BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040E02

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P51819.1|HSP83_IPONI  RecName: Full=Heat shock protein 83            358   4e-116   Ipomoea nil [qian niu]
ref|XP_004240717.1|  PREDICTED: heat shock protein 83-like              353   3e-114   
ref|XP_009768512.1|  PREDICTED: heat shock protein 82                   351   2e-113   Nicotiana sylvestris
ref|XP_011084460.1|  PREDICTED: heat shock protein 83-like              351   3e-113   Sesamum indicum [beniseed]
emb|CBI34381.3|  unnamed protein product                                338   3e-113   Vitis vinifera
ref|XP_004234218.1|  PREDICTED: heat shock protein 83                   350   4e-113   Solanum lycopersicum
ref|XP_002513649.1|  heat shock protein, putative                       350   4e-113   Ricinus communis
ref|XP_006362664.1|  PREDICTED: heat shock protein 83-like              350   4e-113   Solanum tuberosum [potatoes]
ref|XP_009607669.1|  PREDICTED: heat shock protein 82                   350   5e-113   Nicotiana tomentosiformis
ref|XP_009802902.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    350   8e-113   Nicotiana sylvestris
emb|CBI22652.3|  unnamed protein product                                345   9e-113   Vitis vinifera
ref|XP_010261331.1|  PREDICTED: heat shock protein 83                   349   1e-112   Nelumbo nucifera [Indian lotus]
gb|KDP22224.1|  hypothetical protein JCGZ_26055                         349   1e-112   Jatropha curcas
dbj|BAD95030.1|  heat-shock protein                                     334   2e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05141.1|  unnamed protein product                                348   2e-112   Coffea canephora [robusta coffee]
ref|XP_008234835.1|  PREDICTED: heat shock protein 83                   348   5e-112   Prunus mume [ume]
ref|XP_007220219.1|  hypothetical protein PRUPE_ppa002187mg             347   7e-112   Prunus persica
ref|XP_006372391.1|  hypothetical protein POPTR_0017s01160g             347   7e-112   
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   347   8e-112   Cucumis melo [Oriental melon]
ref|XP_002278894.1|  PREDICTED: heat shock protein 83                   347   9e-112   Vitis vinifera
ref|XP_011046024.1|  PREDICTED: heat shock protein 83                   347   1e-111   Populus euphratica
ref|XP_009368732.1|  PREDICTED: heat shock protein 83                   347   1e-111   Pyrus x bretschneideri [bai li]
ref|XP_008801780.1|  PREDICTED: heat shock protein 83                   347   1e-111   Phoenix dactylifera
ref|XP_010941080.1|  PREDICTED: heat shock protein 83                   346   2e-111   Elaeis guineensis
ref|XP_010276895.1|  PREDICTED: heat shock protein 83-like              346   2e-111   Nelumbo nucifera [Indian lotus]
prf||1908431A  heat shock protein HSP81-1                               346   2e-111
ref|XP_007038813.1|  Heat shock protein 90.1 isoform 1                  346   2e-111   
ref|NP_200076.1|  heat shock protein 90.1                               346   3e-111   
ref|XP_002305263.1|  hypothetical protein POPTR_0004s07190g             346   3e-111   Populus trichocarpa [western balsam poplar]
gb|KJB52728.1|  hypothetical protein B456_008G274600                    346   3e-111   Gossypium raimondii
gb|AAA32822.1|  heat shock protein 83                                   345   3e-111   Arabidopsis thaliana [mouse-ear cress]
prf||1710352A  heat shock protein 83                                    345   4e-111
emb|CAN73318.1|  hypothetical protein VITISV_007727                     345   4e-111   Vitis vinifera
ref|XP_002274022.1|  PREDICTED: heat shock protein 83-like              345   5e-111   Vitis vinifera
ref|XP_004140753.1|  PREDICTED: heat shock protein 83-like              345   5e-111   Cucumis sativus [cucumbers]
ref|XP_010060433.1|  PREDICTED: heat shock protein 83-like              345   5e-111   Eucalyptus grandis [rose gum]
emb|CAA68885.1|  heat shock protein 90A                                 345   6e-111   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19581.1|  hypothetical protein MIMGU_mgv1a002166mg                345   7e-111   Erythranthe guttata [common monkey flower]
ref|XP_008376647.1|  PREDICTED: heat shock protein 83 isoform X1        344   9e-111   
ref|XP_009375529.1|  PREDICTED: heat shock protein 83-like              344   9e-111   Pyrus x bretschneideri [bai li]
ref|XP_002864186.1|  heat shock protein 81-1                            344   1e-110   
ref|XP_010442803.1|  PREDICTED: heat shock protein 90-1-like            344   1e-110   Camelina sativa [gold-of-pleasure]
emb|CDY27839.1|  BnaC09g28660D                                          344   1e-110   Brassica napus [oilseed rape]
ref|XP_008380194.1|  PREDICTED: heat shock protein 83-like              344   1e-110   
ref|XP_006280097.1|  hypothetical protein CARUB_v10025984mg             344   1e-110   Capsella rubella
dbj|BAJ34368.1|  unnamed protein product                                344   2e-110   Eutrema halophilum
ref|XP_010934626.1|  PREDICTED: heat shock protein 83-like              343   2e-110   Elaeis guineensis
gb|KFK26865.1|  hypothetical protein AALP_AA8G303900                    343   2e-110   Arabis alpina [alpine rockcress]
gb|AIZ68157.1|  heat shock protein 83                                   343   2e-110   Ornithogalum longebracteatum [sea-onion]
ref|XP_011035346.1|  PREDICTED: heat shock protein 83-like isofor...    343   2e-110   Populus euphratica
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   343   3e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010482633.1|  PREDICTED: heat shock protein 90-1                 343   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010537148.1|  PREDICTED: heat shock protein 83                   343   3e-110   Tarenaya hassleriana [spider flower]
ref|XP_009377558.1|  PREDICTED: heat shock protein 83-like              343   4e-110   Pyrus x bretschneideri [bai li]
ref|XP_010089052.1|  Heat shock protein 83                              342   7e-110   Morus notabilis
ref|XP_006828794.1|  hypothetical protein AMTR_s00001p00118120          342   9e-110   Amborella trichopoda
ref|XP_003592196.1|  Heat shock protein                                 341   1e-109   
ref|XP_011076104.1|  PREDICTED: heat shock protein 83                   340   3e-109   Sesamum indicum [beniseed]
gb|KHN09298.1|  Heat shock protein 83                                   340   3e-109   Glycine soja [wild soybean]
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              340   4e-109   
ref|XP_006599549.1|  PREDICTED: heat shock protein 83-like              340   5e-109   Glycine max [soybeans]
ref|XP_011080917.1|  PREDICTED: heat shock protein 83-like              340   6e-109   Sesamum indicum [beniseed]
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              339   8e-109   Phoenix dactylifera
ref|XP_010445119.1|  PREDICTED: heat shock protein 90-1-like            339   9e-109   Camelina sativa [gold-of-pleasure]
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              339   1e-108   Cicer arietinum [garbanzo]
gb|AFK35835.1|  unknown                                                 322   1e-108   Lotus japonicus
gb|KDO76323.1|  hypothetical protein CISIN_1g005321mg                   338   1e-108   Citrus sinensis [apfelsine]
ref|XP_006476504.1|  PREDICTED: heat shock protein 83-like              338   2e-108   Citrus sinensis [apfelsine]
ref|XP_006439485.1|  hypothetical protein CICLE_v10019095mg             338   2e-108   Citrus clementina [clementine]
gb|KJB24312.1|  hypothetical protein B456_004G138600                    333   2e-108   Gossypium raimondii
ref|XP_009413748.1|  PREDICTED: heat shock protein 83                   338   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010089053.1|  Heat shock protein 83                              337   6e-108   Morus notabilis
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                   337   6e-108   Fragaria vesca subsp. vesca
gb|AAQ08597.1|  heat shock protein                                      337   8e-108   Hevea brasiliensis [jebe]
gb|EAZ29453.1|  hypothetical protein OsJ_13528                          328   9e-108   Oryza sativa Japonica Group [Japonica rice]
gb|EYU25148.1|  hypothetical protein MIMGU_mgv1a002213mg                336   1e-107   Erythranthe guttata [common monkey flower]
ref|XP_007152171.1|  hypothetical protein PHAVU_004G107700g             336   1e-107   Phaseolus vulgaris [French bean]
gb|EEC84771.1|  hypothetical protein OsI_31801                          319   1e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_010035175.1|  PREDICTED: heat shock protein 83                   336   1e-107   Eucalyptus grandis [rose gum]
ref|XP_007040338.1|  Heat shock protein 90.1                            336   1e-107   Theobroma cacao [chocolate]
dbj|BAA00615.1|  81kDa heat-shock protein                               335   2e-107   Arabidopsis thaliana [mouse-ear cress]
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...    335   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119805.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    335   4e-107   Brassica rapa
gb|KEH26332.1|  heat shock protein 81-2                                 334   5e-107   Medicago truncatula
gb|KHG00618.1|  Heat shock 90-1 -like protein                           335   6e-107   Gossypium arboreum [tree cotton]
gb|KJB20596.1|  hypothetical protein B456_003G155600                    334   8e-107   Gossypium raimondii
gb|AEC11021.1|  heat shock protein 90                                   319   8e-107   Camellia sinensis [black tea]
gb|KJB24311.1|  hypothetical protein B456_004G138600                    334   9e-107   Gossypium raimondii
gb|EEC83017.1|  hypothetical protein OsI_28083                          317   1e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              333   1e-106   Elaeis guineensis
ref|XP_009628903.1|  PREDICTED: heat shock protein 83-like              333   1e-106   Nicotiana tomentosiformis
gb|EAY92778.1|  hypothetical protein OsI_14582                          332   6e-106   Oryza sativa Indica Group [Indian rice]
pdb|2XCM|A  Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar...    316   7e-106   Arabidopsis thaliana [mouse-ear cress]
pdb|2JKI|A  Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain     316   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54249.1|  heat-shock protein                                      331   1e-105   Phaseolus vulgaris [French bean]
ref|XP_003580663.1|  PREDICTED: heat shock protein 82                   331   1e-105   Brachypodium distachyon [annual false brome]
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         330   2e-105   Jatropha curcas
gb|ACR35758.1|  unknown                                                 319   3e-105   Zea mays [maize]
gb|ADF31778.1|  heat shock protein 90                                   329   8e-105   Triticum dicoccoides [wild emmer wheat]
emb|CDP12067.1|  unnamed protein product                                328   1e-104   Coffea canephora [robusta coffee]
emb|CAE02770.2|  OSJNBb0085F13.17                                       328   1e-104   Oryza sativa Japonica Group [Japonica rice]
gb|ADF31779.1|  heat shock protein 90                                   328   2e-104   Triticum dicoccoides [wild emmer wheat]
gb|ADF31754.1|  heat shock protein 90                                   328   2e-104   Triticum aestivum [Canadian hard winter wheat]
gb|ADF31755.1|  heat shock protein 90                                   328   2e-104   Triticum aestivum [Canadian hard winter wheat]
gb|KJB81564.1|  hypothetical protein B456_013G150300                    325   2e-104   Gossypium raimondii
gb|EAZ43234.1|  hypothetical protein OsJ_27834                          319   3e-104   Oryza sativa Japonica Group [Japonica rice]
gb|ADF31756.1|  heat shock protein 90                                   327   3e-104   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006422036.1|  hypothetical protein CICLE_v10004456mg             327   4e-104   Citrus clementina [clementine]
gb|AFR60309.1|  HSP90                                                   327   4e-104   Pelargonium peltatum
gb|ADF31772.1|  heat shock protein 90                                   327   5e-104   Triticum urartu
gb|KDO56796.1|  hypothetical protein CISIN_1g005370mg                   327   5e-104   Citrus sinensis [apfelsine]
gb|KDP32613.1|  hypothetical protein JCGZ_13163                         327   5e-104   Jatropha curcas
ref|XP_010252844.1|  PREDICTED: heat shock cognate protein 80-like      327   6e-104   Nelumbo nucifera [Indian lotus]
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 326   8e-104   Tarenaya hassleriana [spider flower]
emb|CBI25731.3|  unnamed protein product                                323   8e-104   Vitis vinifera
ref|XP_002509852.1|  heat shock protein, putative                       326   9e-104   Ricinus communis
ref|XP_011089536.1|  PREDICTED: heat shock cognate protein 80           326   9e-104   Sesamum indicum [beniseed]
gb|AAN61003.1|  putative heat shock protein 90                          321   1e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KHN43913.1|  Heat shock cognate protein 80                           320   1e-103   Glycine soja [wild soybean]
ref|XP_010910639.1|  PREDICTED: heat shock protein 81-1                 322   1e-103   Elaeis guineensis
dbj|BAE71229.1|  putative HEAT SHOCK PROTEIN 81-2                       319   1e-103   Trifolium pratense [peavine clover]
gb|ADF31775.1|  heat shock protein 90                                   326   1e-103   Aegilops tauschii
emb|CDP13679.1|  unnamed protein product                                325   1e-103   Coffea canephora [robusta coffee]
gb|ADX06844.1|  molecular chaperone Hsp90                               325   2e-103   Nicotiana tabacum [American tobacco]
ref|XP_011097724.1|  PREDICTED: heat shock cognate protein 80-like      325   2e-103   Sesamum indicum [beniseed]
gb|AAR12194.1|  molecular chaperone Hsp90-2                             325   2e-103   Nicotiana benthamiana
ref|XP_010103960.1|  Heat shock cognate protein 80                      326   2e-103   
gb|EPS61618.1|  hypothetical protein M569_13176                         325   2e-103   Genlisea aurea
gb|AAK91366.1|  AT5g56010/MDA7_5                                        320   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81562.1|  hypothetical protein B456_013G150300                    325   3e-103   Gossypium raimondii
gb|KHG22758.1|  Heat shock cognate 80                                   325   3e-103   Gossypium arboreum [tree cotton]
gb|AGA62462.1|  heat shock protein 90                                   325   3e-103   Gossypium hirsutum [American cotton]
gb|KJB81563.1|  hypothetical protein B456_013G150300                    324   3e-103   Gossypium raimondii
ref|XP_007142446.1|  hypothetical protein PHAVU_008G281300g             325   3e-103   Phaseolus vulgaris [French bean]
dbj|BAJ85535.1|  predicted protein                                      325   3e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004169769.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    321   4e-103   
ref|XP_004491531.1|  PREDICTED: heat shock cognate protein 80-lik...    323   5e-103   
gb|KHG19401.1|  Heat shock cognate 80                                   324   5e-103   Gossypium arboreum [tree cotton]
ref|XP_002273244.1|  PREDICTED: heat shock cognate protein 80-like      324   5e-103   Vitis vinifera
gb|ADU04387.1|  heat shock protein 90-2                                 324   6e-103   Nicotiana attenuata
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              324   7e-103   Oryza brachyantha
gb|AAR12193.1|  molecular chaperone Hsp90-1                             324   8e-103   Nicotiana benthamiana
ref|NP_001234436.1|  molecular chaperone Hsp90-1                        323   8e-103   Solanum lycopersicum
gb|KGN66052.1|  hypothetical protein Csa_1G569290                       322   9e-103   Cucumis sativus [cucumbers]
gb|KJB22185.1|  hypothetical protein B456_004G034000                    322   1e-102   Gossypium raimondii
ref|XP_009758556.1|  PREDICTED: heat shock cognate protein 80-like      323   1e-102   Nicotiana sylvestris
ref|XP_009594054.1|  PREDICTED: heat shock cognate protein 80-like      323   1e-102   Nicotiana tomentosiformis
gb|KJB22184.1|  hypothetical protein B456_004G033900                    323   1e-102   Gossypium raimondii
ref|XP_001777383.1|  predicted protein                                  323   1e-102   
gb|ABW96308.1|  heat shock protein 90                                   323   1e-102   Vitis pseudoreticulata
ref|NP_001236612.1|  heat shock protein 90-1                            323   1e-102   
emb|CAN62488.1|  hypothetical protein VITISV_029391                     323   1e-102   Vitis vinifera
ref|XP_004491530.1|  PREDICTED: heat shock cognate protein 80-lik...    323   1e-102   Cicer arietinum [garbanzo]
ref|XP_003635036.1|  PREDICTED: heat shock cognate protein 80           323   1e-102   Vitis vinifera
ref|NP_001240230.1|  uncharacterized protein LOC100819568               323   1e-102   Glycine max [soybeans]
gb|KJB13949.1|  hypothetical protein B456_002G103000                    323   2e-102   Gossypium raimondii
ref|XP_009607645.1|  PREDICTED: heat shock cognate protein 80-like      323   2e-102   Nicotiana tomentosiformis
ref|XP_004308050.1|  PREDICTED: heat shock protein 83-like              323   2e-102   Fragaria vesca subsp. vesca
ref|XP_010446135.1|  PREDICTED: heat shock protein 90-3-like            315   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_011039800.1|  PREDICTED: heat shock protein 90-2                 323   2e-102   Populus euphratica
emb|CDY36772.1|  BnaA03g11140D                                          312   2e-102   Brassica napus [oilseed rape]
ref|XP_006287183.1|  hypothetical protein CARUB_v10000353mg             322   2e-102   Capsella rubella
ref|XP_007020406.1|  Heat shock protein 81.4                            322   2e-102   Theobroma cacao [chocolate]
ref|XP_001780981.1|  predicted protein                                  322   3e-102   
ref|XP_009591410.1|  PREDICTED: heat shock cognate protein 80           322   3e-102   Nicotiana tomentosiformis
ref|XP_010246543.1|  PREDICTED: heat shock cognate protein 80           322   3e-102   Nelumbo nucifera [Indian lotus]
ref|XP_010539340.1|  PREDICTED: heat shock protein 90-2-like            322   3e-102   Tarenaya hassleriana [spider flower]
gb|ADU04386.1|  heat shock protein 90-1                                 322   4e-102   Nicotiana attenuata
ref|XP_009785111.1|  PREDICTED: heat shock cognate protein 80           322   4e-102   Nicotiana sylvestris
gb|KHN31689.1|  Heat shock cognate protein 80                           322   4e-102   Glycine soja [wild soybean]
ref|XP_009763345.1|  PREDICTED: heat shock cognate protein 80-like      322   4e-102   Nicotiana sylvestris
ref|XP_010675973.1|  PREDICTED: heat shock cognate protein 80           322   4e-102   Beta vulgaris subsp. vulgaris [field beet]
gb|ADC45395.1|  HSP90-1                                                 322   4e-102   Glycine max [soybeans]
gb|AAS79798.1|  heat shock protein 90                                   322   4e-102   Nicotiana tabacum [American tobacco]
ref|XP_006280101.1|  hypothetical protein CARUB_v10025990mg             322   5e-102   Capsella rubella
ref|XP_008355028.1|  PREDICTED: heat shock protein 90-2                 322   5e-102   
ref|XP_004135593.1|  PREDICTED: heat shock cognate protein 80-like      322   5e-102   
ref|XP_006352548.1|  PREDICTED: heat shock cognate protein 80-like      322   5e-102   Solanum tuberosum [potatoes]
ref|XP_010450563.1|  PREDICTED: heat shock protein 90-3-like            322   5e-102   Camelina sativa [gold-of-pleasure]
ref|XP_006857538.1|  hypothetical protein AMTR_s00061p00036160          322   5e-102   Amborella trichopoda
ref|NP_001274833.1|  Hsp90-2-like                                       322   6e-102   Solanum tuberosum [potatoes]
ref|XP_003617873.1|  Heat shock protein                                 322   6e-102   Medicago truncatula
gb|KGN66050.1|  hypothetical protein Csa_1G569270                       321   6e-102   Cucumis sativus [cucumbers]
ref|XP_010443242.1|  PREDICTED: heat shock protein 90-2                 321   6e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009126978.1|  PREDICTED: heat shock protein 90-2-like            321   7e-102   Brassica rapa
ref|XP_006401391.1|  hypothetical protein EUTSA_v10012832mg             321   7e-102   Eutrema salsugineum [saltwater cress]
gb|ACX31585.1|  molecular chaperone Hsp90-3                             321   7e-102   Nicotiana benthamiana
ref|NP_001275844.1|  HSP90 protein                                      321   8e-102   Citrus sinensis [apfelsine]
dbj|BAG16518.1|  putative Hsp90-2                                       321   8e-102   Capsicum chinense [bonnet pepper]
ref|NP_200414.1|  heat shock protein 81-2                               321   8e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31859.1|  putative heat shock protein 81-2 (HSP81-2)              321   9e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006344905.1|  PREDICTED: heat shock cognate protein 80-like      321   9e-102   Solanum tuberosum [potatoes]
gb|AGU99972.1|  HSP90                                                   321   1e-101   Populus tomentosa [Chinese white poplar]
gb|AAB33937.1|  heat-shock Protein                                      321   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544594.1|  PREDICTED: heat shock cognate protein 80-like      321   1e-101   Glycine max [soybeans]
ref|NP_200412.1|  Heat shock protein 90-3                               321   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27172.1|  hypothetical protein AALP_AA8G344900                    321   1e-101   Arabis alpina [alpine rockcress]
ref|XP_008218765.1|  PREDICTED: heat shock protein 90-2                 321   1e-101   Prunus mume [ume]
ref|XP_002866122.1|  heat shock protein 81-4                            321   1e-101   
ref|NP_200411.1|  Heat shock protein 90-4                               320   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236599.1|  heat shock protein 90-2                            321   1e-101   
gb|AAL49788.1|  putative heat shock protein 90                          320   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002299048.1|  hypothetical protein POPTR_0001s47020g             320   1e-101   Populus trichocarpa [western balsam poplar]
ref|XP_010928158.1|  PREDICTED: heat shock protein 81-1-like            320   1e-101   Elaeis guineensis
ref|XP_010483071.1|  PREDICTED: heat shock protein 90-3-like            320   2e-101   Camelina sativa [gold-of-pleasure]
dbj|BAD04054.1|  heat shock protein 90                                  320   2e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659612.1|  PREDICTED: heat shock protein 81-1-like            320   2e-101   Oryza brachyantha
gb|EYU33725.1|  hypothetical protein MIMGU_mgv1a002215mg                320   2e-101   Erythranthe guttata [common monkey flower]
ref|XP_010545291.1|  PREDICTED: heat shock protein 90-2-like            320   2e-101   Tarenaya hassleriana [spider flower]
ref|XP_010483070.1|  PREDICTED: heat shock protein 90-3-like            320   3e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006280103.1|  hypothetical protein CARUB_v10025991mg             320   3e-101   Capsella rubella
ref|XP_009132345.1|  PREDICTED: heat shock protein 90-2                 320   3e-101   Brassica rapa
ref|NP_001063503.1|  Os09g0482400                                       320   3e-101   
ref|XP_002444804.1|  hypothetical protein SORBIDRAFT_07g028270          320   3e-101   Sorghum bicolor [broomcorn]
ref|NP_001063500.1|  Os09g0482100                                       320   3e-101   
gb|AGC60019.1|  heat shock protein 90                                   319   3e-101   Saccharum hybrid cultivar SP80-3280
tpg|DAA61990.1|  TPA: putative heat shock protein 90 family protein     317   4e-101   
ref|XP_010913224.1|  PREDICTED: heat shock protein 81-1-like            319   4e-101   Elaeis guineensis
ref|XP_010443241.1|  PREDICTED: heat shock protein 90-3-like            319   4e-101   Camelina sativa [gold-of-pleasure]
ref|XP_007208337.1|  hypothetical protein PRUPE_ppa002220mg             319   4e-101   Prunus persica
ref|XP_009362097.1|  PREDICTED: heat shock protein 90-2                 319   4e-101   Pyrus x bretschneideri [bai li]
gb|ACX37413.1|  cytosolic heat shock protein 90.1                       319   4e-101   Dactylis glomerata [cocksfoot]
ref|NP_001170475.1|  LOC100384473                                       319   4e-101   Zea mays [maize]
ref|XP_002532177.1|  heat shock protein, putative                       319   5e-101   Ricinus communis
ref|XP_010913223.1|  PREDICTED: heat shock protein 81-1-like            319   5e-101   Elaeis guineensis
emb|CDY11921.1|  BnaC03g13470D                                          314   5e-101   Brassica napus [oilseed rape]
ref|XP_009367265.1|  PREDICTED: heat shock protein 90-2                 319   5e-101   Pyrus x bretschneideri [bai li]
ref|XP_006659551.1|  PREDICTED: heat shock protein 81-1-like isof...    319   5e-101   
ref|XP_006659553.1|  PREDICTED: heat shock protein 81-1-like            319   6e-101   
ref|XP_006659552.1|  PREDICTED: heat shock protein 81-1-like isof...    319   6e-101   
ref|XP_004500151.1|  PREDICTED: heat shock cognate protein 80-like      318   7e-101   Cicer arietinum [garbanzo]
ref|XP_006452664.1|  hypothetical protein CICLE_v10007633mg             318   7e-101   Citrus clementina [clementine]
ref|XP_008776162.1|  PREDICTED: heat shock protein 81-1                 318   7e-101   Phoenix dactylifera
ref|XP_009391803.1|  PREDICTED: heat shock protein 81-1-like            318   7e-101   Musa acuminata subsp. malaccensis [pisang utan]
sp|A2YWQ1.1|HSP81_ORYSI  RecName: Full=Heat shock protein 81-1; S...    318   8e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              319   8e-101   Setaria italica
gb|AGB76029.1|  heat shock protein 90                                   318   8e-101   Salicornia europaea [chicken-claws]
ref|XP_009132342.1|  PREDICTED: heat shock protein 90-2-like            318   1e-100   Brassica rapa
gb|ACN27969.1|  unknown                                                 318   1e-100   Zea mays [maize]
ref|XP_001777414.1|  predicted protein                                  318   1e-100   
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            318   1e-100   Phoenix dactylifera
ref|NP_001234439.1|  heat shock cognate protein 80                      318   1e-100   Solanum lycopersicum
ref|XP_008670278.1|  PREDICTED: heat shock protein 81-1-like            318   1e-100   Zea mays [maize]
ref|XP_008652859.1|  PREDICTED: heat shock protein 81-1                 318   1e-100   
ref|XP_010063241.1|  PREDICTED: heat shock cognate protein 80-like      318   1e-100   Eucalyptus grandis [rose gum]
ref|XP_009132299.1|  PREDICTED: heat shock protein 90-2-like            318   2e-100   Brassica rapa
ref|XP_001779443.1|  predicted protein                                  318   2e-100   
ref|XP_004294900.1|  PREDICTED: heat shock protein 90-2                 318   2e-100   Fragaria vesca subsp. vesca
ref|XP_007142447.1|  hypothetical protein PHAVU_008G281400g             317   2e-100   Phaseolus vulgaris [French bean]
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg             318   2e-100   Eutrema salsugineum [saltwater cress]
ref|XP_009417329.1|  PREDICTED: heat shock protein 81-1                 317   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010536759.1|  PREDICTED: heat shock protein 90-2-like            317   2e-100   Tarenaya hassleriana [spider flower]
ref|XP_002462554.1|  hypothetical protein SORBIDRAFT_02g028020          317   2e-100   Sorghum bicolor [broomcorn]
gb|KFK40163.1|  hypothetical protein AALP_AA3G338900                    317   3e-100   Arabis alpina [alpine rockcress]
ref|XP_002869603.1|  early-responsive to dehydration 8                  317   3e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_001766228.1|  predicted protein                                  317   3e-100   
emb|CDY06551.1|  BnaC02g12750D                                          313   4e-100   
ref|XP_010483069.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    317   4e-100   
gb|AEK20869.1|  heat shock protein 90-2                                 317   4e-100   Cryptocoryne ciliata
ref|NP_001170480.1|  HSP protein                                        317   4e-100   Zea mays [maize]
ref|XP_002460433.1|  hypothetical protein SORBIDRAFT_02g028050          317   4e-100   Sorghum bicolor [broomcorn]
ref|XP_009383207.1|  PREDICTED: heat shock protein 81-1-like            317   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010047845.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    317   5e-100   Eucalyptus grandis [rose gum]
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          317   5e-100   Sorghum bicolor [broomcorn]
gb|EYU31897.1|  hypothetical protein MIMGU_mgv1a002208mg                316   6e-100   Erythranthe guttata [common monkey flower]
gb|KFK29176.1|  hypothetical protein AALP_AA7G099100                    316   6e-100   Arabis alpina [alpine rockcress]
emb|CDY20742.1|  BnaA02g08820D                                          312   6e-100   Brassica napus [oilseed rape]
ref|XP_010055687.1|  PREDICTED: heat shock protein 90-1-like            316   6e-100   Eucalyptus grandis [rose gum]
ref|XP_002300303.1|  HSP80 family protein                               316   7e-100   Populus trichocarpa [western balsam poplar]
emb|CDY36807.1|  BnaA03g10790D                                          312   8e-100   Brassica napus [oilseed rape]
gb|ABX76302.1|  heat shock protein 90                                   316   8e-100   Ageratina adenophora
emb|CAN70887.1|  hypothetical protein VITISV_005592                     315   1e-99    Vitis vinifera
ref|XP_009420064.1|  PREDICTED: heat shock protein 81-1-like            315   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP87284.1|  cytosolic heat shock protein 90                         316   1e-99    Hordeum vulgare [barley]
emb|CDY64982.1|  BnaA02g35440D                                          311   1e-99    Brassica napus [oilseed rape]
dbj|BAJ99646.1|  predicted protein                                      315   1e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004973824.1|  PREDICTED: heat shock protein 81-1-like            315   1e-99    
gb|ABG57075.1|  heat shock protein 90                                   315   1e-99    Triticum aestivum [Canadian hard winter wheat]
gb|ADF31760.1|  heat shock protein 90                                   315   1e-99    Triticum aestivum [Canadian hard winter wheat]
gb|ADP89125.1|  heat shock protein 90                                   315   1e-99    
ref|XP_006413166.1|  hypothetical protein EUTSA_v10024564mg             315   1e-99    
gb|EMT17245.1|  Heat shock protein 81-3                                 316   1e-99    
emb|CAA72513.1|  heat shock protein                                     315   1e-99    
gb|ACN36206.1|  unknown                                                 315   2e-99    
gb|KFK25886.1|  hypothetical protein AALP_AA8G175000                    315   2e-99    
ref|XP_006413591.1|  hypothetical protein EUTSA_v10024561mg             315   2e-99    
dbj|BAO20259.1|  heat shock protein                                     315   2e-99    
ref|XP_011030250.1|  PREDICTED: heat shock protein 81-1-like            315   2e-99    
ref|XP_009390627.1|  PREDICTED: heat shock protein 81-1-like            314   3e-99    
ref|NP_001135416.2|  heat shock protein 82                              315   3e-99    
gb|AHB36893.1|  heat shock protein 90                                   314   4e-99    
gb|ADF31758.1|  heat shock protein 90                                   314   4e-99    
ref|XP_010433476.1|  PREDICTED: heat shock protein 90-2-like            314   5e-99    
ref|XP_010438732.1|  PREDICTED: heat shock protein 90-2-like            314   5e-99    
ref|XP_008811143.1|  PREDICTED: heat shock protein 81-1-like            313   9e-99    
gb|AFQ94045.1|  heat shock protein 90                                   313   1e-98    
ref|XP_002307846.1|  HSP80 family protein                               313   1e-98    
gb|AIZ68152.1|  heat shock protein 81-1                                 313   1e-98    
gb|ADF31781.1|  heat shock protein 90                                   312   2e-98    
gb|KCW90631.1|  hypothetical protein EUGRSUZ_A02734                     312   2e-98    
ref|XP_011005759.1|  PREDICTED: heat shock cognate protein 80-like      312   2e-98    
emb|CAA67191.1|  HSP80-2                                                312   3e-98    
ref|XP_003574727.1|  PREDICTED: heat shock protein 81-1                 311   4e-98    
gb|ADF31759.1|  heat shock protein 90                                   311   4e-98    
gb|EMS59444.1|  Heat shock protein 81-3                                 311   5e-98    
dbj|BAJ86355.1|  predicted protein                                      311   5e-98    
gb|ADF31757.1|  heat shock protein 90                                   311   6e-98    
ref|XP_002973159.1|  hypothetical protein SELMODRAFT_271009             311   7e-98    
ref|XP_006373573.1|  HSP80 family protein                               310   1e-97    
ref|XP_011040123.1|  PREDICTED: heat shock protein 81-1                 310   1e-97    
ref|XP_011398501.1|  Heat shock protein 90-2                            302   1e-97    
ref|XP_002969937.1|  hypothetical protein SELMODRAFT_267300             310   1e-97    
gb|ADF31773.1|  heat shock protein 90                                   309   4e-97    
gb|ACX37414.1|  cytosolic heat shock protein 90.2                       309   4e-97    
gb|KFK38607.1|  hypothetical protein AALP_AA3G136000                    307   5e-97    
ref|XP_002981406.1|  hypothetical protein SELMODRAFT_271484             309   5e-97    
ref|XP_010235286.1|  PREDICTED: heat shock protein 81-1-like            308   9e-97    
gb|KFK40822.1|  hypothetical protein AALP_AA2G045900                    292   1e-96    
ref|XP_010235281.1|  PREDICTED: heat shock protein 81-1-like            307   3e-96    
gb|KCW52046.1|  hypothetical protein EUGRSUZ_J01486                     290   1e-95    
gb|KHN23824.1|  Heat shock cognate protein 80                           305   2e-95    
gb|AAD11549.1|  heat shock protein 80                                   305   2e-95    
ref|XP_002976693.1|  hypothetical protein SELMODRAFT_151384             304   3e-95    
dbj|BAL45643.1|  heat shock protein 90                                  304   3e-95    
ref|XP_008384610.1|  PREDICTED: heat shock protein 90-2                 304   4e-95    
gb|ACM50884.1|  heat shock protein 90A                                  303   5e-95    
ref|XP_006290237.1|  hypothetical protein CARUB_v100035110mg            295   2e-94    
ref|XP_008238949.1|  PREDICTED: heat shock protein 90-1-like            301   3e-94    
gb|KCW81281.1|  hypothetical protein EUGRSUZ_C02653                     297   5e-94    
ref|XP_007510316.1|  predicted protein                                  300   7e-94    
ref|XP_002499727.1|  predicted protein                                  300   7e-94    
gb|KCW84385.1|  hypothetical protein EUGRSUZ_B01235                     295   5e-93    
ref|XP_005841364.1|  heat shock protein Hsp90, cytosolic protein        298   6e-93    
ref|XP_003058104.1|  predicted protein                                  298   6e-93    
gb|ACO58574.1|  heat shock protein 90                                   284   8e-93    
gb|KDD75584.1|  heat shock protein 90 Hsp90                             298   8e-93    
dbj|BAK08728.1|  heat shock protein 90                                  297   1e-92    
dbj|BAH97107.1|  heat shock protein of Hsp90                            297   1e-92    
gb|AFK31313.1|  heat shock protein 90                                   297   1e-92    
dbj|BAK08690.1|  heat shock protein 90                                  297   1e-92    
dbj|BAK08741.1|  heat shock protein 90                                  297   1e-92    
dbj|BAK08691.1|  heat shock protein 90                                  297   1e-92    
ref|XP_001419938.1|  Heat Shock Protein 90, cytosolic                   297   1e-92    
emb|CEF99333.1|  Histidine kinase-like ATPase, ATP-binding domain       297   1e-92    
gb|ACO58579.1|  heat shock protein 90                                   284   1e-92    
emb|CAM34507.1|  putative heat shock protein 90                         281   2e-92    
gb|ACO58578.1|  heat shock protein 90                                   283   2e-92    
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              296   2e-92    
dbj|BAK08742.1|  heat shock protein 90                                  296   2e-92    
ref|XP_005841337.1|  hypothetical protein GUITHDRAFT_83993              296   2e-92    
gb|AFK31312.1|  heat shock protein 90                                   296   3e-92    
tpg|DAA34102.1|  TPA: heat shock protein 90                             280   8e-92    
emb|CAJ28988.1|  heat shock protein 83                                  278   9e-92    
emb|CEI86384.1|  Putative Heat shock protein 90-1                       279   1e-91    
emb|CBI39793.3|  unnamed protein product                                278   1e-91    
gb|AEE01388.1|  heat shock protein 90                                   280   1e-91    
gb|AAS20999.1|  heat shock protein 82                                   281   5e-91    
dbj|BAK08743.1|  heat shock protein 90                                  293   7e-91    
gb|ADQ64484.1|  hypothetical protein                                    278   8e-91    
pdb|3INW|A  Chain A, Hsp90 N-Terminal Domain With Pochoxime A           278   1e-90    
gb|AFK39716.1|  unknown                                                 279   1e-90    
ref|XP_005643103.1|  HSP90-domain-containing protein                    292   1e-90    
gb|ADV59561.1|  heat shock protein 90                                   292   2e-90    
pdb|3D0B|A  Chain A, Crystal Structure Of Benzamide Tetrahydro-4h...    276   4e-90    
gb|EMS66149.1|  Heat shock protein 83                                   290   4e-90    
pdb|2BSM|A  Chain A, Novel, Potent Small Molecule Inhibitors Of T...    276   4e-90    
pdb|3TUH|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    275   4e-90    
pdb|3HHU|A  Chain A, Human Heat-Shock Protein 90 (Hsp90) In Compl...    276   4e-90    
pdb|2JJC|A  Chain A, Hsp90 Alpha Atpase Domain With Bound Small M...    276   4e-90    
pdb|3B24|A  Chain A, Hsp90 Alpha N-terminal Domain In Complex Wit...    276   5e-90    
pdb|1UY6|A  Chain A, Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trim...    276   5e-90    
pdb|1OSF|A  Chain A, Human Hsp90 In Complex With 17-desmethoxy-17...    275   5e-90    
pdb|3QDD|A  Chain A, Hsp90a N-Terminal Domain In Complex With Bii...    276   5e-90    
pdb|4EGH|A  Chain A, Hsp90-Alpha Atpase Domain In Complex With (4...    276   6e-90    
ref|XP_005777261.1|  hypothetical protein EMIHUDRAFT_443778             290   6e-90    
pdb|2YI0|A  Chain A, Structural Characterization Of 5-Aryl-4-(5-S...    276   6e-90    
gb|ACC43938.1|  82 kDa heat shock protein                               291   6e-90    
pdb|4NH7|A  Chain A, Correlation Between Chemotype-dependent Bind...    276   6e-90    
pdb|3BM9|A  Chain A, Discovery Of Benzisoxazoles As Potent Inhibi...    276   6e-90    
pdb|3EKO|A  Chain A, Dihydroxylphenyl Amides As Inhibitors Of The...    276   6e-90    
pdb|4AWO|A  Chain A, Complex Of Hsp90 Atpase Domain With Tropane ...    276   6e-90    
pdb|4B7P|A  Chain A, Structure Of Hsp90 With Nms-e973 Inhibitor B...    275   7e-90    
gb|AAI02619.1|  HSPCA protein                                           276   8e-90    
pdb|3K98|A  Chain A, Hsp90 N-Terminal Domain In Complex With (1r)...    276   8e-90    
pdb|3R4M|A  Chain A, Optimization Of Potent, Selective, And Orall...    275   8e-90    
pdb|4EEH|A  Chain A, Hsp90 Alpha N-Terminal Domain In Complex Wit...    275   8e-90    
ref|XP_002754345.2|  PREDICTED: heat shock protein HSP 90-alpha         276   9e-90    
dbj|BAF75925.1|  heat shock protein 90                                  288   9e-90    
pdb|2XDU|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    275   9e-90    
pdb|2K5B|A  Chain A, Human Cdc37-Hsp90 Docking Model Based On Nmr       275   1e-89    
pdb|3FT5|A  Chain A, Structure Of Hsp90 Bound With A Novel Fragment     276   1e-89    
pdb|2YE2|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    276   1e-89    
gb|AAI51819.1|  HSPCA protein                                           276   1e-89    
gb|EMT27103.1|  Heat shock protein 83                                   289   1e-89    
pdb|2FWY|A  Chain A, Structure Of Human Hsp90-Alpha Bound To The ...    276   1e-89    
pdb|3K97|A  Chain A, Hsp90 N-Terminal Domain In Complex With 4-Ch...    276   1e-89    
gb|AEI70669.1|  heat shock protein 90 alpha-1                           275   1e-89    
gb|AAI60441.1|  Unknown (protein for IMAGE:7558608)                     276   1e-89    
gb|ETW37559.1|  hsp90-like protein                                      273   1e-89    
pdb|2CCS|A  Chain A, Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Y...    275   2e-89    
pdb|1BYQ|A  Chain A, Hsp90 N-Terminal Domain Bound To Adp-Mg            275   2e-89    
gb|AAC07946.1|  82 kDa heat shock protein                               276   2e-89    
pdb|2YJW|A  Chain A, Tricyclic Series Of Hsp90 Inhibitors               274   2e-89    
gb|AAC07928.1|  82 kDa heat shock protein                               276   2e-89    
gb|AAC07917.1|  82 kDa heat shock protein                               276   2e-89    
gb|AAC07921.1|  82 kDa heat shock protein                               276   2e-89    
gb|AEX08891.1|  heat-shock protein 90                                   273   2e-89    
gb|AAL83217.1|AF473560_1  heat shock protein 90 alpha                   274   2e-89    
pdb|4LWE|A  Chain A, Crystal Structure Of The Human Hsp90-alpha N...    273   2e-89    
emb|CAG32523.1|  hypothetical protein RCJMB04_28d6                      274   2e-89    
pdb|2QFO|A  Chain A, Hsp90 Complexed With A143571 And A516383           273   2e-89    
gb|AEP39605.1|  heat shock protein 90                                   288   2e-89    
sp|O16087.1|HSP83_DROMI  RecName: Full=Heat shock protein 83; Alt...    276   3e-89    
pdb|1UYI|A  Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benz...    274   3e-89    
pdb|2XJG|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    275   3e-89    
dbj|BAC40681.1|  unnamed protein product                                275   3e-89    
emb|CAG31138.1|  hypothetical protein RCJMB04_2l3                       274   4e-89    
pdb|2YEE|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    275   4e-89    
emb|CAG31600.1|  hypothetical protein RCJMB04_8j21                      274   4e-89    
gb|KCW79839.1|  hypothetical protein EUGRSUZ_C01179                     288   5e-89    
pdb|2YE7|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    274   6e-89    
gb|ACC43981.1|  82 kDa heat shock protein                               288   6e-89    
pdb|2QF6|A  Chain A, Hsp90 Complexed With A56322                        272   7e-89    
pdb|1YC1|A  Chain A, Crystal Structures Of Human Hsp90alpha Compl...    274   7e-89    
pdb|3K60|A  Chain A, Crystal Structure Of N-Terminal Domain Of Pl...    273   8e-89    
gb|ACC43967.1|  82 kDa heat shock protein                               288   1e-88    
gb|KCW82680.1|  hypothetical protein EUGRSUZ_C04059                     281   1e-88    
emb|CAA30255.1|  unnamed protein product                                275   1e-88    
gb|AAC07938.1|  82 kDa heat shock protein                               274   1e-88    
ref|XP_001695264.1|  heat shock protein 90A                             286   1e-88    
gb|AAC07924.1|  82 kDa heat shock protein                               274   1e-88    
gb|EPZ35272.1|  Heat shock protein 81-2                                 287   2e-88    
pdb|2XJJ|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    273   2e-88    
gb|AAC07939.1|  82 kDa heat shock protein                               273   2e-88    
gb|AAC07942.1|  82 kDa heat shock protein                               273   2e-88    
gb|AAC07922.1|  82 kDa heat shock protein                               273   2e-88    
gb|ACC43956.1|  82 kDa heat shock protein                               287   2e-88    
gb|AIU47029.1|  heat shock protein                                      278   2e-88    
gb|AAC07919.1|  82 kDa heat shock protein                               273   2e-88    
gb|EGV94858.1|  Heat shock protein HSP 90-alpha                         275   2e-88    
gb|ACF16064.1|  hsp82                                                   286   3e-88    
gb|AAC07936.1|  82 kDa heat shock protein                               273   3e-88    
gb|AAC07915.1|  82 kDa heat shock protein                               273   3e-88    
gb|AJG42174.1|  heat shock protein 90                                   270   3e-88    
emb|CDY11961.1|  BnaC03g13870D                                          276   3e-88    
gb|AAC07927.1|  82 kDa heat shock protein                               273   3e-88    
gb|AAC07914.1|  82 kDa heat shock protein                               273   3e-88    
ref|XP_004367478.1|  heat shock protein 90 alpha, putative              286   4e-88    
ref|XP_002021280.1|  Hsp83                                              275   4e-88    
ref|XP_308799.3|  AGAP006959-PA                                         276   5e-88    
gb|ACD88948.1|  hsp82                                                   286   6e-88    
ref|XP_008628073.1|  PREDICTED: putative heat shock protein HSP 9...    275   6e-88    
gb|AAB46677.1|  heat shock protein 83                                   275   6e-88    
sp|P04810.1|HSP83_DROSI  RecName: Full=Heat shock protein 83; Alt...    275   7e-88    
gb|AAB46685.1|  heat shock protein 83                                   275   8e-88    
sp|P04811.1|HSP83_DROVI  RecName: Full=Heat shock protein 83; Alt...    275   8e-88    
gb|AAC07947.1|  82 kDa heat shock protein                               272   8e-88    
ref|XP_008216018.1|  PREDICTED: heat shock protein 83-like              283   1e-87    
gb|AAC07940.1|  82 kDa heat shock protein                               271   1e-87    
gb|AAC07935.1|  82 kDa heat shock protein                               271   1e-87    
gb|AAA37868.1|  heat-shock protein hsp86                                274   1e-87    
ref|XP_003704636.1|  PREDICTED: heat shock protein 83-like              285   1e-87    
ref|XP_308797.3|  AGAP006961-PA                                         275   1e-87    
gb|ACD88973.1|  hsp82                                                   285   1e-87    
gb|AAC07923.1|  82 kDa heat shock protein                               271   1e-87    
gb|AAC07920.1|  82 kDa heat shock protein                               271   2e-87    
ref|XP_006619000.1|  PREDICTED: heat shock protein HSP 90-alpha-like    284   2e-87    
gb|ADG23114.1|  molecular chaperone                                     267   2e-87    
ref|XP_007986070.1|  PREDICTED: heat shock protein HSP 90-alpha         275   2e-87    
ref|NP_001153536.1|  heat shock protein 90                              284   2e-87    
gb|AAC07944.1|  82 kDa heat shock protein                               271   2e-87    
gb|AAC07943.1|  82 kDa heat shock protein                               271   2e-87    
gb|AAC07937.1|  82 kDa heat shock protein                               271   2e-87    
gb|AIL52741.1|  heat shock protein 90                                   284   2e-87    
emb|CAA27439.1|  hsp 82                                                 274   3e-87    
ref|XP_011154034.1|  PREDICTED: heat shock protein 83                   283   3e-87    
ref|XP_008917763.1|  PREDICTED: heat shock protein HSP 90-alpha         278   3e-87    
gb|AEV53616.1|  heat shock protein 90-beta                              267   3e-87    
ref|XP_003396897.1|  PREDICTED: heat shock protein 83-like              283   3e-87    
gb|EDM18741.1|  rCG43497, isoform CRA_b                                 268   4e-87    
dbj|BAK20463.1|  heat shock protein 90                                  271   4e-87    
pdb|1UYM|A  Chain A, Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-T...    268   6e-87    
emb|CDJ58300.1|  hypothetical protein EMWEY_00014950                    275   8e-87    
ref|XP_006270466.1|  PREDICTED: heat shock protein HSP 90-alpha         273   8e-87    
gb|ADQ20111.1|  heat shock protein 90                                   282   9e-87    
ref|XP_011060405.1|  PREDICTED: heat shock protein 83                   282   9e-87    
gb|ADR79284.1|  Hsp90 alpha2                                            282   9e-87    
gb|KDR11182.1|  Heat shock protein 83                                   282   9e-87    
gb|AAW49252.2|  heat shock protein 90                                   282   1e-86    
gb|AAA36024.1|  heat shock protein 86                                   270   1e-86    
gb|AFP54306.1|  heat shock protein 90                                   282   1e-86    
gb|AAI02945.1|  HSP90AB1 protein                                        268   1e-86    
gb|AAW49253.2|  heat shock protein 90                                   281   1e-86    
gb|ADR79283.1|  Hsp90 alpha1                                            281   1e-86    
dbj|BAF57908.1|  Heat-shock protein 90                                  270   1e-86    
gb|AAZ17405.1|  90 kDa heat shock protein                               270   2e-86    
pdb|3NMQ|A  Chain A, Hsp90b N-Terminal Domain In Complex With Ec4...    267   2e-86    
gb|AAF74276.1|AF250004_1  82 kDa heat shock protein 4                   269   2e-86    
gb|KFB48797.1|  hypothetical protein ZHAS_00016808                      278   2e-86    
gb|AEA42008.1|  heat shock protein 90                                   281   2e-86    



>sp|P51819.1|HSP83_IPONI RecName: Full=Heat shock protein 83 [Ipomoea nil]
 gb|AAA33748.1| heat shock protein 83 [Ipomoea nil]
 prf||1909372A heat shock protein 83
Length=703

 Score =   358 bits (919),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  175



>ref|XP_004240717.1| PREDICTED: heat shock protein 83-like [Solanum lycopersicum]
Length=704

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  175



>ref|XP_009768512.1| PREDICTED: heat shock protein 82 [Nicotiana sylvestris]
Length=703

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEQLGR  175



>ref|XP_011084460.1| PREDICTED: heat shock protein 83-like [Sesamum indicum]
Length=703

 Score =   351 bits (900),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGE+LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEKLGR  175



>emb|CBI34381.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   338 bits (868),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            M EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFT+TRDV+GEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVNGEQLGR  170



>ref|XP_004234218.1| PREDICTED: heat shock protein 83 [Solanum lycopersicum]
Length=704

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEQLGR  175



>ref|XP_002513649.1| heat shock protein, putative [Ricinus communis]
 gb|EEF49052.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_006362664.1| PREDICTED: heat shock protein 83-like [Solanum tuberosum]
Length=704

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_009607669.1| PREDICTED: heat shock protein 82 [Nicotiana tomentosiformis]
Length=703

 Score =   350 bits (899),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_009802902.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83-like [Nicotiana 
sylvestris]
Length=703

 Score =   350 bits (897),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVHMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>emb|CBI22652.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   345 bits (885),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGR  175



>ref|XP_010261331.1| PREDICTED: heat shock protein 83 [Nelumbo nucifera]
Length=703

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>gb|KDP22224.1| hypothetical protein JCGZ_26055 [Jatropha curcas]
Length=703

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSI+DSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSILDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGR  175



>dbj|BAD95030.1| heat-shock protein [Arabidopsis thaliana]
Length=246

 Score =   334 bits (856),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/170 (95%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK+NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  170



>emb|CDP05141.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD  GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTSGEQLGR  175



>ref|XP_008234835.1| PREDICTED: heat shock protein 83 [Prunus mume]
Length=703

 Score =   348 bits (892),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_007220219.1| hypothetical protein PRUPE_ppa002187mg [Prunus persica]
 gb|EMJ21418.1| hypothetical protein PRUPE_ppa002187mg [Prunus persica]
Length=703

 Score =   347 bits (891),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_006372391.1| hypothetical protein POPTR_0017s01160g [Populus trichocarpa]
 gb|ERP50188.1| hypothetical protein POPTR_0017s01160g [Populus trichocarpa]
Length=703

 Score =   347 bits (891),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDKTN TLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_008439282.1| PREDICTED: heat shock protein 83 [Cucumis melo]
Length=703

 Score =   347 bits (890),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+ESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_002278894.1| PREDICTED: heat shock protein 83 [Vitis vinifera]
Length=703

 Score =   347 bits (890),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV M EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVAMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFT+TRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVNGEQLGR  175



>ref|XP_011046024.1| PREDICTED: heat shock protein 83 [Populus euphratica]
Length=703

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDKTN TLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_009368732.1| PREDICTED: heat shock protein 83 [Pyrus x bretschneideri]
Length=703

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGR  175



>ref|XP_008801780.1| PREDICTED: heat shock protein 83 [Phoenix dactylifera]
Length=703

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+ESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQYIWESQAGGSFTVTRDV GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGR  175



>ref|XP_010941080.1| PREDICTED: heat shock protein 83 [Elaeis guineensis]
Length=702

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+ESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQYIWESQAGGSFTVTRDV GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGR  175



>ref|XP_010276895.1| PREDICTED: heat shock protein 83-like [Nelumbo nucifera]
Length=701

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQ+ +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQIGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>prf||1908431A heat shock protein HSP81-1
Length=705

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK+NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>ref|XP_007038813.1| Heat shock protein 90.1 isoform 1 [Theobroma cacao]
 gb|EOY23314.1| Heat shock protein 90.1 isoform 1 [Theobroma cacao]
Length=703

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVT+KHNDDEQYIWESQAGGSFTVTRDV+GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTSKHNDDEQYIWESQAGGSFTVTRDVNGEPLGR  175



>ref|NP_200076.1| heat shock protein 90.1 [Arabidopsis thaliana]
 dbj|BAA98082.1| heat-shock protein [Arabidopsis thaliana]
 gb|AAM91104.1| AT5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AAN46890.1| At5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AED96244.1| heat shock protein 90.1 [Arabidopsis thaliana]
Length=705

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK+NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>ref|XP_002305263.1| hypothetical protein POPTR_0004s07190g [Populus trichocarpa]
 gb|EEE85774.1| hypothetical protein POPTR_0004s07190g [Populus trichocarpa]
Length=703

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV+M EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVKMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDKTN TLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGR  175



>gb|KJB52728.1| hypothetical protein B456_008G274600 [Gossypium raimondii]
Length=703

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV+MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVKMADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>gb|AAA32822.1| heat shock protein 83 [Arabidopsis thaliana]
Length=705

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>prf||1710352A heat shock protein 83
Length=705

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>emb|CAN73318.1| hypothetical protein VITISV_007727 [Vitis vinifera]
Length=704

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGR  175



>ref|XP_002274022.1| PREDICTED: heat shock protein 83-like [Vitis vinifera]
Length=704

 Score =   345 bits (885),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGR  175



>ref|XP_004140753.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 ref|XP_004157188.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 gb|KGN57413.1| hypothetical protein Csa_3G183950 [Cucumis sativus]
Length=703

 Score =   345 bits (885),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+ESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIR+VPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_010060433.1| PREDICTED: heat shock protein 83-like [Eucalyptus grandis]
 gb|KCW90632.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=704

 Score =   345 bits (885),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+E LTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYEGLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDKTNKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKTNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGR  175



>emb|CAA68885.1| heat shock protein 90A [Arabidopsis thaliana]
Length=704

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKPNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>gb|EYU19581.1| hypothetical protein MIMGU_mgv1a002166mg [Erythranthe guttata]
Length=706

 Score =   345 bits (884),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD DGEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDDDGEQLGR  175



>ref|XP_008376647.1| PREDICTED: heat shock protein 83 isoform X1 [Malus domestica]
 ref|XP_008376648.1| PREDICTED: heat shock protein 83 isoform X2 [Malus domestica]
Length=703

 Score =   344 bits (883),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSF VTRDV GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFIVTRDVSGEQLGR  175



>ref|XP_009375529.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
Length=703

 Score =   344 bits (883),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMHDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGR  175



>ref|XP_002864186.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40445.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
Length=705

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>ref|XP_010442803.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=705

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>emb|CDY27839.1| BnaC09g28660D [Brassica napus]
Length=705

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>ref|XP_008380194.1| PREDICTED: heat shock protein 83-like [Malus domestica]
Length=703

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMHDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGR  175



>ref|XP_006280097.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
 gb|EOA12995.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
Length=705

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>dbj|BAJ34368.1| unnamed protein product [Thellungiella halophila]
Length=705

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>ref|XP_010934626.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
 ref|XP_010934627.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=702

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MAD+QM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+E LTDKS
Sbjct  1    MADIQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYEGLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQYIWESQAGGSFTVTRDV GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGR  175



>gb|KFK26865.1| hypothetical protein AALP_AA8G303900 [Arabis alpina]
Length=705

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>gb|AIZ68157.1| heat shock protein 83 [Ornithogalum saundersiae]
Length=701

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+ESLTDKS
Sbjct  1    MADVQMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDKTNKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKTNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTK+NDDEQYIWESQAGGSFTVTRD  GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKNNDDEQYIWESQAGGSFTVTRDTSGEQLGR  175



>ref|XP_011035346.1| PREDICTED: heat shock protein 83-like isoform X1 [Populus euphratica]
Length=703

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV+M EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRF SLTDKS
Sbjct  1    MADVKMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFASLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_010671625.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=703

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV M EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVTMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD  GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTTGEQLGR  175



>ref|XP_010482633.1| PREDICTED: heat shock protein 90-1 [Camelina sativa]
Length=705

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRMVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>ref|XP_010537148.1| PREDICTED: heat shock protein 83 [Tarenaya hassleriana]
Length=702

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGR  175



>ref|XP_009377558.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
 ref|XP_009377599.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
Length=703

 Score =   343 bits (879),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM +AETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMHDAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGR  175



>ref|XP_010089052.1| Heat shock protein 83 [Morus notabilis]
 gb|EXB37299.1| Heat shock protein 83 [Morus notabilis]
Length=703

 Score =   342 bits (877),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQM E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MAEVQMGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK +KTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKASKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD +GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTEGEQLGR  175



>ref|XP_006828794.1| hypothetical protein AMTR_s00001p00118120 [Amborella trichopoda]
 gb|ERM96210.1| hypothetical protein AMTR_s00001p00118120 [Amborella trichopoda]
Length=705

 Score =   342 bits (876),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 172/177 (97%), Gaps = 2/177 (1%)
 Frame = +2

Query  113  MADVQMA--EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            MADVQMA  EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  1    MADVQMAGGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  60

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGA
Sbjct  61   KSKLDAQPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGA  120

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV+GE LGR
Sbjct  121  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEPLGR  177



>ref|XP_003592196.1| Heat shock protein [Medicago truncatula]
 gb|AES62447.1| heat shock protein 81-2 [Medicago truncatula]
Length=689

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+ +M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MAEFEMCDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  175



>ref|XP_011076104.1| PREDICTED: heat shock protein 83 [Sesamum indicum]
Length=698

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  170



>gb|KHN09298.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD DGEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGR  170



>ref|XP_003533977.1| PREDICTED: heat shock protein 83-like [Glycine max]
 gb|KHN42443.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   340 bits (872),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKDNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD DGEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGR  170



>ref|XP_006599549.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=699

 Score =   340 bits (871),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLS+IDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSVIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD DGEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGR  170



>ref|XP_011080917.1| PREDICTED: heat shock protein 83-like [Sesamum indicum]
Length=704

 Score =   340 bits (871),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM E+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMGESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KL++QPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLESQPELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGR  175



>ref|XP_008797179.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=701

 Score =   339 bits (870),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV M E+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+ESLTDKS
Sbjct  1    MADVHMGESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYS+YLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDV+GE LGR
Sbjct  121  SMIGQFGVGFYSSYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEPLGR  175



>ref|XP_010445119.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=706

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 171/176 (97%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQ-LGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE  LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLLGR  176



>ref|XP_004516872.1| PREDICTED: heat shock protein 83-like [Cicer arietinum]
Length=699

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADGETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD DGEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGR  170



>gb|AFK35835.1| unknown [Lotus japonicus]
Length=190

 Score =   322 bits (825),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L++IDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTLIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGESLGR  170



>gb|KDO76323.1| hypothetical protein CISIN_1g005321mg [Citrus sinensis]
Length=702

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV M E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKS
Sbjct  1    MADVHMGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGR  175



>ref|XP_006476504.1| PREDICTED: heat shock protein 83-like [Citrus sinensis]
Length=701

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV M E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKS
Sbjct  1    MADVHMGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NKTLSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGR  175



>ref|XP_006439485.1| hypothetical protein CICLE_v10019095mg [Citrus clementina]
 gb|ESR52725.1| hypothetical protein CICLE_v10019095mg [Citrus clementina]
Length=702

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV M E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVHMGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIR+VPDK NK LSIIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRIVPDKANKALSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGR  175



>gb|KJB24312.1| hypothetical protein B456_004G138600 [Gossypium raimondii]
Length=543

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 169/176 (96%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MADVQM-AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK  289
            MADV M +E+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFE LTDK
Sbjct  1    MADVHMGSESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDK  60

Query  290  SKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGAD  469
            SKLDAQPELFIR++PDK NKTLSI+DSGVGM KADLVNNLGTIARSGTKEFMEALQAGAD
Sbjct  61   SKLDAQPELFIRIIPDKANKTLSIVDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGAD  120

Query  470  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD+ GE LGR
Sbjct  121  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDLGGEPLGR  176



>ref|XP_009413748.1| PREDICTED: heat shock protein 83 [Musa acuminata subsp. malaccensis]
Length=702

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQM E ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNASDALDKIRFESLTDKS
Sbjct  1    MAEVQMGETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQPELFIRLVPDK NKTLSIIDSG GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQPELFIRLVPDKANKTLSIIDSGNGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY WESQAGGSFTVTRD  GEQLGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYTWESQAGGSFTVTRDTTGEQLGR  175



>ref|XP_010089053.1| Heat shock protein 83 [Morus notabilis]
 gb|EXB37300.1| Heat shock protein 83 [Morus notabilis]
Length=701

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV+M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS
Sbjct  1    MADVRMGKTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD+QPELFIR+VPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDSQPELFIRIVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY WESQAGGSFTVTRDV+GE LGR
Sbjct  121  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYAWESQAGGSFTVTRDVNGEPLGR  175



>ref|XP_004308051.1| PREDICTED: heat shock protein 83 [Fragaria vesca subsp. vesca]
Length=703

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADVQMGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAG-AD  469
            KLDAQPELFIRLVPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL +G +D
Sbjct  61   KLDAQPELFIRLVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALASGVSD  120

Query  470  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+GEQLGR
Sbjct  121  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGR  176



>gb|AAQ08597.1| heat shock protein [Hevea brasiliensis]
Length=698

 Score =   337 bits (863),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV+G+QLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGDQLGR  170



>gb|EAZ29453.1| hypothetical protein OsJ_13528 [Oryza sativa Japonica Group]
Length=434

 Score =   328 bits (842),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  116  ADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSK  295
             DVQMAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSK
Sbjct  5    GDVQMAEKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK  64

Query  296  LDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVS  475
            LDAQPELFIRLVP K +KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGADVS
Sbjct  65   LDAQPELFIRLVPYKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVS  124

Query  476  MIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            MIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVT D  GE+LGR
Sbjct  125  MIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGR  178



>gb|EYU25148.1| hypothetical protein MIMGU_mgv1a002213mg [Erythranthe guttata]
Length=700

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFE LTDKSKLD+Q
Sbjct  1    MADGETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFT+TRDVDGEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVDGEQLGR  170



>ref|XP_007152171.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
 gb|ESW24165.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
Length=700

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPD+ NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDQANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD DGEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTDGEQLGR  170



>gb|EEC84771.1| hypothetical protein OsI_31801 [Oryza sativa Indica Group]
Length=184

 Score =   319 bits (817),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_010035175.1| PREDICTED: heat shock protein 83 [Eucalyptus grandis]
 gb|KCW46468.1| hypothetical protein EUGRSUZ_K00295 [Eucalyptus grandis]
Length=700

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIR+ESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPD+ NKTL+IIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDRANKTLAIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDV GEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGR  170



>ref|XP_007040338.1| Heat shock protein 90.1 [Theobroma cacao]
 gb|EOY24839.1| Heat shock protein 90.1 [Theobroma cacao]
Length=705

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 170/176 (97%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MADVQM-AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK  289
            MADV M +E+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK
Sbjct  1    MADVHMGSESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK  60

Query  290  SKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGAD  469
            SKLDAQPELFIR++PDK NKTLSI+DSG+GM KADLVNNLGTIARSGTKEFMEALQAGAD
Sbjct  61   SKLDAQPELFIRIIPDKINKTLSIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGAD  120

Query  470  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGR  176



>dbj|BAA00615.1| 81kDa heat-shock protein [Arabidopsis thaliana]
Length=700

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/170 (95%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK+NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  170



>sp|P27323.3|HS901_ARATH RecName: Full=Heat shock protein 90-1; Short=AtHSP90.1; AltName: 
Full=Heat shock protein 81-1; Short=HSP81-1; AltName: Full=Heat 
shock protein 83 [Arabidopsis thaliana]
Length=700

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/170 (95%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK+NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  170



>ref|XP_009119805.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 90-1 [Brassica 
rapa]
Length=710

 Score =   335 bits (859),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQ+LSLIINTFYSNKEI LR+LISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQILSLIINTFYSNKEILLRDLISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIID G+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDXGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIG FGVGFYS+YLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGHFGVGFYSSYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  175



>gb|KEH26332.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   334 bits (857),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK N TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKANNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD DGEQLGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGR  170



>gb|KHG00618.1| Heat shock 90-1 -like protein [Gossypium arboreum]
Length=707

 Score =   335 bits (858),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 170/177 (96%), Gaps = 2/177 (1%)
 Frame = +2

Query  113  MADVQM--AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            MADV M  AE+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  1    MADVHMGGAESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  60

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIR++PDK NKTLSI+DSG+GM KA+LVNNLGTIARSGTKEFMEALQAGA
Sbjct  61   KSKLDAQPELFIRIIPDKANKTLSIVDSGIGMTKAELVNNLGTIARSGTKEFMEALQAGA  120

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGR  177



>gb|KJB20596.1| hypothetical protein B456_003G155600 [Gossypium raimondii]
Length=707

 Score =   334 bits (857),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 170/177 (96%), Gaps = 2/177 (1%)
 Frame = +2

Query  113  MADVQM--AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            MADV M  AE+ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTD
Sbjct  1    MADVHMGGAESETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTD  60

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIR++PDK NKTLSI+DSGVGM KA+LVNNLGTIARSGTKEFMEALQAGA
Sbjct  61   KSKLDAQPELFIRIIPDKANKTLSIVDSGVGMTKAELVNNLGTIARSGTKEFMEALQAGA  120

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGR  177



>gb|AEC11021.1| heat shock protein 90, partial [Camellia sinensis]
Length=240

 Score =   319 bits (817),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIV +KHNDDEQY+WESQAGGSFTVTRD   E LGR
Sbjct  121  FGVGFYSAYLVAEKVIVVSKHNDDEQYVWESQAGGSFTVTRDTTDESLGR  170



>gb|KJB24311.1| hypothetical protein B456_004G138600 [Gossypium raimondii]
Length=704

 Score =   334 bits (856),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 169/176 (96%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MADVQM-AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK  289
            MADV M +E+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFE LTDK
Sbjct  1    MADVHMGSESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDK  60

Query  290  SKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGAD  469
            SKLDAQPELFIR++PDK NKTLSI+DSGVGM KADLVNNLGTIARSGTKEFMEALQAGAD
Sbjct  61   SKLDAQPELFIRIIPDKANKTLSIVDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGAD  120

Query  470  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD+ GE LGR
Sbjct  121  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDLGGEPLGR  176



>gb|EEC83017.1| hypothetical protein OsI_28083 [Oryza sativa Indica Group]
Length=184

 Score =   317 bits (811),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLII TFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIIKTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_010934628.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=701

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADVQM E+ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNASDALDKIR+ESLTDKS
Sbjct  1    MADVQMGESETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRYESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDAQ ELFIRLVPDK NKTL+IIDSGVGM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAQSELFIRLVPDKVNKTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYS YLVAEKV+VTTKHNDD+ YIWESQAGGSFTVTRDV GE LGR
Sbjct  121  SMIGQFGVGFYSCYLVAEKVVVTTKHNDDDPYIWESQAGGSFTVTRDVHGEPLGR  175



>ref|XP_009628903.1| PREDICTED: heat shock protein 83-like [Nicotiana tomentosiformis]
Length=703

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MADV M E+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN SDALDKIRFESLTDKS
Sbjct  1    MADVHMGESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNCSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLDA PELFI++VPDK NKT SIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDAVPELFIKIVPDKVNKTFSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFGVGFYS+YLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRDV+GE LGR
Sbjct  121  SMIGQFGVGFYSSYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEPLGR  175



>gb|EAY92778.1| hypothetical protein OsI_14582 [Oryza sativa Indica Group]
Length=703

 Score =   332 bits (851),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  116  ADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSK  295
             DVQMAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSK
Sbjct  5    GDVQMAEKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK  64

Query  296  LDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVS  475
            LDAQPELFIRLVPDK +KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGADVS
Sbjct  65   LDAQPELFIRLVPDKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVS  124

Query  476  MIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            MIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVT D  GE+LGR
Sbjct  125  MIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGR  178



>pdb|2XCM|A Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 
Domain
 pdb|2XCM|B Chain B, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 
Domain
Length=214

 Score =   316 bits (809),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  134  EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQPE  313
            E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQPE
Sbjct  7    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  66

Query  314  LFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFG  493
            LFI ++PDK   TL+I+DSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  67   LFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  126

Query  494  VGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  127  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  174



>pdb|2JKI|A Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
 pdb|2JKI|B Chain B, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
 pdb|2JKI|C Chain C, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
Length=223

 Score =   316 bits (809),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  134  EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQPE  313
            E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQPE
Sbjct  10   ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  69

Query  314  LFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFG  493
            LFI ++PDK   TL+I+DSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  70   LFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  129

Query  494  VGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  130  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  177



>gb|AGV54249.1| heat-shock protein [Phaseolus vulgaris]
Length=703

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPD+ NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDQANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVT+D DGE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTKDTDGETLGR  170



>ref|XP_003580663.1| PREDICTED: heat shock protein 82 [Brachypodium distachyon]
Length=710

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 168/176 (95%), Gaps = 2/176 (1%)
 Frame = +2

Query  116  ADVQM--AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK  289
            ADVQM  AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDK
Sbjct  4    ADVQMGGAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDK  63

Query  290  SKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGAD  469
            SKLDAQPELFIRLVPDK  KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGAD
Sbjct  64   SKLDAQPELFIRLVPDKAAKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGAD  123

Query  470  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VSMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVT D DGE+LGR
Sbjct  124  VSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDADGERLGR  179



>gb|KDP25390.1| hypothetical protein JCGZ_20546 [Jatropha curcas]
Length=706

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 2/177 (1%)
 Frame = +2

Query  113  MADVQM--AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            MADVQM   E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  1    MADVQMRETETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  60

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLD+QPELFIR+VPDK NKTLS+IDSG+GM K DLVNNLGTIARSGTKEFMEALQAGA
Sbjct  61   KSKLDSQPELFIRIVPDKVNKTLSVIDSGIGMTKGDLVNNLGTIARSGTKEFMEALQAGA  120

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKV+VTTKHNDD+QY+WESQAGGSFTV +DVDGE LGR
Sbjct  121  DVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDDQYVWESQAGGSFTVRKDVDGEPLGR  177



>gb|ACR35758.1| unknown [Zea mays]
 gb|ACR36747.1| unknown [Zea mays]
 tpg|DAA47843.1| TPA: putative heat shock protein 90 family protein isoform 1 
[Zea mays]
 tpg|DAA47844.1| TPA: putative heat shock protein 90 family protein isoform 2 
[Zea mays]
Length=351

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK N TL+IIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>gb|ADF31778.1| heat shock protein 90 [Triticum dicoccoides]
Length=712

 Score =   329 bits (844),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 4/177 (2%)
 Frame = +2

Query  119  DVQM----AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            DVQM    AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  4    DVQMGGGAAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  63

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIRLVPDK NKTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGA
Sbjct  64   KSKLDAQPELFIRLVPDKANKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGA  123

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVT D +GE+LGR
Sbjct  124  DVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTEGERLGR  180



>emb|CDP12067.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MADVQMA-EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK  289
            MADVQMA E ETFAFQAEINQLLSLIINTFYSNKEIFLREL SNASDALDKIRFESLTDK
Sbjct  1    MADVQMAGETETFAFQAEINQLLSLIINTFYSNKEIFLRELTSNASDALDKIRFESLTDK  60

Query  290  SKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGAD  469
            SKL++QPELFIR+VPDK N+TLSIIDSGVGM K+D+VNNLGTIARSGTKEFMEALQAGAD
Sbjct  61   SKLESQPELFIRIVPDKVNRTLSIIDSGVGMTKSDMVNNLGTIARSGTKEFMEALQAGAD  120

Query  470  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VSMIGQFGVGFYS+YLVAEKV+VTTKHND EQY+WESQAGGSFTVTRDV GE LGR
Sbjct  121  VSMIGQFGVGFYSSYLVAEKVVVTTKHNDGEQYVWESQAGGSFTVTRDVSGEPLGR  176



>emb|CAE02770.2| OSJNBb0085F13.17 [Oryza sativa Japonica Group]
 emb|CAD39419.2| OSJNBa0027H06.1 [Oryza sativa Japonica Group]
Length=703

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  116  ADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSK  295
             DVQMAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSK
Sbjct  5    GDVQMAEKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK  64

Query  296  LDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVS  475
            LDAQPELFIRLVP K +KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGADVS
Sbjct  65   LDAQPELFIRLVPYKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVS  124

Query  476  MIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            MIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVT D  GE+LGR
Sbjct  125  MIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGR  178



>gb|ADF31779.1| heat shock protein 90 [Triticum dicoccoides]
Length=712

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 4/177 (2%)
 Frame = +2

Query  119  DVQM----AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            DVQM    AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  4    DVQMGGGAAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  63

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIRLVPDK  KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGA
Sbjct  64   KSKLDAQPELFIRLVPDKATKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGA  123

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVT D +GE+LGR
Sbjct  124  DVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTEGERLGR  180



>gb|ADF31754.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31763.1| heat shock protein 90 [Triticum aestivum]
Length=707

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 1/174 (1%)
 Frame = +2

Query  116  ADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSK  295
            +DVQM E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSK
Sbjct  3    SDVQM-ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK  61

Query  296  LDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVS  475
            LDAQPELFIRLVPDK NKTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGADVS
Sbjct  62   LDAQPELFIRLVPDKANKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVS  121

Query  476  MIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            MIGQFGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVT D +GE+LGR
Sbjct  122  MIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTLDTEGERLGR  175



>gb|ADF31755.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31764.1| heat shock protein 90 [Triticum aestivum]
Length=712

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 4/177 (2%)
 Frame = +2

Query  119  DVQM----AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            DVQM    AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  4    DVQMGGGAAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  63

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIRLVPDK  KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGA
Sbjct  64   KSKLDAQPELFIRLVPDKATKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGA  123

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVT D +GE+LGR
Sbjct  124  DVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTEGERLGR  180



>gb|KJB81564.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=587

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|EAZ43234.1| hypothetical protein OsJ_27834 [Oryza sativa Japonica Group]
Length=423

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>gb|ADF31756.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31765.1| heat shock protein 90 [Triticum aestivum]
Length=713

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 168/177 (95%), Gaps = 4/177 (2%)
 Frame = +2

Query  119  DVQM----AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            DVQM    AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  4    DVQMGGGAAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  63

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIRLVPDK NKTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGA
Sbjct  64   KSKLDAQPELFIRLVPDKANKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGA  123

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVT D +GE+LGR
Sbjct  124  DVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTLDTEGERLGR  180



>ref|XP_006422036.1| hypothetical protein CICLE_v10004456mg [Citrus clementina]
 ref|XP_006490631.1| PREDICTED: heat shock protein 83-like [Citrus sinensis]
 gb|ESR35276.1| hypothetical protein CICLE_v10004456mg [Citrus clementina]
Length=699

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIR++PDK NKTL+I+DSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQYIWESQAGGSFTVTRDV GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGR  170



>gb|AFR60309.1| HSP90 [Pelargonium peltatum]
Length=699

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/170 (94%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LT+KSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTEKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVG YSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGIYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDKSGEVLGR  170



>gb|ADF31772.1| heat shock protein 90 [Triticum urartu]
Length=712

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 168/177 (95%), Gaps = 4/177 (2%)
 Frame = +2

Query  119  DVQM----AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            DVQM    AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  4    DVQMGGGAAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  63

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIRLVPDK +KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGA
Sbjct  64   KSKLDAQPELFIRLVPDKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGA  123

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVT D +GE+LGR
Sbjct  124  DVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTEGERLGR  180



>gb|KDO56796.1| hypothetical protein CISIN_1g005370mg [Citrus sinensis]
Length=699

 Score =   327 bits (838),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIR++PDK NKTL+I+DSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ
Sbjct  61   PELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQYIWESQAGGSFTVTRDV GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGR  170



>gb|KDP32613.1| hypothetical protein JCGZ_13163 [Jatropha curcas]
Length=699

 Score =   327 bits (838),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGENLGR  170



>ref|XP_010252844.1| PREDICTED: heat shock cognate protein 80-like [Nelumbo nucifera]
Length=699

 Score =   327 bits (837),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN T+SIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTISIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGESLGR  170



>ref|XP_010552350.1| PREDICTED: heat shock protein 90-2 [Tarenaya hassleriana]
Length=699

 Score =   326 bits (836),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFIR+VPDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>emb|CBI25731.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   323 bits (827),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>ref|XP_002509852.1| heat shock protein, putative [Ricinus communis]
 gb|EEF51239.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   326 bits (836),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 2/177 (1%)
 Frame = +2

Query  113  MADVQMAE--AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            MAD+QM E  AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  1    MADMQMTETEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  60

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLD+QPELFIR+VPDK +KTL+IIDSG+GM KADLVNNLGTIARSGTKEFMEALQAG 
Sbjct  61   KSKLDSQPELFIRIVPDKVDKTLAIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGV  120

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKV+VTTKHNDD+QY+WESQAGGSF V +DVDGE LGR
Sbjct  121  DVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDDQYVWESQAGGSFIVRKDVDGEPLGR  177



>ref|XP_011089536.1| PREDICTED: heat shock cognate protein 80 [Sesamum indicum]
Length=699

 Score =   326 bits (836),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|AAN61003.1| putative heat shock protein 90 [Arabidopsis thaliana]
 gb|AAN64168.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=526

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>gb|KHN43913.1| Heat shock cognate protein 80 [Glycine soja]
Length=494

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVA+KVIVTTKHNDDEQY+WES AGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGR  171



>ref|XP_010910639.1| PREDICTED: heat shock protein 81-1, partial [Elaeis guineensis]
Length=565

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP
Sbjct  3    AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE+LGR
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEKLGR  171



>dbj|BAE71229.1| putative HEAT SHOCK PROTEIN 81-2 [Trifolium pratense]
Length=478

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFE LTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARS TKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSATKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGR  170



>gb|ADF31775.1| heat shock protein 90 [Aegilops tauschii]
Length=713

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 4/177 (2%)
 Frame = +2

Query  119  DVQM----AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            DVQM    AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  4    DVQMGGGAAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  63

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KS+LDAQPELFIRLVPDK NKTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGA
Sbjct  64   KSELDAQPELFIRLVPDKANKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGA  123

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVT D +GE+LGR
Sbjct  124  DVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTLDTEGERLGR  180



>emb|CDP13679.1| unnamed protein product [Coffea canephora]
Length=681

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PE FI ++PDKTN TLSI+DSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PEFFIHIIPDKTNNTLSIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGENLGR  170



>gb|ADX06844.1| molecular chaperone Hsp90 [Nicotiana tabacum]
Length=699

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_011097724.1| PREDICTED: heat shock cognate protein 80-like [Sesamum indicum]
Length=699

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|AAR12194.1| molecular chaperone Hsp90-2 [Nicotiana benthamiana]
Length=699

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_010103960.1| Heat shock cognate protein 80 [Morus notabilis]
 gb|EXB97663.1| Heat shock cognate protein 80 [Morus notabilis]
Length=732

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            M+E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MSETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEILGR  170



>gb|EPS61618.1| hypothetical protein M569_13176 [Genlisea aurea]
Length=701

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>gb|AAK91366.1| AT5g56010/MDA7_5 [Arabidopsis thaliana]
Length=527

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>gb|KJB81562.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=699

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|KHG22758.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE +GR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTTGESIGR  170



>gb|AGA62462.1| heat shock protein 90 [Gossypium hirsutum]
Length=699

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE +GR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENIGR  170



>gb|KJB81563.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=684

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_007142446.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
 gb|ESW14440.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
Length=699

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            M+E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MSETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD DGE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTDGESLGR  170



>dbj|BAJ85535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 168/179 (94%), Gaps = 5/179 (3%)
 Frame = +2

Query  116  ADVQM-----AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESL  280
            +DVQM     AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESL
Sbjct  3    SDVQMGGGAGAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESL  62

Query  281  TDKSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQA  460
            TDKSKLDAQPELFIR+VPDK  KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQA
Sbjct  63   TDKSKLDAQPELFIRIVPDKATKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQA  122

Query  461  GADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GADVSMIGQFGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQA GSFTVT D +GE+LGR
Sbjct  123  GADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQADGSFTVTLDTEGERLGR  181



>ref|XP_004169769.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate protein 80-like, 
partial [Cucumis sativus]
Length=587

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_004491531.1| PREDICTED: heat shock cognate protein 80-like isoform X2 [Cicer 
arietinum]
Length=660

 Score =   323 bits (828),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGR  170



>gb|KHG19401.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE+LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEKLGR  170



>ref|XP_002273244.1| PREDICTED: heat shock cognate protein 80-like [Vitis vinifera]
Length=704

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            P+LFI +VPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE+LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGERLGR  170



>gb|ADU04387.1| heat shock protein 90-2 [Nicotiana attenuata]
Length=699

 Score =   324 bits (830),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_006664928.1| PREDICTED: heat shock protein 82-like [Oryza brachyantha]
Length=717

 Score =   324 bits (831),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 167/176 (95%), Gaps = 2/176 (1%)
 Frame = +2

Query  116  ADVQMA--EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK  289
             DVQMA  E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK
Sbjct  4    PDVQMAAAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDK  63

Query  290  SKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGAD  469
            SKLDAQPELFIRLVPDK  KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEALQAGAD
Sbjct  64   SKLDAQPELFIRLVPDKPTKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGAD  123

Query  470  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VSMIGQFGVGFYSAYLVA++V+VTTKHNDDEQY+WESQAGGSFTV+ D +G++LGR
Sbjct  124  VSMIGQFGVGFYSAYLVADRVVVTTKHNDDEQYVWESQAGGSFTVSLDTNGDRLGR  179



>gb|AAR12193.1| molecular chaperone Hsp90-1 [Nicotiana benthamiana]
Length=699

 Score =   324 bits (830),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  G+ LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGDNLGR  170



>ref|NP_001234436.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
 gb|AAR12195.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
Length=699

 Score =   323 bits (829),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFQSLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|KGN66052.1| hypothetical protein Csa_1G569290 [Cucumis sativus]
Length=631

 Score =   322 bits (824),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|KJB22185.1| hypothetical protein B456_004G034000 [Gossypium raimondii]
Length=666

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT KHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_009758556.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_009594054.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|KJB22184.1| hypothetical protein B456_004G033900 [Gossypium raimondii]
Length=699

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT KHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_001777383.1| predicted protein [Physcomitrella patens]
 gb|EDQ57787.1| predicted protein [Physcomitrella patens]
Length=707

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  113  MADVQMA--EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            MADV +A  E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  1    MADVNLASPEIETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  60

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSK+D QPELFI +VPDK N TLSIIDSG+GM KAD+VNNLGTIARSGTKEFMEAL AGA
Sbjct  61   KSKMDGQPELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALTAGA  120

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKV+VT+KHNDDEQYIWESQAGGSFT+TRD  GEQLGR
Sbjct  121  DVSMIGQFGVGFYSAYLVAEKVVVTSKHNDDEQYIWESQAGGSFTITRDTSGEQLGR  177



>gb|ABW96308.1| heat shock protein 90 [Vitis pseudoreticulata]
Length=699

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT KHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>ref|NP_001236612.1| heat shock protein 90-1 [Glycine max]
 gb|ACI31552.1| heat shock protein 90-1 [Glycine max]
Length=702

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+I+DSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDNTGEVLGR  170



>emb|CAN62488.1| hypothetical protein VITISV_029391 [Vitis vinifera]
Length=699

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>ref|XP_004491530.1| PREDICTED: heat shock cognate protein 80-like isoform X1 [Cicer 
arietinum]
Length=699

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGR  170



>ref|XP_003635036.1| PREDICTED: heat shock cognate protein 80 [Vitis vinifera]
Length=699

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>ref|NP_001240230.1| uncharacterized protein LOC100819568 [Glycine max]
 gb|ADC45396.1| HSP90-2 [Glycine max]
 gb|KHN01774.1| Heat shock cognate protein 80 [Glycine soja]
Length=699

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+I+DSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDNTGEVLGR  170



>gb|KJB13949.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=699

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TLSIIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQ++WESQAGGSFTVTRD  GE +GR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQFVWESQAGGSFTVTRDTTGESIGR  170



>ref|XP_009607645.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_004308050.1| PREDICTED: heat shock protein 83-like [Fragaria vesca subsp. 
vesca]
Length=700

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 166/176 (94%), Gaps = 5/176 (3%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MAD     AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MADA----AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  56

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAG-AD  469
            KLDAQPELFIRLVPDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL +G +D
Sbjct  57   KLDAQPELFIRLVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALASGVSD  116

Query  470  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFT+TRDV GEQLGR
Sbjct  117  VSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVSGEQLGR  172



>ref|XP_010446135.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=437

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLG  634
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  G ++ 
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGTKIA  169



>ref|XP_011039800.1| PREDICTED: heat shock protein 90-2 [Populus euphratica]
Length=699

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKT+ TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEPLGR  170



>emb|CDY36772.1| BnaA03g11140D [Brassica napus]
 emb|CDY36776.1| BnaA03g11100D [Brassica napus]
Length=363

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGE  625
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE  166



>ref|XP_006287183.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
 gb|EOA20081.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
Length=699

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGR  170



>ref|XP_007020406.1| Heat shock protein 81.4 [Theobroma cacao]
 gb|EOY11931.1| Heat shock protein 81.4 [Theobroma cacao]
Length=699

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN +LSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE+LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDDAGEKLGR  170



>ref|XP_001780981.1| predicted protein [Physcomitrella patens]
 gb|EDQ54241.1| predicted protein [Physcomitrella patens]
Length=704

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 164/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  113  MADVQMA--EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            MADV M+  E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct  1    MADVTMSGPEVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD  60

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLD QPELFI +VPDK N TLSIIDSG+GM KAD+VNNLGTIARSGTKEFMEAL AGA
Sbjct  61   KSKLDGQPELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALSAGA  120

Query  467  DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            DVSMIGQFGVGFYSAYLVAEKV+VT+KHNDDEQYIWESQAGGSFT+TRD  GE LGR
Sbjct  121  DVSMIGQFGVGFYSAYLVAEKVVVTSKHNDDEQYIWESQAGGSFTITRDTSGEPLGR  177



>ref|XP_009591410.1| PREDICTED: heat shock cognate protein 80 [Nicotiana tomentosiformis]
 dbj|BAE97400.1| heat shock protein 90 [Nicotiana tabacum]
 dbj|BAM24708.1| Heat shock protein 90 [Nicotiana tabacum]
Length=699

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_010246543.1| PREDICTED: heat shock cognate protein 80 [Nelumbo nucifera]
Length=699

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEDLGR  170



>ref|XP_010539340.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|ADU04386.1| heat shock protein 90-1 [Nicotiana attenuata]
Length=699

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_009785111.1| PREDICTED: heat shock cognate protein 80 [Nicotiana sylvestris]
Length=699

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>gb|KHN31689.1| Heat shock cognate protein 80 [Glycine soja]
Length=700

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+I+DSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEVLGR  170



>ref|XP_009763345.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_010675973.1| PREDICTED: heat shock cognate protein 80 [Beta vulgaris subsp. 
vulgaris]
Length=698

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKL+AQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLEAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEPLGR  170



>gb|ADC45395.1| HSP90-1 [Glycine max]
Length=702

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+I+DSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEVLGR  170



>gb|AAS79798.1| heat shock protein 90 [Nicotiana tabacum]
Length=699

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKE+FLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEVFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN +L+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_006280101.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
 gb|EOA12999.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
Length=699

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGR  170



>ref|XP_008355028.1| PREDICTED: heat shock protein 90-2 [Malus domestica]
Length=694

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALSAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGR  170



>ref|XP_004135593.1| PREDICTED: heat shock cognate protein 80-like [Cucumis sativus]
Length=699

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_006352548.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTV RD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVARDTSGESLGR  170



>ref|XP_010450563.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGR  170



>ref|XP_006857538.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
 gb|ERN19005.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
Length=699

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDK + TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKASNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDSSGESLGR  170



>ref|NP_001274833.1| Hsp90-2-like [Solanum tuberosum]
 gb|ABB55365.1| Hsp90-2-like [Solanum tuberosum]
Length=700

 Score =   322 bits (824),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            M++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MSDIETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_003617873.1| Heat shock protein [Medicago truncatula]
 ref|XP_003617876.1| Heat shock protein [Medicago truncatula]
 gb|AET00832.1| heat shock protein 81-2 [Medicago truncatula]
 gb|AET00835.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   322 bits (824),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFE LTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEALGR  170



>gb|KGN66050.1| hypothetical protein Csa_1G569270 [Cucumis sativus]
Length=699

 Score =   321 bits (823),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_010443242.1| PREDICTED: heat shock protein 90-2 [Camelina sativa]
Length=699

 Score =   321 bits (823),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGR  170



>ref|XP_009126978.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=696

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+I+DSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>ref|XP_006401391.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
 dbj|BAJ33984.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42844.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
Length=699

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+I+DSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>gb|ACX31585.1| molecular chaperone Hsp90-3 [Nicotiana benthamiana]
Length=700

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQ LSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEAETFAFQAEINQQLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|NP_001275844.1| HSP90 protein [Citrus sinensis]
 gb|AFF58924.1| Hsp90 [Citrus sinensis]
Length=700

 Score =   321 bits (823),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKVIVT KHNDDEQYIWESQAGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVAEKVIVTAKHNDDEQYIWESQAGGSFTVTRDTSGEPLGR  171



>dbj|BAG16518.1| putative Hsp90-2 [Capsicum chinense]
Length=699

 Score =   321 bits (823),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADSETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+I+DSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVLVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|NP_200414.1| heat shock protein 81-2 [Arabidopsis thaliana]
 sp|P55737.1|HS902_ARATH RecName: Full=Heat shock protein 90-2; Short=AtHSP90.2; AltName: 
Full=Heat shock protein 81-2; Short=HSP81-2; AltName: Full=Protein 
EARLY-RESPONSIVE TO DEHYDRATION 8; AltName: Full=Protein 
LOSS OF RECOGNITION OF AVRRPM1 2 [Arabidopsis thaliana]
 dbj|BAB09285.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAL32828.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAM91205.1| heat shock protein 81-2 [Arabidopsis thaliana]
 gb|AAN71943.1| putative heat-shock protein HSP81-2 [Arabidopsis thaliana]
 gb|AAO00895.1| Unknown protein [Arabidopsis thaliana]
 gb|AED96711.1| heat shock protein 81-2 [Arabidopsis thaliana]
 prf||1908431B heat shock protein HSP81-2
Length=699

 Score =   321 bits (823),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGR  170



>gb|AAN31859.1| putative heat shock protein 81-2 (HSP81-2) [Arabidopsis thaliana]
Length=699

 Score =   321 bits (822),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGR  170



>ref|XP_006344905.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   321 bits (822),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFQSLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTV RD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVARDTSGEDLGR  170



>gb|AGU99972.1| HSP90 [Populus tomentosa]
Length=699

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKT+ TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDNSGEPLGR  170



>gb|AAB33937.1| heat-shock Protein [Arabidopsis thaliana]
Length=699

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>ref|XP_003544594.1| PREDICTED: heat shock cognate protein 80-like [Glycine max]
Length=700

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVA+KVIVTTKHNDDEQY+WES AGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGR  171



>ref|NP_200412.1| Heat shock protein 90-3 [Arabidopsis thaliana]
 sp|P51818.2|HS903_ARATH RecName: Full=Heat shock protein 90-3; Short=AtHSP90.3; AltName: 
Full=HSP81.2; AltName: Full=Heat shock protein 81-3; Short=HSP81-3 
[Arabidopsis thaliana]
 dbj|BAB09283.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL32910.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL91191.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AED96709.1| heat shock protein 81-3 [Arabidopsis thaliana]
Length=699

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>gb|KFK27172.1| hypothetical protein AALP_AA8G344900 [Arabis alpina]
Length=699

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>ref|XP_008218765.1| PREDICTED: heat shock protein 90-2 [Prunus mume]
Length=699

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDNSGEVLGR  170



>ref|XP_002866122.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42381.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>ref|NP_200411.1| Heat shock protein 90-4 [Arabidopsis thaliana]
 sp|O03986.1|HS904_ARATH RecName: Full=Heat shock protein 90-4; Short=AtHSP90.4; AltName: 
Full=Heat shock protein 81-4; Short=HSP81-4 [Arabidopsis 
thaliana]
 emb|CAA72514.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAB09282.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAE99287.1| heat shock protein [Arabidopsis thaliana]
 gb|AED96708.1| Heat shock protein 90-4 [Arabidopsis thaliana]
Length=699

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>ref|NP_001236599.1| heat shock protein 90-2 [Glycine max]
 gb|ACI31551.1| heat shock protein 90-2 [Glycine max]
Length=700

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVA+KVIVTTKHNDDEQY+WES AGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGR  171



>gb|AAL49788.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=699

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGR  170



>ref|XP_002299048.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
 gb|EEE83853.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
Length=699

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI +VPDKT+ TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTV RD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVIRDTSGEPLGR  170



>ref|XP_010928158.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=702

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP
Sbjct  3    AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKGSNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  171



>ref|XP_010483071.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVT+D  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTKDTSGEPLGR  170



>dbj|BAD04054.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|EAZ09522.1| hypothetical protein OsI_31797 [Oryza sativa Indica Group]
Length=699

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_006659612.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=686

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+VIVTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>gb|EYU33725.1| hypothetical protein MIMGU_mgv1a002215mg [Erythranthe guttata]
Length=700

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKL++Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLESQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGR  170



>ref|XP_010545291.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLI NTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLITNTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>ref|XP_010483070.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVT+D  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTKDTSGEPLGR  170



>ref|XP_006280103.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13001.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=699

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            P+LFI ++PDKTN TL+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGR  170



>ref|XP_009132345.1| PREDICTED: heat shock protein 90-2 [Brassica rapa]
Length=699

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINT YSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTLYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>ref|NP_001063503.1| Os09g0482400 [Oryza sativa Japonica Group]
 ref|NP_001175894.1| Os09g0482610 [Oryza sativa Japonica Group]
 sp|Q07078.2|HSP83_ORYSJ RecName: Full=Heat shock protein 81-3; Short=HSP81-3; AltName: 
Full=Gravity-specific protein GSC 381 [Oryza sativa Japonica 
Group]
 dbj|BAD33409.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25417.1| Os09g0482400 [Oryza sativa Japonica Group]
 gb|ACJ54894.1| heat shock protein [Oryza sativa Japonica Group]
 dbj|BAG88166.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01431.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94622.1| Os09g0482610 [Oryza sativa Japonica Group]
Length=699

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_002444804.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
 gb|EES14299.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
Length=698

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK N TL+IIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|NP_001063500.1| Os09g0482100 [Oryza sativa Japonica Group]
 sp|Q69QQ6.1|HSP82_ORYSJ RecName: Full=Heat shock protein 81-2; Short=HSP81-2; AltName: 
Full=Heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD33406.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25414.1| Os09g0482100 [Oryza sativa Japonica Group]
Length=699

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>gb|AGC60019.1| heat shock protein 90 [Saccharum hybrid cultivar SP80-3280]
Length=698

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK N TL+IIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>tpg|DAA61990.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=629

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  134  EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQPE  313
            E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQPE
Sbjct  4    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  314  LFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFG  493
            LFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  494  VGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_010913224.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI ++PDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  171



>ref|XP_010443241.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELF+ ++PDKTN TL+IID GVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFVHIIPDKTNNTLTIIDRGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGR  170



>ref|XP_007208337.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
 gb|EMJ09536.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
Length=699

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            P+LFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDNSGEVLGR  170



>ref|XP_009362097.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK + TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGR  170



>gb|ACX37413.1| cytosolic heat shock protein 90.1 [Dactylis glomerata]
Length=699

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK N TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQYIWESQAGGSFTV RD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVARDTTGEQLGR  171



>ref|NP_001170475.1| LOC100384473 [Zea mays]
 gb|ACO35045.1| heat shock protein 90 [Zea mays]
Length=697

 Score =   319 bits (817),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK N TL+IIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_002532177.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30214.1| heat shock protein, putative [Ricinus communis]
Length=698

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 162/170 (95%), Gaps = 1/170 (1%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TLSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRD-SGENLGR  169



>ref|XP_010913223.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI ++PDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKASSTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  171



>emb|CDY11921.1| BnaC03g13470D [Brassica napus]
Length=537

 Score =   314 bits (805),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGE  625
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE  166



>ref|XP_009367265.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK + TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGR  170



>ref|XP_006659551.1| PREDICTED: heat shock protein 81-1-like isoform X1 [Oryza brachyantha]
Length=699

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_006659553.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=699

 Score =   319 bits (817),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_006659552.1| PREDICTED: heat shock protein 81-1-like isoform X2 [Oryza brachyantha]
Length=699

 Score =   319 bits (817),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_004500151.1| PREDICTED: heat shock cognate protein 80-like [Cicer arietinum]
Length=699

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TL+I+DSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFT+TRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTITRDTSGEILGR  170



>ref|XP_006452664.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|AFF58923.1| Hsp90 [Citrus sinensis]
 gb|ESR65904.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|KDO59214.1| hypothetical protein CISIN_1g045760mg [Citrus sinensis]
Length=700

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI ++PDKTN +LSIIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNSLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKVIVT KHNDDEQYIWESQAGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVAEKVIVTAKHNDDEQYIWESQAGGSFTVTRDTSGELLGR  171



>ref|XP_008776162.1| PREDICTED: heat shock protein 81-1 [Phoenix dactylifera]
Length=700

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  171



>ref|XP_009391803.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            A+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI ++PDK   TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRDV GE LGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGESLGR  171



>sp|A2YWQ1.1|HSP81_ORYSI RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Indica Group]
 sp|Q0J4P2.2|HSP81_ORYSJ RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Japonica Group]
 emb|CAA77978.1| heat shock protein 82 (HSP82) [Oryza sativa]
 dbj|BAD08818.1| heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAD08897.1| heat shock protein 82 [Oryza sativa Japonica Group]
 gb|EAZ07512.1| hypothetical protein OsI_29768 [Oryza sativa Indica Group]
 gb|ADM86854.1| 82kDa heat shock protein [Oryza sativa Japonica Group]
Length=699

 Score =   318 bits (816),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_004974995.1| PREDICTED: heat shock protein 82-like [Setaria italica]
Length=709

 Score =   319 bits (817),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 166/178 (93%), Gaps = 4/178 (2%)
 Frame = +2

Query  116  ADVQMA---EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            ADV MA   E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD
Sbjct  4    ADVHMAGGPETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  63

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIRLVPDK +KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEAL AGA
Sbjct  64   KSKLDAQPELFIRLVPDKASKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGA  123

Query  467  -DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
             DVSMIGQFGVGFYSAYLVA+KV+VTTKHNDDEQY+WESQAGGSFTVT D  GE+LGR
Sbjct  124  TDVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGR  181



>gb|AGB76029.1| heat shock protein 90 [Salicornia europaea]
Length=696

 Score =   318 bits (816),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N +L+IIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNSLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDT-GEPLGR  169



>ref|XP_009132342.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=698

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIINTF+SNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFHSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>gb|ACN27969.1| unknown [Zea mays]
 gb|ACN28652.1| unknown [Zea mays]
 gb|AFW57714.1| putative heat shock protein 90 family protein [Zea mays]
Length=714

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 166/178 (93%), Gaps = 4/178 (2%)
 Frame = +2

Query  116  ADVQMA---EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  286
            ADV MA   E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD
Sbjct  4    ADVHMAGGAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD  63

Query  287  KSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGA  466
            KSKLDAQPELFIRLVPDK +KTLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEAL AGA
Sbjct  64   KSKLDAQPELFIRLVPDKASKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGA  123

Query  467  -DVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
             DVSMIGQFGVGFYSAYLVA++V+VTTKHNDDEQY+WESQAGGSFTVT D  GE+LGR
Sbjct  124  TDVSMIGQFGVGFYSAYLVADRVMVTTKHNDDEQYVWESQAGGSFTVTHDTTGERLGR  181



>ref|XP_001777414.1| predicted protein [Physcomitrella patens]
 gb|EDQ57818.1| predicted protein [Physcomitrella patens]
Length=704

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSK+D QP
Sbjct  6    AQVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKMDGQP  65

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK N TLSIIDSG+GM KAD+VNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  66   ELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALTAGADVSMIGQF  125

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKV+VT+KHNDDEQYIWESQAGGSFT+TRD  GEQLGR
Sbjct  126  GVGFYSAYLVAEKVVVTSKHNDDEQYIWESQAGGSFTITRDTSGEQLGR  174



>ref|XP_008811147.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=701

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK + TLSIIDSGVGM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  171



>ref|NP_001234439.1| heat shock cognate protein 80 [Solanum lycopersicum]
 sp|P36181.1|HSP80_SOLLC RecName: Full=Heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAB01376.1| heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAR12196.1| molecular chaperone Hsp90-2 [Solanum lycopersicum]
 prf||1909348A heat shock protein hsp80
Length=699

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            M++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGR  170



>ref|XP_008670278.1| PREDICTED: heat shock protein 81-1-like [Zea mays]
 tpg|DAA40366.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=698

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI LVPDK   TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHLVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVA++V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  123  GVGFYSAYLVADRVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_008652859.1| PREDICTED: heat shock protein 81-1 [Zea mays]
 tpg|DAA61991.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=699

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  134  EAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQPE  313
            E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQPE
Sbjct  4    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  314  LFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFG  493
            LFI +VPDK + TLSIIDSG+GM K+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  494  VGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            VGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTVTRD  GEQLGR
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR  171



>ref|XP_010063241.1| PREDICTED: heat shock cognate protein 80-like [Eucalyptus grandis]
 gb|KCW70449.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=703

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MAE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKV+VTTKH DDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHYDDEQYVWESQAGGSFTVTRDTSGEILGR  170



>ref|XP_009132299.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=699

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+AETFAFQAEINQLLSLIIN FYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINPFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDK N TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVA+KVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGR  170



>ref|XP_001779443.1| predicted protein [Physcomitrella patens]
 gb|EDQ55721.1| predicted protein [Physcomitrella patens]
Length=697

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  310
            AE ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKL AQP
Sbjct  4    AEVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLGAQP  63

Query  311  ELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  490
            ELFI +VPDK N TLSIIDSG+GM KAD+VNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  64   ELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALSAGADVSMIGQF  123

Query  491  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            GVGFYSAYLVAEKV+VT+KHNDDEQY+WESQAGGSFT+TRD  GEQLGR
Sbjct  124  GVGFYSAYLVAEKVVVTSKHNDDEQYMWESQAGGSFTITRDTSGEQLGR  172



>ref|XP_004294900.1| PREDICTED: heat shock protein 90-2 [Fragaria vesca subsp. vesca]
Length=697

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 1/170 (1%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKL++Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLESQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD  GE LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD-SGEPLGR  169



>ref|XP_007142447.1| hypothetical protein PHAVU_008G281400g [Phaseolus vulgaris]
 gb|ESW14441.1| hypothetical protein PHAVU_008G281400g [Phaseolus vulgaris]
Length=698

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +2

Query  128  MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  307
            M+E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLD Q
Sbjct  1    MSETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  308  PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  487
            PELFI ++PDKTN TL+IIDSG+GM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  488  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD D E LGR
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRD-DSEPLGR  169



>ref|XP_006401798.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
 gb|ESQ43251.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
Length=707

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  113  MADVQMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKS  292
            MA+VQMA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS
Sbjct  1    MAEVQMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKS  60

Query  293  KLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADV  472
            KLD QPELFIRLVPDK NKTLSIIDSG+GM KADLVNNLGTIARSGTKEFMEALQAGADV
Sbjct  61   KLDGQPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADV  120

Query  473  SMIGQFGVG--FYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGR  637
            SMIGQFG    F      +EKVIVTTKHNDDEQY+WESQAGGSFTVTRDVDGE LGR
Sbjct  121  SMIGQFGARSLFLCLSRSSEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGR  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125