT+ +SP H    G +L+SPTG+ ++ KS CH+LPL
Sbjct  179  NVRSRSPGPRSRGPTSPTSPLHHRLSGVSLESPTGKKEDGKSVCHKLPL  227



>ref|XP_008355073.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Malus domestica]
Length=422

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 95/208 (46%), Gaps = 27/208 (13%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKN--------------ERIDRSDRPRSLGEVS  261
            MP WWGRKS+K      +    K+P S +N              +  ++ +RPRS  E  
Sbjct  1    MPAWWGRKSSKSKEEQEKAVQHKNPYSNRNSNNFVIKSSTSNDIKNKEKDERPRSFDEHV  60

Query  262  GMVDARNSPRTsrdfssargssgsasafMD------KGLPLPQPSVssfgnd--lglgfg  417
                 R SPR SR+F+   G S S     D         PLP+PSVSS            
Sbjct  61   ----TRRSPRASREFAGPVGVSSSGFLGFDSDGGERAAHPLPRPSVSSLQGLPLGNDQGN  116

Query  418  fgsgsdsgssvsssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPR  594
                  +  S  SS+  DD         +S R +GD K S + +SP  RSR PT+ +SP 
Sbjct  117  GLGSGSASLSSVSSSGSDDPPVAQCGAASSYRFIGDPKASMMPKSPGPRSRGPTSPTSPL  176

Query  595  HPHCGGANLDSPTGRMDEWKSECHRLPL  678
            HP     +L+SPTG+ ++ KS CH LPL
Sbjct  177  HPRLCAMSLESPTGKQEDGKSVCHPLPL  204



>ref|XP_009347263.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009347264.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009347265.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
Length=640

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 96/208 (46%), Gaps = 27/208 (13%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKN--------------ERIDRSDRPRSLGEVS  261
            MP WWGRKS+K      +    K+P S +N              +  ++ +RPRS  E  
Sbjct  1    MPAWWGRKSSKSKEEQEKAVQHKNPYSNRNSNNFVIKSSTSNDIKNKEKDERPRSFDEHV  60

Query  262  GMVDARNSPRTsrdfssargssgsasafMD------KGLPLPQPSVssfgndlgl--gfg  417
                 R SPR SR+F+ A G S S     D         PLP+PSVSS            
Sbjct  61   ----TRRSPRASREFAGAVGVSSSGFLGFDSDGGERAAHPLPRPSVSSLQGLALGNDQGN  116

Query  418  fgsgsdsgssvsssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPR  594
                + +  S  SS+  DD         +S R  GD K S + +SP  RSR PT+ +SP 
Sbjct  117  GLGSASASVSSVSSSGSDDPLVAQCGAASSYRFTGDPKVSMMPKSPGPRSRGPTSPTSPL  176

Query  595  HPHCGGANLDSPTGRMDEWKSECHRLPL  678
            HP     +L+SPTG+ ++ KS CH LPL
Sbjct  177  HPRLCAMSLESPTGKQEDGKSVCHPLPL  204



>ref|XP_002280682.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Vitis vinifera]
Length=623

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 102/203 (50%), Gaps = 33/203 (16%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSP------SSVKNERIDRSDRPRSLGEVSGMVDARNS  285
            MP WWGRKS+K    + Q  +P+S        S++N++ +  D+P+S  E  G+  +RNS
Sbjct  1    MPAWWGRKSSK-CKEEVQQQNPESTLYNISKISIRNDKKNGKDKPKSFDE--GLF-SRNS  56

Query  286  PRTsrdfssargssgsasafMD----------KGLPLPQPSVssfgndlglgfgfgsgsd  435
            PR+S+D+ +   S G  S+             +G PLP PS               S S 
Sbjct  57   PRSSKDYGALTVSGGGGSSGFSGFDSDCGDKIRGHPLPLPSAGIEHGVGSGSGSVSSVSS  116

Query  436  sgssvsssasCDDH-NRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPRHPHCG  609
            SGSS       DDH +  D   F   RG G+ K +  S+SP   SR+ T   SP HP   
Sbjct  117  SGSS-------DDHPSPHDHAPFGVYRGQGETKSNTRSRSPGPGSRSAT---SPLHPRFS  166

Query  610  GANLDSPTGRMDEWKSECHRLPL  678
             +N+DS TG+ +E +S CHRLPL
Sbjct  167  TSNIDSLTGKQEEGRS-CHRLPL  188



>gb|ADI52619.1| mitogen-activated protein kinase kinase kinase [Gossypium hirsutum]
Length=661

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 111/229 (48%), Gaps = 46/229 (20%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERID-------------------------R  228
            MPGWWG+KS+K   + P+  +P+  +SV   +                            
Sbjct  1    MPGWWGKKSSKNKEDSPRNQTPRG-TSVGFLKFSPAKTDAATAAAAGKKKAPAATPDDKN  59

Query  229  SDRPRSLGEVSGMV-DARNSPRTsrdfssargssgsasafM-----------DKGLPLPQ  372
            ++ P+   +  G+V   R+SPR SRDF    G+    S               +G+PLP 
Sbjct  60   NNYPKGCDDGGGLVFSTRSSPRVSRDFGVGGGAVVPGSGSSGFSGFDSDSGEKRGIPLPT  119

Query  373  PSVssfgndlglgfgfgsgsdsgssvsssasCDDHNRIDRVQFTS------LRGVGDNKQ  534
            PSVSS  +D  +G G GS S    S S S+  D+    D VQF +      +RG G N+ 
Sbjct  120  PSVSSLQSDHVVGLGSGSPSVCSFSSSGSSE-DNQIPNDPVQFIAYRSYNDMRGQGGNRS  178

Query  535  SPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKSECHRLPL  678
            +  S+SP  RSR PT+ +SP H    G +L+SPTG+ ++ KS CH+LPL
Sbjct  179  NVRSRSPGPRSRGPTSPTSPLHHRLSGVSLESPTGKKEDGKSVCHKLPL  227



>ref|XP_004288333.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Fragaria vesca subsp. vesca]
Length=618

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 84/186 (45%), Gaps = 9/186 (5%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTsrd  303
            MP WWGRKS K    DP      +P S +N  + +S   RS    +       SPR    
Sbjct  1    MPAWWGRKSTKTTKTDPPEKKSLNPYSNRNSYVVKSPPARS----TNTSFDEPSPRVVSK  56

Query  304  fssargssgsasaf--MDKGLPLPQPSVssfgndlglgfgfgsgsdsgssvsssasCDDH  477
                  S  S        KG PLP+PSVSS                +  SVSS  S    
Sbjct  57   DLGTASSGFSGFESDGGSKGHPLPRPSVSSPHGGGPGNDQGVGLGSASGSVSSGTSSVSS  116

Query  478  NRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWK  654
            +  D+    + R  G+ K S + +SP   SR PT+ +SP H   GG +L+SPTG++D+ K
Sbjct  117  D--DQPVLAAFRVNGEPKFSMMPRSPGPGSRGPTSPTSPLHARLGGMSLESPTGKLDDGK  174

Query  655  SECHRL  672
            S CH L
Sbjct  175  SVCHPL  180



>ref|XP_003523226.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform 1 [Glycine max]
Length=601

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 100/187 (53%), Gaps = 22/187 (12%)
 Frame = +1

Query  124  MPGWWGRKSAKK--ITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTs  297
            MP WWG+KS+K     +  Q + P   ++          +P+       +V  RNSPR S
Sbjct  1    MPTWWGKKSSKTKDQQHQQQQDHPHGAAATTTLLHFNFIKPKPSKSFDDVV--RNSPRAS  58

Query  298  rdfssargssgsasafMDKGLPLPQPSVssfgndlg-lgfgfgsgsdsgssvsssasCDD  474
            RDF S+          +D+GLPLP+PSV S  +     G  FGS S SGSSVSSS S DD
Sbjct  59   RDFGSSAA--------VDQGLPLPRPSVFSTQSFAIDQGLVFGSASVSGSSVSSSGSYDD  110

Query  475  HNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEW  651
            H +I+     + RG GD K    S+SP   SR PT+ +SP HP   G +LDSPTGR +  
Sbjct  111  HPQIN-----ASRGQGDMKFLVRSKSPGPGSRGPTSPTSPLHPKLLGLSLDSPTGRQE--  163

Query  652  KSECHRL  672
              ECH L
Sbjct  164  -GECHPL  169



>gb|KJB75259.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=661

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 111/229 (48%), Gaps = 46/229 (20%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERID-------------------------R  228
            MPGWWG+KS+K   + P+  +P+  +SV   +                            
Sbjct  1    MPGWWGKKSSKNKEDSPRNQTPRG-TSVGFLKFSPTKTDAATAAAAGKKKAPAATPDDKN  59

Query  229  SDRPRSLGEVSGMV-DARNSPRTsrdfssargssgsasafM-----------DKGLPLPQ  372
            ++ P+   +  G+V   R+SPR SRDF    G+    S               +G+PLP 
Sbjct  60   NNYPKGCDDGGGLVFSTRSSPRVSRDFGVGGGAVVPGSGSSGFSGFDSDSGEKRGIPLPT  119

Query  373  PSVssfgndlglgfgfgsgsdsgssvsssasCDDHNRIDRVQFTS------LRGVGDNKQ  534
            PSVSS  +D  +G G GS S    S S S+  D+    D VQF +      +RG G+ + 
Sbjct  120  PSVSSMHSDHVVGLGSGSPSVCSFSSSGSSE-DNQIPNDPVQFIAYRSYNDMRGQGETRS  178

Query  535  SPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKSECHRLPL  678
            +  S+SP  RSR PT+ +SP H    G +L+SPTG+ ++ KS CH+LPL
Sbjct  179  NVRSRSPGPRSRGPTSPTSPLHHRLSGVSLESPTGKKEDGKSVCHKLPL  227



>gb|KJB75261.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=662

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 111/229 (48%), Gaps = 46/229 (20%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERID-------------------------R  228
            MPGWWG+KS+K   + P+  +P+  +SV   +                            
Sbjct  1    MPGWWGKKSSKNKEDSPRNQTPRG-TSVGFLKFSPTKTDAATAAAAGKKKAPAATPDDKN  59

Query  229  SDRPRSLGEVSGMV-DARNSPRTsrdfssargssgsasafM-----------DKGLPLPQ  372
            ++ P+   +  G+V   R+SPR SRDF    G+    S               +G+PLP 
Sbjct  60   NNYPKGCDDGGGLVFSTRSSPRVSRDFGVGGGAVVPGSGSSGFSGFDSDSGEKRGIPLPT  119

Query  373  PSVssfgndlglgfgfgsgsdsgssvsssasCDDHNRIDRVQFTS------LRGVGDNKQ  534
            PSVSS  +D  +G G GS S    S S S+  D+    D VQF +      +RG G+ + 
Sbjct  120  PSVSSMHSDHVVGLGSGSPSVCSFSSSGSSE-DNQIPNDPVQFIAYRSYNDMRGQGETRS  178

Query  535  SPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKSECHRLPL  678
            +  S+SP  RSR PT+ +SP H    G +L+SPTG+ ++ KS CH+LPL
Sbjct  179  NVRSRSPGPRSRGPTSPTSPLHHRLSGVSLESPTGKKEDGKSVCHKLPL  227



>gb|KJB75262.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=577

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 112/231 (48%), Gaps = 50/231 (22%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERID-------------------------R  228
            MPGWWG+KS+K   + P+  +P+  +SV   +                            
Sbjct  1    MPGWWGKKSSKNKEDSPRNQTPRG-TSVGFLKFSPTKTDAATAAAAGKKKAPAATPDDKN  59

Query  229  SDRPRSLGEVSGMV-DARNSPRTsrdfssargssgsasafM-----------DKGLPLPQ  372
            ++ P+   +  G+V   R+SPR SRDF    G+    S               +G+PLP 
Sbjct  60   NNYPKGCDDGGGLVFSTRSSPRVSRDFGVGGGAVVPGSGSSGFSGFDSDSGEKRGIPLPT  119

Query  373  PSVssfgndlglgfgfgsgsdsgssvsssasCDDHNRI--DRVQFTS------LRGVGDN  528
            PSVSS  +D  +G G GS S    S S S    + N+I  D VQF +      +RG G+ 
Sbjct  120  PSVSSMHSDHVVGLGSGSPSVCSFSSSGS---SEDNQIPNDPVQFIAYRSYNDMRGQGET  176

Query  529  KQSPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKSECHRLPL  678
            + +  S+SP  RSR PT+ +SP H    G +L+SPTG+ ++ KS CH+LPL
Sbjct  177  RSNVRSRSPGPRSRGPTSPTSPLHHRLSGVSLESPTGKKEDGKSVCHKLPL  227



>gb|KHN31145.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=593

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 98/185 (53%), Gaps = 26/185 (14%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERIDRSDRPRSLGEVSGMVDARNSPRTsrd  303
            MP WWG+KS+K      Q        +V   +   S   +S  +V      RNSPR SRD
Sbjct  1    MPTWWGKKSSKTKDQQHQQQQDHPHGAVNFIKPKPS---KSFDDV-----VRNSPRASRD  52

Query  304  fssargssgsasafMDKGLPLPQPSVssfgndlg-lgfgfgsgsdsgssvsssasCDDHN  480
            F S+          +D+GLPLP+PSV S  +     G  FGS S SGSSVSSS S DDH 
Sbjct  53   FGSSAA--------VDQGLPLPRPSVFSTQSFAIDQGLVFGSASVSGSSVSSSGSYDDHP  104

Query  481  RIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKS  657
            +I+     + RG GD K    S+SP   SR PT+ +SP HP   G +LDSPTGR +    
Sbjct  105  QIN-----ASRGQGDMKFLVRSKSPGPGSRGPTSPTSPLHPKLLGLSLDSPTGRQE---G  156

Query  658  ECHRL  672
            ECH L
Sbjct  157  ECHPL  161



>gb|KJB75260.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=473

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 112/231 (48%), Gaps = 50/231 (22%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERID-------------------------R  228
            MPGWWG+KS+K   + P+  +P+  +SV   +                            
Sbjct  1    MPGWWGKKSSKNKEDSPRNQTPRG-TSVGFLKFSPTKTDAATAAAAGKKKAPAATPDDKN  59

Query  229  SDRPRSLGEVSGMV-DARNSPRTsrdfssargssgsasafM-----------DKGLPLPQ  372
            ++ P+   +  G+V   R+SPR SRDF    G+    S               +G+PLP 
Sbjct  60   NNYPKGCDDGGGLVFSTRSSPRVSRDFGVGGGAVVPGSGSSGFSGFDSDSGEKRGIPLPT  119

Query  373  PSVssfgndlglgfgfgsgsdsgssvsssasCDDHNRI--DRVQFTS------LRGVGDN  528
            PSVSS  +D  +G G GS S    S S S    + N+I  D VQF +      +RG G+ 
Sbjct  120  PSVSSMHSDHVVGLGSGSPSVCSFSSSGS---SEDNQIPNDPVQFIAYRSYNDMRGQGET  176

Query  529  KQSPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKSECHRLPL  678
            + +  S+SP  RSR PT+ +SP H    G +L+SPTG+ ++ KS CH+LPL
Sbjct  177  RSNVRSRSPGPRSRGPTSPTSPLHHRLSGVSLESPTGKKEDGKSVCHKLPL  227



>ref|XP_007048387.1| Mitogen-activated protein kinase kinase kinase 3 [Theobroma cacao]
 gb|EOX92544.1| Mitogen-activated protein kinase kinase kinase 3 [Theobroma cacao]
Length=668

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 107/236 (45%), Gaps = 58/236 (25%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSP---------KSPSSV-----------------------  207
            MP WWG+KS+K     PQ  SP          SP+                         
Sbjct  1    MPAWWGKKSSKNKEESPQNQSPCGTTVGLIKSSPNKTDAAAMVAVAVAGSRGGGKKKEAA  60

Query  208  ----KNERIDRSDRPRSLGEVSGMV-DARNSPR-----TsrdfssargssgsasafMDKG  357
                  ++ + S+RP+S  +  G++  ARNSPR      +    S+  S   + +   +G
Sbjct  61   AAAAAADKDNNSNRPKSFDDGGGLLLSARNSPRGSKDFVAVGRGSSGFSGFDSDSGEKRG  120

Query  358  LPLPQPSVssfgndlglgfgfgsgsdsgssvsssasCDDHNRIDRVQFTSLRGVGDNKQS  537
            +PLP+PSVSS  +D G+G G GS S S  S S S   D+    D VQF + R   D    
Sbjct  121  IPLPRPSVSSMQSDHGVGLGSGSASVSSVSSSGSYE-DNQTANDPVQFQACRPYID----  175

Query  538  PVSQSPVR-----------SRAPTTNSSPRHPHCGGANLDSPTGRMDEWKSECHRL  672
            P SQ  +R           SR  T+ +SP H    G +L+SPTGR ++ KS+CH+L
Sbjct  176  PRSQGEIRMNMGSRSPGPGSRGATSPTSPLHHRLSGVSLESPTGRKEDGKSQCHKL  231



>gb|KJB46890.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=654

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  469  DDHNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMD  645
            D+    D VQF + RG G+ + +  S+SP   SR  T+ +SP H      +L+SPTGR +
Sbjct  149  DNQIANDPVQFLAYRGQGETRMNTRSRSPGPGSRGATSPTSPLHHQLSAVSLESPTGRKE  208

Query  646  EWKSECHRLPL  678
            + KS CH+LPL
Sbjct  209  DGKSVCHKLPL  219



>gb|KJB46894.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=545

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  487  DRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPRHPHCGGANLDSPTGRMDEWKSEC  663
            D VQF + RG G+ + +  S+SP   SR  T+ +SP H      +L+SPTGR ++ KS C
Sbjct  155  DPVQFLAYRGQGETRMNTRSRSPGPGSRGATSPTSPLHHQLSAVSLESPTGRKEDGKSVC  214

Query  664  HRLPL  678
            H+LPL
Sbjct  215  HKLPL  219



>ref|XP_008358959.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
 ref|XP_008358960.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
Length=642

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 94/208 (45%), Gaps = 27/208 (13%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKN--------------ERIDRSDRPRSLGEVS  261
            MP WWGRKS+K      +    K+P S +N              ++ ++ +RPRS  E  
Sbjct  1    MPAWWGRKSSKSKEEQEKAVQHKNPYSNRNSNNFVNKSSISNDNKKKEKDERPRSFDEQV  60

Query  262  GMVDARNSPRTsrdfssargssgsasafMD------KGLPLPQPSVssfgndlgl--gfg  417
                 R SPR SR+F S  G S S     D         PLP+PSVSS            
Sbjct  61   ----TRASPRASREFXSVVGVSSSGFLGFDSDGGERAAHPLPRPSVSSLQGLALGNDQVN  116

Query  418  fgsgsdsgssvsssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPR  594
                  +  S  SS+  DD         +S R +GD K S + +SP  RSR PT+ +SP 
Sbjct  117  GLGSGSASVSSVSSSGSDDPLVAHCGAASSYRCIGDPKVSMMPKSPGPRSRGPTSPTSPL  176

Query  595  HPHCGGANLDSPTGRMDEWKSECHRLPL  678
            HP      L+SPTG+ ++ KS  H LPL
Sbjct  177  HPRLCPMGLESPTGKQEDGKSVYHPLPL  204



>ref|XP_008363405.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
 ref|XP_008363406.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
Length=640

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 95/208 (46%), Gaps = 27/208 (13%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKN--------------ERIDRSDRPRSLGEVS  261
            MP WWGRKS+K      +    K+P S +N              ++ ++ +RPRS  E  
Sbjct  1    MPAWWGRKSSKSKEEQEKAVQHKNPYSNRNSNNFVNKSSISNDNKKKEKDERPRSFDEQV  60

Query  262  GMVDARNSPRTsrdfssargssgsasafMD------KGLPLPQPSVssfgndlgl--gfg  417
                 R SPR SR+FSS  G S S     D         PLP+PSVSS            
Sbjct  61   ----TRASPRASREFSSVVGVSSSGFLGFDSDGGERAAHPLPRPSVSSLQGLALGNDQVN  116

Query  418  fgsgsdsgssvsssasCDDHNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNSSPR  594
                  +  S  SS+  DD         +S R +GD K S + +SP  RSR PT+ +SP 
Sbjct  117  GLGSGSASVSSVSSSGSDDPLVAHCGAASSYRCIGDPKVSMMPKSPGPRSRGPTSPTSPL  176

Query  595  HPHCGGANLDSPTGRMDEWKSECHRLPL  678
            HP      L+SPTG+ ++ KS  H LPL
Sbjct  177  HPRLCPMGLESPTGKQEDGKSVYHPLPL  204



>gb|EYU18037.1| hypothetical protein MIMGU_mgv1a002756mg [Erythranthe guttata]
Length=641

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 106/204 (52%), Gaps = 20/204 (10%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVKNERID-------RSDRPRSLGEV---SGMVD  273
            MP WW + S +   ++P+  +    SS+KNER         +  + RS  EV        
Sbjct  1    MPAWWDKISGRSKDSEPKSENSAKSSSLKNERKREKESGNRKESKARSFDEVLLPPPPPP  60

Query  274  ARNSPR-----TsrdfssargssgsasafMDKGLPLPQP--SVssfgndlglgfgfgsgs  432
            + NSPR     ++    S   S   +++ +D+G PLP+P  S +S       GFGFG+GS
Sbjct  61   SANSPRKSRDFSAVGGISTGFSGFDSASSLDRGHPLPRPLESPNSDLQGQVSGFGFGTGS  120

Query  433  dsgssvsssasCDDHNRIDRVQFTSLRG-VGDNKQSPVSQSPVR-SRAPTTNSSPRHPHC  606
             S SSVSSS S +D   I       +RG V +N+ SP  +SP R SR  T+ +SPRH   
Sbjct  121  GSVSSVSSSGSSEDQPHIT-FDHPPIRGQVDNNRLSPSLRSPGRGSRCTTSATSPRHARV  179

Query  607  GGANLDSPTGRMDEWKSECHRLPL  678
            GG  +     +++E ++ECHRLPL
Sbjct  180  GGGGIHLDCPKLEEGRNECHRLPL  203



>ref|XP_007213592.1| hypothetical protein PRUPE_ppa002709mg [Prunus persica]
 gb|EMJ14791.1| hypothetical protein PRUPE_ppa002709mg [Prunus persica]
Length=642

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 95/211 (45%), Gaps = 30/211 (14%)
 Frame = +1

Query  124  MPGWWGRKSAKKITNDPQLNSPKSPSSVK-----------NERIDRSD---RPRSLGEVS  261
            MP WWGRKS+K      +    K+P S +           N  I + +   RP+S  E  
Sbjct  1    MPAWWGRKSSKSKEEQEKTLQHKNPYSNRNNNNFIIKSSINSDIKKKEKDVRPKSFDEQ-  59

Query  262  GMVDARNSPRTsrdfssargssgsasa------fMDKGLPLPQPSVssfgndlglgfgfg  423
                 R SPR S++   A  S+   S          +G PLP+PSVSS            
Sbjct  60   ---ITRGSPRASKELVRAGVSASGFSGFDSDGCERKQGHPLPRPSVSSAQGLGNDQVLGL  116

Query  424  sgsdsgssvsssasCDD-----HNRIDRVQFTSLRGVGDNKQSPVSQSPV-RSRAPTTNS  585
                +  S  SS+   D     H+   ++  +S R  GD K + + +SP   S+ PT+ +
Sbjct  117  GSGSASISSVSSSGSSDDQPIAHDSHAQLGASSYRANGDPKYNMMPRSPGPGSKGPTSPT  176

Query  586  SPRHPHCGGANLDSPTGRMDEWKSECHRLPL  678
            SP HP     +L+SPTG+ ++ KS CH LPL
Sbjct  177  SPLHPLFCAISLESPTGKQEDGKSVCHPLPL  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240