BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040A06

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06309.1|  unnamed protein product                                340   1e-111   Coffea canephora [robusta coffee]
ref|XP_011096538.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    338   1e-110   Sesamum indicum [beniseed]
ref|XP_004244796.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    337   3e-110   Solanum lycopersicum
ref|XP_009763087.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    336   5e-110   Nicotiana sylvestris
ref|XP_006366097.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    335   9e-110   Solanum tuberosum [potatoes]
ref|XP_006467495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    333   9e-109   Citrus sinensis [apfelsine]
ref|XP_009596105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    332   2e-108   Nicotiana tomentosiformis
ref|XP_002519707.1|  50 kDa ketoavyl-ACP synthase                       330   1e-107   
gb|AGH32916.1|  ketoacyl-ACP synthase I                                 329   2e-107   Camellia chekiangoleosa
ref|XP_006449664.1|  hypothetical protein CICLE_v10015139mg             329   3e-107   Citrus clementina [clementine]
ref|XP_009801210.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    328   6e-107   Nicotiana sylvestris
ref|XP_008371590.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    328   7e-107   
ref|XP_009627828.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    328   8e-107   Nicotiana tomentosiformis
ref|XP_010111005.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        327   2e-106   
ref|XP_006365563.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    327   3e-106   Solanum tuberosum [potatoes]
gb|ABJ90468.1|  beta-ketoacyl-ACP synthase I                            327   3e-106   Jatropha curcas
gb|KDP37953.1|  hypothetical protein JCGZ_04596                         325   1e-105   Jatropha curcas
ref|XP_002305334.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        325   1e-105   Populus trichocarpa [western balsam poplar]
gb|AAF61738.1|AF244519_1  beta-ketoacyl-ACP synthetase 1                318   2e-105   Brassica napus [oilseed rape]
ref|XP_004233105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    325   2e-105   Solanum lycopersicum
gb|KHG12491.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    325   2e-105   Gossypium arboreum [tree cotton]
gb|ACJ07141.1|  beta-ketoacyl-ACP synthase I-2                          325   2e-105   Arachis hypogaea [goober]
ref|XP_010241300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    324   2e-105   Nelumbo nucifera [Indian lotus]
gb|KJB57278.1|  hypothetical protein B456_009G156400                    324   2e-105   Gossypium raimondii
ref|NP_001238610.1|  beta-ketoacyl-ACP synthetase I                     324   3e-105   Glycine max [soybeans]
gb|KHG12490.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    325   3e-105   Gossypium arboreum [tree cotton]
gb|ACJ07140.1|  beta-ketoacyl-ACP synthase I-1                          323   4e-105   Arachis hypogaea [goober]
ref|XP_007025115.1|  3-ketoacyl-acyl carrier protein synthase I i...    321   4e-105   
gb|ACZ06069.1|  beta-ketoacyl-ACP synthetase I                          323   5e-105   Arachis hypogaea [goober]
gb|KJB66776.1|  hypothetical protein B456_010G165600                    323   6e-105   Gossypium raimondii
gb|KJB57279.1|  hypothetical protein B456_009G156400                    324   7e-105   Gossypium raimondii
gb|KJB66777.1|  hypothetical protein B456_010G165600                    323   1e-104   Gossypium raimondii
ref|XP_010529153.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    322   2e-104   Tarenaya hassleriana [spider flower]
gb|ABM53471.1|  plastid 3-keto-acyl-ACP synthase I                      322   2e-104   Helianthus annuus
ref|XP_002316735.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        322   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_007211401.1|  hypothetical protein PRUPE_ppa005228mg             322   2e-104   Prunus persica
ref|XP_007158937.1|  hypothetical protein PHAVU_002G194300g             321   3e-104   Phaseolus vulgaris [French bean]
gb|EYU43272.1|  hypothetical protein MIMGU_mgv1a005817mg                322   3e-104   Erythranthe guttata [common monkey flower]
ref|XP_007025114.1|  3-ketoacyl-acyl carrier protein synthase I i...    323   5e-104   
gb|KEH43811.1|  3-oxoacyl-(acyl carrier) synthase II                    321   6e-104   Medicago truncatula
ref|XP_004504688.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    321   6e-104   Cicer arietinum [garbanzo]
ref|XP_007025113.1|  3-ketoacyl-acyl carrier protein synthase I i...    323   7e-104   
ref|XP_004293525.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    320   8e-104   Fragaria vesca subsp. vesca
ref|XP_011011532.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    320   1e-103   Populus euphratica
ref|XP_011012842.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    319   2e-103   Populus euphratica
ref|XP_010538529.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    319   2e-103   Tarenaya hassleriana [spider flower]
gb|KJB34973.1|  hypothetical protein B456_006G093400                    320   3e-103   Gossypium raimondii
emb|CDX77646.1|  BnaC07g19000D                                          319   3e-103   
ref|XP_003638193.1|  Beta-ketoacyl-ACP synthase I                       319   3e-103   
gb|AAC04691.1|  beta-ketoacyl-ACP synthase I                            319   3e-103   Perilla frutescens [beefsteak-mint]
emb|CDY33467.1|  BnaA06g36060D                                          318   4e-103   Brassica napus [oilseed rape]
ref|XP_010275024.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    318   4e-103   Nelumbo nucifera [Indian lotus]
ref|XP_006398324.1|  hypothetical protein EUTSA_v10000874mg             318   7e-103   Eutrema salsugineum [saltwater cress]
ref|XP_008225453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    318   9e-103   Prunus mume [ume]
emb|CDY03228.1|  BnaC09g19280D                                          317   1e-102   
emb|CDY35156.1|  BnaA09g17930D                                          317   1e-102   Brassica napus [oilseed rape]
ref|XP_009101526.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    317   2e-102   Brassica rapa
ref|XP_002272874.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    317   2e-102   Vitis vinifera
gb|KFK31480.1|  hypothetical protein AALP_AA6G117600                    317   2e-102   Arabis alpina [alpine rockcress]
gb|KHG22354.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    317   3e-102   Gossypium arboreum [tree cotton]
gb|ABA07910.1|  plastid 3-ketoacyl-ACP synthase I                       316   3e-102   Cuphea avigera var. pulcherrima
ref|NP_001237654.1|  beta-ketoacyl-ACP synthetase I-2                   315   6e-102   Glycine max [soybeans]
gb|AGV54408.1|  beta-ketoacyl-ACP synthetase I                          315   9e-102   Phaseolus vulgaris [French bean]
ref|XP_011085258.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    315   9e-102   Sesamum indicum [beniseed]
ref|XP_009114364.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    315   1e-101   Brassica rapa
ref|XP_008383499.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    314   3e-101   
emb|CAN70157.1|  hypothetical protein VITISV_030014                     313   3e-101   Vitis vinifera
ref|XP_008444105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    313   6e-101   Cucumis melo [Oriental melon]
ref|XP_004147414.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    313   7e-101   Cucumis sativus [cucumbers]
ref|XP_004161144.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...    313   7e-101   
gb|EPS68881.1|  hypothetical protein M569_05881                         312   2e-100   Genlisea aurea
ref|XP_006280411.1|  hypothetical protein CARUB_v10026344mg             311   3e-100   Capsella rubella
ref|XP_002863412.1|  kas I                                              311   4e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_008349175.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    310   5e-100   
ref|NP_199441.1|  beta-ketoacyl-[acyl carrier protein] synthase I       310   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190479.1|  beta-ketoacyl-[acyl carrier protein] synthase I    310   2e-99    Arabidopsis thaliana [mouse-ear cress]
gb|KHG12107.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    308   4e-99    Gossypium arboreum [tree cotton]
ref|XP_009128853.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    308   4e-99    Brassica rapa
ref|XP_009360871.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    307   1e-98    Pyrus x bretschneideri [bai li]
gb|AAC49118.1|  3-ketoacyl-acyl carrier protein synthase I              307   2e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDY43962.1|  BnaA02g24400D                                          305   7e-98    Brassica napus [oilseed rape]
ref|XP_010441599.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    305   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010481467.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    302   1e-96    Camelina sativa [gold-of-pleasure]
gb|ACJ85057.1|  unknown                                                 296   1e-96    Medicago truncatula
ref|XP_010052073.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    300   4e-96    Eucalyptus grandis [rose gum]
gb|KCW75931.1|  hypothetical protein EUGRSUZ_D00305                     300   4e-96    Eucalyptus grandis [rose gum]
ref|XP_003608492.1|  Beta-ketoacyl-ACP synthase I                       297   7e-95    Medicago truncatula
gb|AFK43304.1|  unknown                                                 297   7e-95    Medicago truncatula
emb|CDX87726.1|  BnaC02g32230D                                          297   9e-95    
ref|XP_010666593.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    297   1e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006845316.1|  hypothetical protein AMTR_s00141p00029880          293   3e-93    Amborella trichopoda
ref|XP_009391220.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    291   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010917436.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    291   2e-92    Elaeis guineensis
ref|XP_010495756.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    293   4e-92    
ref|XP_003564149.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    289   9e-92    Brachypodium distachyon [annual false brome]
dbj|BAJ86549.1|  predicted protein                                      288   2e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008784346.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    288   4e-91    Phoenix dactylifera
ref|XP_004964587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    287   5e-91    Setaria italica
ref|XP_010932377.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    287   6e-91    Elaeis guineensis
ref|NP_001149639.1|  3-oxoacyl-synthase I                               287   6e-91    Zea mays [maize]
ref|NP_001146139.1|  uncharacterized protein LOC100279707               286   9e-91    Zea mays [maize]
gb|AFW85455.1|  hypothetical protein ZEAMMB73_016804                    286   1e-90    
gb|AFW85456.1|  hypothetical protein ZEAMMB73_016804                    286   2e-90    
ref|XP_009401483.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    285   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002438009.1|  hypothetical protein SORBIDRAFT_10g006430          285   5e-90    Sorghum bicolor [broomcorn]
ref|XP_006653452.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    284   6e-90    
gb|EAY94286.1|  hypothetical protein OsI_16057                          283   3e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_001762048.1|  predicted protein                                  281   3e-89    
gb|ABR18442.1|  unknown                                                 285   4e-89    Picea sitchensis
ref|XP_006656734.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    281   6e-89    
ref|NP_001052904.1|  Os04g0445700                                       280   2e-88    
ref|XP_001776124.1|  predicted protein                                  281   2e-88    
ref|NP_001032018.1|  beta-ketoacyl-[acyl carrier protein] synthase I    279   2e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CBI30851.3|  unnamed protein product                                279   2e-88    Vitis vinifera
gb|AAK58535.1|  beta-ketoacyl-ACP synthetase I                          279   6e-88    Coriandrum sativum [cilantro]
dbj|BAH00228.1|  unnamed protein product                                277   5e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057053.1|  Os06g0196600                                       277   6e-87    
ref|XP_002960175.1|  hypothetical protein SELMODRAFT_229853             273   4e-86    
ref|XP_007040574.1|  3-ketoacyl-acyl carrier protein synthase I         275   5e-86    
ref|XP_007160188.1|  hypothetical protein PHAVU_002G300400g             275   6e-86    Phaseolus vulgaris [French bean]
sp|P23902.1|KASC1_HORVU  RecName: Full=3-oxoacyl-[acyl-carrier-pr...    274   7e-86    Hordeum vulgare [barley]
ref|XP_001762687.1|  predicted protein                                  273   1e-85    
ref|XP_006603178.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    266   3e-85    
gb|KDP25270.1|  hypothetical protein JCGZ_20426                         273   4e-85    Jatropha curcas
ref|NP_001241906.1|  uncharacterized protein LOC100808453               271   2e-84    
gb|KHN12535.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    267   3e-84    Glycine soja [wild soybean]
ref|XP_003530435.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    270   3e-84    Glycine max [soybeans]
ref|XP_006579443.1|  PREDICTED: uncharacterized protein LOC100808...    268   4e-84    Glycine max [soybeans]
ref|XP_006584770.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    270   4e-84    Glycine max [soybeans]
ref|XP_010053160.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    268   5e-84    
ref|XP_003579824.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    269   6e-84    Brachypodium distachyon [annual false brome]
ref|XP_011022477.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    270   7e-84    Populus euphratica
ref|XP_006579442.1|  PREDICTED: uncharacterized protein LOC100808...    270   7e-84    Glycine max [soybeans]
ref|XP_010239948.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    270   7e-84    
ref|XP_004975742.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    267   3e-83    Setaria italica
ref|XP_002265207.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    267   5e-83    Vitis vinifera
ref|XP_006584769.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    267   7e-83    Glycine max [soybeans]
ref|XP_006584772.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    267   1e-82    Glycine max [soybeans]
ref|XP_006584771.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    267   1e-82    Glycine max [soybeans]
emb|CAD40964.2|  OSJNBa0027P08.14                                       265   1e-82    Oryza sativa Japonica Group [Japonica rice]
emb|CAH67240.1|  OSIGBa0140O07.8                                        265   1e-82    Oryza sativa [red rice]
ref|XP_004975743.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    265   2e-82    
gb|ADE76842.1|  unknown                                                 266   2e-82    Picea sitchensis
gb|AGJ84410.1|  beta-ketoacyl-ACP synthase I                            266   2e-82    Cocos nucifera
ref|XP_002299456.1|  hypothetical protein POPTR_0001s10890g             265   3e-82    
ref|XP_002303661.2|  hypothetical protein POPTR_0003s14190g             265   5e-82    Populus trichocarpa [western balsam poplar]
gb|KHG26930.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    264   9e-82    Gossypium arboreum [tree cotton]
gb|KJB24182.1|  hypothetical protein B456_004G131800                    264   1e-81    Gossypium raimondii
ref|XP_010915981.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    263   2e-81    Elaeis guineensis
ref|XP_002518849.1|  3-oxoacyl-[acyl-carrier-protein] synthase, p...    263   2e-81    Ricinus communis
ref|XP_011026849.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    262   6e-81    Populus euphratica
gb|KEH21261.1|  3-oxoacyl-[acyl-carrier] synthase                       254   2e-80    Medicago truncatula
ref|XP_004245499.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    260   2e-80    Solanum lycopersicum
ref|XP_008783167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    260   4e-80    Phoenix dactylifera
ref|XP_009590113.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    259   6e-80    Nicotiana tomentosiformis
emb|CDP12182.1|  unnamed protein product                                259   1e-79    Coffea canephora [robusta coffee]
gb|EAZ30871.1|  hypothetical protein OsJ_14945                          256   2e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008239156.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    258   4e-79    Prunus mume [ume]
gb|EYU23310.1|  hypothetical protein MIMGU_mgv1a005480mg                256   9e-79    Erythranthe guttata [common monkey flower]
gb|AAC78479.1|  3-oxoacyl-[acyl-carrier-protein] synthase               256   1e-78    Capsicum chinense [bonnet pepper]
ref|XP_006343829.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    256   2e-78    Solanum tuberosum [potatoes]
ref|XP_010917434.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    255   2e-78    Elaeis guineensis
ref|XP_008352312.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    254   2e-78    
ref|XP_009358636.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    254   5e-78    Pyrus x bretschneideri [bai li]
ref|XP_008341776.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    254   5e-78    Malus domestica [apple tree]
ref|XP_007209938.1|  hypothetical protein PRUPE_ppa004714mg             254   5e-78    
ref|XP_008352311.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    254   5e-78    
ref|XP_009341875.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    254   5e-78    Pyrus x bretschneideri [bai li]
ref|XP_002969875.1|  hypothetical protein SELMODRAFT_171238             253   7e-78    
ref|XP_003074998.1|  beta-ketoacyl-ACP synthase (ISS)                   253   1e-77    
emb|CEG00998.1|  Beta-ketoacyl synthase, active site                    253   1e-77    Ostreococcus tauri
ref|XP_004301818.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    253   2e-77    Fragaria vesca subsp. vesca
ref|XP_010109776.1|  hypothetical protein L484_003136                   253   2e-77    
ref|XP_009803233.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    252   5e-77    Nicotiana sylvestris
gb|AIQ82742.1|  3-oxoacyl-(acyl-carrier-protein) synthase               251   8e-77    Capsicum annuum
gb|AIQ82734.1|  3-oxoacyl-(acyl-carrier-protein) synthase               251   1e-76    Capsicum annuum
gb|AIQ82743.1|  3-oxoacyl-(acyl-carrier-protein) synthase               251   1e-76    Capsicum annuum
ref|XP_001416469.1|  predicted protein                                  248   2e-76    Ostreococcus lucimarinus CCE9901
gb|AIQ82746.1|  3-oxoacyl-(acyl-carrier-protein) synthase               249   4e-76    Capsicum annuum
gb|AIQ82747.1|  3-oxoacyl-(acyl-carrier-protein) synthase               249   4e-76    Capsicum annuum
gb|AIQ82745.1|  3-oxoacyl-(acyl-carrier-protein) synthase               249   5e-76    Capsicum annuum
gb|EYU26415.1|  hypothetical protein MIMGU_mgv1a006855mg                246   1e-75    Erythranthe guttata [common monkey flower]
ref|XP_011082304.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    248   2e-75    Sesamum indicum [beniseed]
ref|XP_011082303.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    248   3e-75    
gb|ADZ05697.1|  3-oxoacyl-(acyl-carrier-protein) synthase               247   3e-75    Capsicum annuum
ref|XP_007509323.1|  predicted protein                                  246   4e-75    Bathycoccus prasinos
gb|KEH21260.1|  3-oxoacyl-(acyl carrier) synthase II                    246   8e-75    Medicago truncatula
dbj|BAK03950.1|  predicted protein                                      244   2e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002964698.1|  hypothetical protein SELMODRAFT_230451             240   2e-73    
gb|KHM99882.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    238   9e-73    Glycine soja [wild soybean]
ref|XP_006476353.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    241   1e-72    Citrus sinensis [apfelsine]
gb|KDO76592.1|  hypothetical protein CISIN_1g010896mg                   241   1e-72    Citrus sinensis [apfelsine]
ref|XP_002961627.1|  hypothetical protein SELMODRAFT_230041             237   2e-72    
gb|EAZ36138.1|  hypothetical protein OsJ_20447                          236   1e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006439308.1|  hypothetical protein CICLE_v10019855mg             238   2e-71    Citrus clementina [clementine]
ref|XP_003060067.1|  predicted protein                                  233   5e-70    Micromonas pusilla CCMP1545
ref|XP_004503596.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    230   9e-69    Cicer arietinum [garbanzo]
ref|XP_005843858.1|  hypothetical protein CHLNCDRAFT_27559              228   7e-68    Chlorella variabilis
ref|XP_002504288.1|  predicted protein                                  226   9e-67    Micromonas commoda
gb|AEF13159.1|  beta-ketoacyl acyl carrier protein synthase             219   7e-65    Haematococcus lacustris
gb|EYU26414.1|  hypothetical protein MIMGU_mgv1a024999mg                218   2e-64    Erythranthe guttata [common monkey flower]
ref|XP_001701199.1|  3-ketoacyl-CoA-synthase                            220   4e-64    Chlamydomonas reinhardtii
ref|XP_002956811.1|  hypothetical protein VOLCADRAFT_83790              218   4e-64    Volvox carteri f. nagariensis
ref|XP_011398280.1|  3-oxoacyl-[acyl-carrier-protein] synthase I,...    216   2e-63    Auxenochlorella protothecoides
ref|XP_005643461.1|  3-oxoacyl-synth                                    214   7e-63    Coccomyxa subellipsoidea C-169
gb|EMT20383.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    203   1e-58    
gb|ACL27963.1|  chloroplast beta-ketoacyl-ACP synthase 1 a-1            191   6e-58    Brassica rapa subsp. pekinensis [bai cai]
emb|CAF23962.1|  probable beta-ketoacyl-ACP synthetase                  199   1e-57    
ref|WP_039359465.1|  3-oxoacyl-ACP synthase                             199   2e-57    Candidatus Protochlamydia amoebophila
ref|XP_004987019.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    200   2e-57    
ref|XP_004959862.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    200   2e-57    
ref|WP_042282680.1|  3-oxoacyl-ACP synthase                             197   6e-57    Candidatus Protochlamydia sp. R18
gb|ACL27959.1|  chloroplast beta-ketoacyl-ACP synthase 1 c-1            186   4e-56    Brassica oleracea var. alboglabra [Chinese broccoli]
gb|EKE08116.1|  3-oxoacyl-(acyl carrier protein) synthase II            188   6e-56    uncultured bacterium
gb|ACL27957.1|  chloroplast beta-ketoacyl-ACP synthase 1 b-1            182   2e-54    Brassica oleracea var. alboglabra [Chinese broccoli]
gb|ACM17228.1|  chloroplast beta-ketoacyl-ACP synthase 1                181   3e-54    Brassica oleracea var. alboglabra [Chinese broccoli]
ref|WP_032125192.1|  3-oxoacyl-ACP synthase                             188   3e-53    Candidatus Protochlamydia massiliensis
gb|KIC73224.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    187   8e-53    Neochlamydia sp. EPS4
ref|XP_002463312.1|  hypothetical protein SORBIDRAFT_02g041620          186   4e-52    
ref|WP_042239744.1|  3-oxoacyl-ACP synthase                             184   1e-51    Neochlamydia sp. S13
ref|WP_039384131.1|  3-oxoacyl-ACP synthase                             184   1e-51    Neochlamydia sp. TUME1
ref|XP_005642959.1|  3-ketoacyl-ACP-synthase                            183   5e-51    Coccomyxa subellipsoidea C-169
ref|WP_013944050.1|  3-oxoacyl-ACP synthase                             179   9e-50    Simkania negevensis
ref|XP_001773138.1|  predicted protein                                  180   2e-49    
gb|EMS63377.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    179   3e-49    Triticum urartu
ref|WP_041017043.1|  3-oxoacyl-ACP synthase                             177   6e-49    Criblamydia sequanensis
ref|XP_002989269.1|  hypothetical protein SELMODRAFT_129433             177   6e-49    
gb|KDD75769.1|  beta-ketoacyl synthase                                  177   1e-48    Helicosporidium sp. ATCC 50920
ref|XP_001763306.1|  predicted protein                                  176   3e-48    
ref|XP_001700152.1|  3-ketoacyl-ACP-synthase                            176   4e-48    Chlamydomonas reinhardtii
ref|XP_006852602.1|  hypothetical protein AMTR_s00021p00221210          165   6e-48    
ref|XP_002950994.1|  hypothetical protein VOLCADRAFT_104947             174   1e-47    Volvox carteri f. nagariensis
ref|XP_005537149.1|  3-oxoacyl-[acyl-carrier-protein] synthase I,...    174   2e-47    Cyanidioschyzon merolae strain 10D
ref|WP_042103505.1|  3-oxoacyl-ACP synthase                             172   2e-47    Parachlamydiaceae bacterium HS-T3
ref|XP_002516228.1|  46 kDa ketoavyl-ACP synthase                       174   3e-47    Ricinus communis
gb|AAA33872.1|  chloroplast beta-ketoacyl-ACP synthase precursor        174   3e-47    Ricinus communis
gb|EKE22156.1|  hypothetical protein ACD_7C00036G0001                   170   4e-47    uncultured bacterium
ref|XP_010937287.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    173   7e-47    Elaeis guineensis
ref|XP_001768994.1|  predicted protein                                  173   1e-46    
ref|XP_010937286.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    173   1e-46    Elaeis guineensis
ref|XP_010937284.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    173   1e-46    Elaeis guineensis
ref|XP_010937285.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    173   1e-46    
gb|EAZ42784.1|  hypothetical protein OsJ_27364                          171   1e-46    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060274.1|  Os07g0616200                                       171   2e-46    
gb|EAZ04708.1|  hypothetical protein OsI_26869                          171   3e-46    Oryza sativa Indica Group [Indian rice]
gb|EPS61225.1|  hypothetical protein M569_13573                         166   9e-46    Genlisea aurea
ref|WP_006340838.1|  3-oxoacyl-ACP synthase                             168   1e-45    Parachlamydia acanthamoebae
ref|XP_011078137.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    169   2e-45    Sesamum indicum [beniseed]
ref|XP_008242279.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    169   4e-45    Prunus mume [ume]
ref|XP_007204195.1|  hypothetical protein PRUPE_ppa003597mg             169   4e-45    Prunus persica
ref|XP_011078136.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    169   4e-45    Sesamum indicum [beniseed]
ref|XP_006353782.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    169   4e-45    Solanum tuberosum [potatoes]
ref|XP_010554926.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    168   5e-45    
ref|XP_002973275.1|  hypothetical protein SELMODRAFT_149056             168   5e-45    
ref|XP_002986735.1|  hypothetical protein SELMODRAFT_158169             168   5e-45    
ref|XP_004243689.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    168   6e-45    Solanum lycopersicum
gb|AAL06498.1|AF412045_1  At1g74960/F9E10_19                            161   6e-45    Arabidopsis thaliana [mouse-ear cress]
emb|CAN81160.1|  hypothetical protein VITISV_012302                     166   1e-44    Vitis vinifera
ref|XP_002965643.1|  hypothetical protein SELMODRAFT_230708             165   2e-44    
ref|XP_010533238.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    167   2e-44    Tarenaya hassleriana [spider flower]
ref|XP_009337174.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   2e-44    Pyrus x bretschneideri [bai li]
ref|XP_010089666.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       167   2e-44    Morus notabilis
ref|XP_008337819.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    167   2e-44    Malus domestica [apple tree]
ref|XP_010313772.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   2e-44    Solanum lycopersicum
emb|CBI27767.3|  unnamed protein product                                166   2e-44    Vitis vinifera
gb|KCW81914.1|  hypothetical protein EUGRSUZ_C03291                     166   3e-44    Eucalyptus grandis [rose gum]
ref|XP_009149615.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   3e-44    
ref|XP_002276214.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   3e-44    Vitis vinifera
ref|XP_009359705.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   4e-44    Pyrus x bretschneideri [bai li]
gb|KDO73818.1|  hypothetical protein CISIN_1g008146mg                   163   4e-44    Citrus sinensis [apfelsine]
gb|AAF91318.1|AF242848_1  beta-ketoacyl-acyl carrier protein synt...    166   4e-44    Brassica napus [oilseed rape]
ref|XP_011093876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   4e-44    Sesamum indicum [beniseed]
ref|XP_010539937.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   4e-44    
ref|XP_004251704.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   4e-44    Solanum lycopersicum
gb|ABJ90469.2|  beta-ketoacyl-ACP synthase II                           166   5e-44    Jatropha curcas
gb|KDP33964.1|  hypothetical protein JCGZ_07535                         166   5e-44    Jatropha curcas
ref|XP_003083296.1|  Animal-type fatty acid synthase and related ...    165   6e-44    Ostreococcus tauri
ref|XP_009337172.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    166   6e-44    Pyrus x bretschneideri [bai li]
gb|ABI18155.1|  plastid 3-keto-acyl-ACP synthase II                     164   7e-44    Helianthus annuus
gb|KIY95883.1|  3-oxoacyl-[acyl-carrier-protein (ACP)]synthase III      160   7e-44    
ref|XP_008338300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    165   8e-44    
ref|XP_006300437.1|  hypothetical protein CARUB_v10020101mg             165   1e-43    
ref|XP_007012570.1|  Fatty acid biosynthesis 1 isoform 5                163   1e-43    
gb|AAC04692.1|  beta-ketoacyl-ACP synthase II                           164   2e-43    
ref|XP_001768920.1|  predicted protein                                  162   2e-43    
emb|CDY41034.1|  BnaC05g14920D                                          164   2e-43    
gb|KDO73814.1|  hypothetical protein CISIN_1g008146mg                   162   2e-43    
ref|XP_011460975.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    164   2e-43    
emb|CDY26686.1|  BnaA06g13360D                                          163   2e-43    
ref|XP_009767768.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    163   2e-43    
gb|KDO73816.1|  hypothetical protein CISIN_1g008146mg                   162   3e-43    
gb|AAF61739.1|AF244520_1  beta-ketoacyl-ACP synthetase 2                162   3e-43    
ref|WP_013182436.1|  3-oxoacyl-ACP synthase                             161   3e-43    
ref|XP_007012566.1|  Fatty acid biosynthesis 1 isoform 1                163   4e-43    
gb|KDO73817.1|  hypothetical protein CISIN_1g008146mg                   162   4e-43    
emb|CDP03046.1|  unnamed protein product                                163   4e-43    
ref|XP_006390366.1|  hypothetical protein EUTSA_v10018368mg             163   4e-43    
gb|ACL27962.1|  chloroplast beta-ketoacyl-ACP synthase 1 d-3            152   5e-43    
ref|XP_002889002.1|  hypothetical protein ARALYDRAFT_476635             163   5e-43    
gb|AGH32917.1|  ketoacyl-ACP synthase II                                163   5e-43    
gb|EYU25822.1|  hypothetical protein MIMGU_mgv1a004003mg                163   5e-43    
ref|XP_009106152.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    163   5e-43    
ref|XP_006474686.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    163   6e-43    
gb|KDO73811.1|  hypothetical protein CISIN_1g008146mg                   162   7e-43    
emb|CDY45409.1|  BnaA07g31890D                                          162   7e-43    
emb|CDX73128.1|  BnaC06g35760D                                          162   7e-43    
ref|NP_565097.1|  3-oxoacyl-[acyl-carrier-protein] synthase II          162   8e-43    
gb|KDO73815.1|  hypothetical protein CISIN_1g008146mg                   162   8e-43    
ref|XP_009625177.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    161   9e-43    
gb|AAL91174.1|  putative 3-ketoacyl-ACP synthase                        162   9e-43    
gb|AGC65509.1|  keto acyl-acyl carrier protein synthase II              162   1e-42    
ref|XP_010428495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    162   1e-42    
ref|NP_001290396.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    162   1e-42    
ref|NP_001289900.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    162   1e-42    
ref|XP_005707986.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       160   2e-42    
ref|XP_006452865.1|  hypothetical protein CICLE_v10007846mg             162   2e-42    
ref|XP_006597886.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   2e-42    
ref|XP_006307215.1|  hypothetical protein CARUB_v10008814mg             161   2e-42    
ref|XP_006597885.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   2e-42    
ref|XP_011072620.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    161   3e-42    
emb|CDX85866.1|  BnaC06g22680D                                          160   3e-42    
ref|XP_009104733.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    160   3e-42    
emb|CDX68154.1|  BnaA07g21940D                                          160   3e-42    
emb|CDY46021.1|  BnaA02g17050D                                          160   3e-42    
ref|XP_009128067.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    160   4e-42    
ref|XP_002324139.2|  hypothetical protein POPTR_0018s07450g             160   4e-42    
ref|XP_010498339.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   4e-42    
gb|KDO73819.1|  hypothetical protein CISIN_1g008146mg                   156   5e-42    
ref|XP_010477132.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   5e-42    
ref|XP_006597884.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   6e-42    
emb|CDY19275.1|  BnaC01g32050D                                          153   7e-42    
ref|XP_003547514.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   7e-42    
ref|XP_010459588.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    158   8e-42    
gb|KJB36054.1|  hypothetical protein B456_006G138500                    150   8e-42    
ref|XP_010104609.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       159   8e-42    
gb|EYU28306.1|  hypothetical protein MIMGU_mgv1a004039mg                159   9e-42    
ref|XP_010498338.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   9e-42    
ref|XP_010477131.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   1e-41    
ref|XP_010459587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   1e-41    
ref|XP_006381576.1|  FATTY ACID BIOSYNTHESIS 1 family protein           158   2e-41    
ref|XP_006416523.1|  hypothetical protein EUTSA_v10007353mg             158   2e-41    
gb|KDO45705.1|  hypothetical protein CISIN_1g023909mg                   152   3e-41    
ref|XP_011039936.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    158   4e-41    
dbj|BAJ91001.1|  predicted protein                                      157   4e-41    
gb|EMS53974.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    156   5e-41    
ref|XP_008378994.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    157   5e-41    
ref|XP_003557750.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    156   6e-41    
emb|CDZ80412.1|  3-oxoacyl-[acyl-carrier-protein] synthase 2            155   7e-41    
gb|EMS61602.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    155   8e-41    
emb|CAA84022.1|  beta-ketoacyl-ACP synthase                             156   9e-41    
gb|KDO45704.1|  hypothetical protein CISIN_1g023909mg                   151   1e-40    
ref|XP_010939869.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    155   2e-40    
ref|XP_010939870.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    155   2e-40    
ref|XP_011072618.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    155   3e-40    
ref|XP_011072621.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    155   3e-40    
gb|AFK45051.1|  unknown                                                 148   3e-40    
gb|KJB59061.1|  hypothetical protein B456_009G236800                    146   4e-40    
ref|XP_004984083.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   4e-40    
gb|EMT17388.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    153   4e-40    
emb|CAA84023.1|  beta-ketoacyl-ACP synthase                             154   4e-40    
ref|XP_008782961.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   6e-40    
ref|XP_008782971.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   6e-40    
gb|AAD55280.1|AC008263_11  Similar to gb|AF060519 3-ketoacyl-ACP ...    154   6e-40    
ref|XP_008782980.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   6e-40    
ref|XP_011006167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   7e-40    
ref|XP_004984084.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   7e-40    
ref|XP_003562655.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   8e-40    
gb|AFW88073.1|  hypothetical protein ZEAMMB73_812704                    153   8e-40    
ref|XP_006658817.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    152   1e-39    
gb|KJB27217.1|  hypothetical protein B456_004G285300                    152   1e-39    
ref|XP_006345248.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    153   1e-39    
gb|AFW88075.1|  hypothetical protein ZEAMMB73_812704                    152   1e-39    
ref|NP_001146702.1|  uncharacterized protein LOC100280304 precursor     152   1e-39    
ref|XP_010049368.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   1e-39    
gb|KJB27218.1|  hypothetical protein B456_004G285300                    152   1e-39    
ref|NP_001169617.1|  uncharacterized protein LOC100383498 precursor     153   1e-39    
ref|NP_001132041.1|  uncharacterized protein LOC100193451 precursor     152   2e-39    
ref|XP_002463181.1|  hypothetical protein SORBIDRAFT_02g039230          152   2e-39    
gb|KHG27960.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    153   2e-39    
gb|AIL53812.1|  beta-ketoacyl-[acyl carrier protein] synthase II        152   2e-39    
gb|KJB27220.1|  hypothetical protein B456_004G285300                    152   2e-39    
gb|ACG25173.1|  3-oxoacyl-synthase I                                    152   2e-39    
ref|XP_008651372.1|  PREDICTED: uncharacterized protein LOC100280...    152   2e-39    
gb|KJB27216.1|  hypothetical protein B456_004G285300                    152   3e-39    
gb|EEE59220.1|  hypothetical protein OsJ_11186                          152   3e-39    
ref|XP_006426725.1|  hypothetical protein CICLE_v10027447mg             151   3e-39    
ref|WP_020370551.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...    150   3e-39    
gb|EEC75431.1|  hypothetical protein OsI_11955                          151   3e-39    
ref|XP_006426741.1|  hypothetical protein CICLE_v10027240mg             151   4e-39    
ref|XP_006426733.1|  hypothetical protein CICLE_v10025676mg             150   7e-39    
gb|KEH37629.1|  3-oxoacyl-(acyl carrier) synthase II                    150   7e-39    
emb|CDO97819.1|  unnamed protein product                                150   2e-38    
gb|AAX54528.1|  ketoacyl-ACP synthase II                                145   2e-38    
gb|AAC68861.1|  3-ketoacyl-ACP synthase                                 150   2e-38    
gb|KEH37628.1|  3-oxoacyl-(acyl carrier) synthase II                    150   2e-38    
ref|XP_006426746.1|  hypothetical protein CICLE_v10025485mg             149   2e-38    
ref|XP_006651481.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    149   2e-38    
ref|XP_004169836.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    149   4e-38    
ref|XP_004144052.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    149   4e-38    
ref|XP_008450963.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    149   5e-38    
emb|CBI35831.3|  unnamed protein product                                149   6e-38    
gb|KHG11340.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    147   6e-38    
ref|XP_010654405.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    149   6e-38    
gb|KJB82970.1|  hypothetical protein B456_013G222600                    147   8e-38    
gb|KJB82972.1|  hypothetical protein B456_013G222600                    147   1e-37    
gb|AAB37270.1|  beta-ketoacyl-ACP synthase II                           147   1e-37    
gb|KJB65356.1|  hypothetical protein B456_010G091400                    148   1e-37    
gb|KHG11339.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    148   1e-37    
ref|XP_004508026.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    147   2e-37    
gb|KDO45712.1|  hypothetical protein CISIN_1g037985mg                   147   2e-37    
gb|KJB82969.1|  hypothetical protein B456_013G222600                    147   2e-37    
emb|CAC59946.1|  beta-ketoacyl-ACP synthase IV                          147   2e-37    
ref|XP_010687531.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    147   3e-37    
gb|AIL53811.1|  beta-ketoacyl-[acyl carrier protein] synthase II        147   3e-37    
gb|KHG18322.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    147   3e-37    
gb|KJB82971.1|  hypothetical protein B456_013G222600                    147   3e-37    
gb|AAC68860.1|  3-ketoacyl-ACP synthase                                 147   3e-37    
ref|WP_014518181.1|  3-oxoacyl-ACP synthase                             145   3e-37    
ref|XP_003060578.1|  predicted protein                                  147   3e-37    
ref|WP_010883551.1|  3-oxoacyl-ACP synthase                             145   4e-37    
ref|XP_007154557.1|  hypothetical protein PHAVU_003G128700g             146   4e-37    
ref|XP_006466138.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   5e-37    
ref|XP_010047453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    146   5e-37    
ref|XP_004488123.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   6e-37    
ref|XP_001421280.1|  predicted protein                                  144   6e-37    
ref|XP_003609968.1|  3-oxoacyl-ACP synthase                             145   6e-37    
gb|ACJ85772.1|  unknown                                                 145   6e-37    
ref|XP_001421246.1|  predicted protein                                  144   7e-37    
ref|XP_009390876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   8e-37    
ref|XP_010932374.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   1e-36    
ref|XP_009380020.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   1e-36    
ref|XP_010932370.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   1e-36    
gb|ACJ07142.1|  beta-ketoacyl-ACP synthase II-1                         145   1e-36    
ref|XP_010932371.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   1e-36    
gb|ADK23940.1|  KASII                                                   145   1e-36    
gb|ACQ41833.1|  beta-ketoacyl-ACP synthase II                           145   2e-36    
ref|XP_010932372.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   2e-36    
ref|XP_010932373.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    144   2e-36    
ref|XP_009587352.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    144   2e-36    
gb|AAB37271.1|  beta-ketoacyl-ACP synthase II                           144   3e-36    
ref|XP_010318480.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    143   5e-36    
ref|XP_002505037.1|  predicted protein                                  142   6e-36    
ref|XP_011398918.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    142   6e-36    
ref|XP_009771698.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    142   7e-36    
ref|WP_013712221.1|  3-oxoacyl-ACP synthase                             141   8e-36    
ref|WP_003386033.1|  3-oxoacyl-(acyl-carrier-protein) synthase 2        141   9e-36    
ref|WP_033933647.1|  3-oxoacyl-ACP synthase                             134   1e-35    
ref|XP_006600238.1|  PREDICTED: beta-ketoacyl-ACP synthetase 2 is...    142   1e-35    
ref|XP_006342938.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    142   1e-35    
gb|EMT21411.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    142   2e-35    
ref|XP_004305765.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    142   2e-35    
gb|AAF26738.2|AF220453_1  beta-ketoacyl-ACP synthase II                 142   2e-35    
ref|WP_000044699.1|  3-oxoacyl-ACP synthase                             140   2e-35    
ref|XP_009404185.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...    140   2e-35    
ref|XP_011467454.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    141   2e-35    
ref|WP_018670788.1|  3-oxoacyl-ACP synthase                             140   2e-35    
ref|XP_011467455.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    141   2e-35    
ref|XP_010273891.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    141   3e-35    
pdb|4JRH|A  Chain A, Crystal Structure Of Beta-ketoacyl-acp Synth...    140   3e-35    
ref|WP_014108720.1|  3-oxoacyl-ACP synthase                             140   3e-35    
ref|XP_008784350.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    141   3e-35    
ref|XP_010273890.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    141   3e-35    
ref|WP_029071816.1|  3-oxoacyl-ACP synthase                             140   4e-35    
ref|WP_000044693.1|  3-oxoacyl-ACP synthase                             140   4e-35    
ref|WP_000044695.1|  3-oxoacyl-ACP synthase                             139   4e-35    
ref|WP_044127261.1|  3-oxoacyl-ACP synthase                             139   4e-35    
ref|WP_000044694.1|  3-oxoacyl-ACP synthase                             139   4e-35    
gb|KHN17744.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    142   4e-35    
ref|WP_001960562.1|  3-oxoacyl-[acyl-carrier-protein] synthase, K...    139   4e-35    
ref|WP_029627385.1|  3-oxoacyl-ACP synthase                             139   4e-35    
ref|WP_000044692.1|  3-oxoacyl-ACP synthase                             139   5e-35    
ref|WP_032470935.1|  3-oxoacyl-ACP synthase                             139   5e-35    
ref|WP_000044691.1|  3-oxoacyl-ACP synthase                             139   5e-35    
ref|WP_000044698.1|  3-oxoacyl-ACP synthase                             139   5e-35    
ref|WP_000044690.1|  3-oxoacyl-ACP synthase                             139   6e-35    
ref|WP_029100165.1|  3-oxoacyl-ACP synthase                             139   6e-35    
ref|WP_003287563.1|  3-oxoacyl-ACP synthase                             139   6e-35    
ref|WP_013919533.1|  3-oxoacyl-ACP synthase                             139   6e-35    
gb|KJB34912.1|  hypothetical protein B456_006G090100                    140   6e-35    
ref|NP_001236069.1|  plastid 3-keto-acyl-ACP synthase II-B precursor    140   7e-35    
ref|XP_009336709.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    139   7e-35    
ref|WP_008570646.1|  3-oxoacyl-ACP synthase                             139   8e-35    
ref|WP_020967796.1|  3-oxoacyl-ACP synthase                             139   8e-35    
ref|WP_009872915.1|  3-oxoacyl-ACP synthase                             139   8e-35    
gb|KHN07879.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    139   9e-35    
ref|WP_000044697.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               139   9e-35    
ref|WP_000044696.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               138   1e-34    
ref|WP_037043122.1|  3-oxoacyl-ACP synthase                             138   1e-34    
ref|WP_012324674.1|  3-oxoacyl-ACP synthase                             138   1e-34    
ref|WP_009873390.1|  3-oxoacyl-ACP synthase                             138   1e-34    
ref|XP_008228351.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    139   1e-34    
ref|WP_028537823.1|  3-oxoacyl-ACP synthase                             138   1e-34    
ref|XP_010261746.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    139   2e-34    
ref|WP_024067272.1|  3-oxoacyl-ACP synthase                             138   2e-34    
ref|WP_041106079.1|  3-oxoacyl-ACP synthase                             138   2e-34    
ref|WP_031413633.1|  3-oxoacyl-ACP synthase                             137   2e-34    
ref|WP_009872150.1|  3-oxoacyl-ACP synthase                             138   2e-34    
ref|WP_043219408.1|  3-oxoacyl-ACP synthase                             137   2e-34    
ref|WP_011913730.1|  3-oxoacyl-ACP synthase                             137   2e-34    
ref|WP_015276543.1|  beta-ketoacyl-acyl-carrier-protein synthase II     137   2e-34    



>emb|CDP06309.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 183/216 (85%), Gaps = 8/216 (4%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHF--------PSGvavrplprrlrvvSATAAPKREKDP  228
            MQ + +  LRPSPLDPLRK TSHF         S     P        S  +A KREKDP
Sbjct  1    MQTIQTPPLRPSPLDPLRKPTSHFLSITRKPPASVSRRLPFVSASASASTVSAAKREKDP  60

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKRVVITGMGLVSVFGNDVDAYY+KLLAGESGI+AIDRFDASKFPTRFGGQIRGFK+EGY
Sbjct  61   KKRVVITGMGLVSVFGNDVDAYYEKLLAGESGITAIDRFDASKFPTRFGGQIRGFKSEGY  120

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            IDGKNDRRLDDCLRYCIVAGKKALENADL  D IGKIDKERAG+LVGTGMGGLTVFSDGV
Sbjct  121  IDGKNDRRLDDCLRYCIVAGKKALENADLAPDRIGKIDKERAGVLVGTGMGGLTVFSDGV  180

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  181  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  216



>ref|XP_011096538.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Sesamum indicum]
Length=472

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 187/214 (87%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTT--SHFPSGvavrplprrlrvvSATAA----PKREKDPKK  234
            MQAL S ALRPSPLDPLRK    +  PS  A  P+ R    +SA+A+    PKRE DPKK
Sbjct  1    MQALQSAALRPSPLDPLRKPQYPTSLPSNNAKPPVKRLPFTISASASTVSSPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDVDAYY+KLLAGESGI+ IDRFDASKFPTRFGGQIRGFK+EGYID
Sbjct  61   RVVITGMGLVSVFGNDVDAYYEKLLAGESGITPIDRFDASKFPTRFGGQIRGFKSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKNDRRLDDCLRYCIVAGKKALE+ADLG D +GKIDK RAG+LVGTGMGGLTVFSDGVQA
Sbjct  121  GKNDRRLDDCLRYCIVAGKKALEDADLGGDRLGKIDKIRAGVLVGTGMGGLTVFSDGVQA  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKGYRKITPFFIPYAITNMGSALLAIDLG MG
Sbjct  181  LIEKGYRKITPFFIPYAITNMGSALLAIDLGLMG  214



>ref|XP_004244796.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=468

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 185/210 (88%), Gaps = 2/210 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSAT--AAPKREKDPKKRVVI  246
            MQA+ S++LRPSP+DP  KT   F +   ++P        S+T  +AP REKDPKKRVVI
Sbjct  1    MQAIQSSSLRPSPVDPFLKTIPQFTNVKPLKPKRTPFISASSTTVSAPTREKDPKKRVVI  60

Query  247  TGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKND  426
            TGMGLVSVFGNDVDAYYDKLLAGESG++ IDRFDASKFPTRFGGQIRGFKA+GYIDGKND
Sbjct  61   TGMGLVSVFGNDVDAYYDKLLAGESGVTLIDRFDASKFPTRFGGQIRGFKADGYIDGKND  120

Query  427  RRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEK  606
            RRLDDCLRYCIVAGKKALENADLG+D   KIDKERAG+LVGTGMGGLTVFSDGVQALIEK
Sbjct  121  RRLDDCLRYCIVAGKKALENADLGSDRDKKIDKERAGVLVGTGMGGLTVFSDGVQALIEK  180

Query  607  GYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+RKITPFFIPYAITNMGSALLAID+GFMG
Sbjct  181  GHRKITPFFIPYAITNMGSALLAIDVGFMG  210



>ref|XP_009763087.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana sylvestris]
Length=467

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 183/209 (88%), Gaps = 1/209 (0%)
 Frame = +1

Query  73   MQALNSTALRPSP-LDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVIT  249
            MQAL S++LRPSP   P  K T+H  + V      +    +SA++AP REKDPKKRVVIT
Sbjct  1    MQALQSSSLRPSPPTHPFLKPTTHQFTNVKPLKPKKLTPFISASSAPTREKDPKKRVVIT  60

Query  250  GMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  429
            GMGLVSVFGNDVDAYYDKLLAGESGIS IDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR
Sbjct  61   GMGLVSVFGNDVDAYYDKLLAGESGISLIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  120

Query  430  RLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKG  609
            RLDDCLRYCIVAGKKALENADLG D   KI+KERAG+LVGTGMGGLTVFSDGVQALIEKG
Sbjct  121  RLDDCLRYCIVAGKKALENADLGTDRDKKINKERAGVLVGTGMGGLTVFSDGVQALIEKG  180

Query  610  YRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +RKITPFFIPYAITNMGSALLAID+GFMG
Sbjct  181  HRKITPFFIPYAITNMGSALLAIDVGFMG  209



>ref|XP_006366097.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=468

 Score =   335 bits (860),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 184/210 (88%), Gaps = 2/210 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSAT--AAPKREKDPKKRVVI  246
            MQA+ S++LRPSP+DP  KT   F +   +RP        S+T  +AP REKDPKKRVVI
Sbjct  1    MQAIQSSSLRPSPVDPFLKTIPQFTNVKPLRPKRTPFISASSTTVSAPTREKDPKKRVVI  60

Query  247  TGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKND  426
            TGMGLVSVFGNDVDAYYDKLLAGESG++ IDRFDASKFPTRFGGQIRGFKA+GYIDGKND
Sbjct  61   TGMGLVSVFGNDVDAYYDKLLAGESGVTLIDRFDASKFPTRFGGQIRGFKADGYIDGKND  120

Query  427  RRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEK  606
            RRLDDCLRYCIVAGKKALENADLG D   KIDKERAG+LVGTGMGGLTVFSDGVQALIEK
Sbjct  121  RRLDDCLRYCIVAGKKALENADLGIDRDKKIDKERAGVLVGTGMGGLTVFSDGVQALIEK  180

Query  607  GYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+RKITPFFIPYAITNMGSALLAID+GFMG
Sbjct  181  GHRKITPFFIPYAITNMGSALLAIDVGFMG  210



>ref|XP_006467495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Citrus sinensis]
 gb|KDO78133.1| hypothetical protein CISIN_1g012221mg [Citrus sinensis]
Length=468

 Score =   333 bits (853),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 182/210 (87%), Gaps = 2/210 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR-KTTSHFPSGvavrplprrlrvvSAT-AAPKREKDPKKRVVI  246
            MQ+L S++L  SPL+PLR K+  + P+              S+T +APKREKDPKKRVVI
Sbjct  1    MQSLQSSSLHASPLNPLRSKSNFNLPNNARPTARRVSFITASSTKSAPKREKDPKKRVVI  60

Query  247  TGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKND  426
            TGMGLVSVFGNDVDAYY+KLL GESGI+ IDRFDASKFPTRFGGQIRGF AEGYIDGKND
Sbjct  61   TGMGLVSVFGNDVDAYYNKLLDGESGITMIDRFDASKFPTRFGGQIRGFSAEGYIDGKND  120

Query  427  RRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEK  606
            RRLDDCLRYCIVAGKKALE+ADLGAD   KIDKERAG+LVGTGMGGLTVFSDGVQALIEK
Sbjct  121  RRLDDCLRYCIVAGKKALEDADLGADISKKIDKERAGVLVGTGMGGLTVFSDGVQALIEK  180

Query  607  GYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  181  GHRKITPFFIPYAITNMGSALLAIDLGFMG  210



>ref|XP_009596105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nicotiana tomentosiformis]
Length=469

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 184/212 (87%), Gaps = 5/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATA----APKREKDPKKRV  240
            MQ++ S + RPSPLDPL+KT   F S V      +R+  +SA+A    APKREKDPKKRV
Sbjct  1    MQSIQSPSFRPSPLDPLKKTVPQF-SNVRSLSHVKRVPFISASATTVSAPKREKDPKKRV  59

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGLVSVFGNDVD YYD+LLAGESGIS IDRFDASKFPTRFGGQIRGF ++GYIDGK
Sbjct  60   VITGMGLVSVFGNDVDTYYDRLLAGESGISLIDRFDASKFPTRFGGQIRGFTSDGYIDGK  119

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRRLDDCLRY IVAGKKALENADLG D +GKIDKERAGILVGTGMGGLTVFSDGVQ LI
Sbjct  120  NDRRLDDCLRYAIVAGKKALENADLGGDRLGKIDKERAGILVGTGMGGLTVFSDGVQNLI  179

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  180  EKGHRKITPFFIPYAITNMGSALLGIDLGFMG  211



>ref|XP_002519707.1| 50 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|AAA33873.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR12416.1| plastid 3-keto-acyl-ACP synthase I [Ricinus communis]
 gb|EEF42680.1| 50 kDa ketoavyl-ACP synthase [Ricinus communis]
 dbj|BAM75183.1| ketoacyl-acyl carrier protein synthase [Ricinus communis]
Length=469

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 176/211 (83%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHF---PSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            MQAL S +LRPSPL PL K T +    P+              +  +APKREKDP+KRVV
Sbjct  1    MQALQSPSLRPSPLTPLHKNTHNAAKRPTKKVSFITASSTNNNTTISAPKREKDPRKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITG GLVSVFGNDVD YYDKLLAGESGI  IDRFDASKFPTRFGGQIRGF ++GYIDGKN
Sbjct  61   ITGTGLVSVFGNDVDTYYDKLLAGESGIGLIDRFDASKFPTRFGGQIRGFNSQGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCLRYCIVAGKKALE+ADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQALIE
Sbjct  121  DRRLDDCLRYCIVAGKKALEHADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQALIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+RKITPFFIPYAITNMGSALLAI+LG MG
Sbjct  181  KGHRKITPFFIPYAITNMGSALLAIELGLMG  211



>gb|AGH32916.1| ketoacyl-ACP synthase I [Camellia chekiangoleosa]
Length=469

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 183/211 (87%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTAL-RPSPLDPLRKTTSHFPSGvavrplprrlrvvS--ATAAPKREKDPKKRVV  243
            MQAL S++L RPSPL+PL K++ + P+           R +   + +APKRE DPKKRVV
Sbjct  1    MQALQSSSLLRPSPLNPLLKSSPNLPTNAKPSSTSTPKRTLPFISASAPKRESDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGLVSVFGN+VDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF ++GYIDGKN
Sbjct  61   ITGMGLVSVFGNEVDAYYDKLLAGESGIRLIDRFDASKFPTRFAGQIRGFNSQGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCLRYCIVAGKKALE+ADLG D +GKIDKERAG+LVGTGMGGLTVFSDGVQALIE
Sbjct  121  DRRLDDCLRYCIVAGKKALEDADLGGDRLGKIDKERAGVLVGTGMGGLTVFSDGVQALIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +GYRKITPFFIPYAITNMGSA+LAI+LGFMG
Sbjct  181  RGYRKITPFFIPYAITNMGSAVLAIELGFMG  211



>ref|XP_006449664.1| hypothetical protein CICLE_v10015139mg [Citrus clementina]
 gb|ESR62904.1| hypothetical protein CICLE_v10015139mg [Citrus clementina]
Length=468

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 181/210 (86%), Gaps = 2/210 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR-KTTSHFPSGvavrplprrlrvvSAT-AAPKREKDPKKRVVI  246
            MQ+L S++L  SPL+PLR K+  + P+              S+T +APKREKDPKKRVVI
Sbjct  1    MQSLQSSSLHASPLNPLRSKSNFNLPNNARPTARRVSFITASSTKSAPKREKDPKKRVVI  60

Query  247  TGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKND  426
            TGMGLVSVFGNDVDAYY+KLL GESGI+ IDRFDASKFPTRFGGQIRGF AEGYIDGKND
Sbjct  61   TGMGLVSVFGNDVDAYYNKLLDGESGITMIDRFDASKFPTRFGGQIRGFSAEGYIDGKND  120

Query  427  RRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEK  606
            RRLDDCLRY IVAGKKALE+ADLGAD   KIDKERAG+LVGTGMGGLTVFSDGVQALIEK
Sbjct  121  RRLDDCLRYSIVAGKKALEDADLGADISKKIDKERAGVLVGTGMGGLTVFSDGVQALIEK  180

Query  607  GYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  181  GHRKITPFFIPYAITNMGSALLAIDLGFMG  210



>ref|XP_009801210.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nicotiana sylvestris]
Length=469

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 178/211 (84%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprr---lrvvSATAAPKREKDPKKRVV  243
            MQ++ S + RPSPLDPL+KT     +   +    R        +  +APKREKDPKKRVV
Sbjct  1    MQSIQSPSFRPSPLDPLKKTVPQLTNVRPLSHAKRVPFISASATTVSAPKREKDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGLVSVFGNDVD YYD+LLAGESGIS IDRFDASKFPTRFGGQIRGF ++GYIDGKN
Sbjct  61   ITGMGLVSVFGNDVDTYYDRLLAGESGISLIDRFDASKFPTRFGGQIRGFTSDGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCLRY IVAGKKALENADLG D +GKIDKERAG+LVGTGMGGLTVFSDGVQ LIE
Sbjct  121  DRRLDDCLRYAIVAGKKALENADLGGDRLGKIDKERAGVLVGTGMGGLTVFSDGVQNLIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  181  KGHRKITPFFIPYAITNMGSALLGIDLGFMG  211



>ref|XP_008371590.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 177/214 (83%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplpr------rlrvvSATAAPKREKDPKK  234
            MQ+L S+ LRP+PLDP+RK T HFP+                   V A +APKRE DPKK
Sbjct  1    MQSLQSSTLRPAPLDPIRKRTPHFPNVTTRTANSSRRISFISASSVPAVSAPKREMDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDV+ YYDKLLAGESG+  IDRFDASKFPTRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDVNTYYDKLLAGESGVGPIDRFDASKFPTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKNDRRLDDCLRY IVAGKKALE+ADLGAD   K+DK R G+LVG+GMGGLTVFSDGV A
Sbjct  121  GKNDRRLDDCLRYSIVAGKKALEDADLGADQRSKLDKSRTGVLVGSGMGGLTVFSDGVHA  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  181  LIEKGHRKITPFFIPYAITNMGSALLAIDLGFMG  214



>ref|XP_009627828.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=467

 Score =   328 bits (841),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 181/209 (87%), Gaps = 1/209 (0%)
 Frame = +1

Query  73   MQALNSTALRPSP-LDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVIT  249
            MQAL S++LRPSP   P  K  +H  + V      +    +SA++AP REKDPKKRVVIT
Sbjct  1    MQALQSSSLRPSPPTHPFLKPNTHQFTNVKPLKPKKLTPFISASSAPTREKDPKKRVVIT  60

Query  250  GMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  429
            GMGLVSVFGNDVDAYYDKLLAGESGIS IDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR
Sbjct  61   GMGLVSVFGNDVDAYYDKLLAGESGISLIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  120

Query  430  RLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKG  609
            RLDDCLRY IVAGKKALENADLG D   KI+KERAG+LVGTGMGGLTVFSDGVQALIEKG
Sbjct  121  RLDDCLRYGIVAGKKALENADLGTDRDKKINKERAGVLVGTGMGGLTVFSDGVQALIEKG  180

Query  610  YRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +RKI+PFFIPYAITNMGSALLAID+GFMG
Sbjct  181  HRKISPFFIPYAITNMGSALLAIDVGFMG  209



>ref|XP_010111005.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Morus notabilis]
 gb|EXC29391.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Morus notabilis]
Length=457

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 179/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR--KTTSHFPSGvavrplpr---rlrvvSATAAPKREKDPKKR  237
            MQA+ +  LR SPLDPLR  + + HFPS                 S  +APKREKDPK+R
Sbjct  1    MQAIQAPTLRVSPLDPLRNRRRSPHFPSARPSATKKVPFFCRAASSTVSAPKREKDPKQR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGN++DAYYDKLL+GESGI+ IDRFDASKFPTRFGGQIRGF +EGYIDG
Sbjct  61   VVITGMGLVSVFGNELDAYYDKLLSGESGIAPIDRFDASKFPTRFGGQIRGFSSEGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYC+VAGKKAL +ADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQAL
Sbjct  121  KNDRRLDDCLRYCLVAGKKALVDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALLAIDLG MG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLAIDLGLMG  213



>ref|XP_006365563.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=469

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 176/211 (83%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFP---SGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            M+A+ S + RPSPLDPLRK    F    S  A R         S  +APKREKDPKKRVV
Sbjct  1    MEAMQSLSFRPSPLDPLRKNMPQFTNVRSLGAKRVPFIISASASTVSAPKREKDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITG GLVSVFGNDVD YY++LLAGESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGTGLVSVFGNDVDTYYERLLAGESGISLIDRFDASKFPTRFGGQIRGFTSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCLRY IVAGKKALENADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQ LIE
Sbjct  121  DRRLDDCLRYAIVAGKKALENADLGGDRLEKIDKERAGVLVGTGMGGLTVFSDGVQNLIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  181  KGHRKITPFFIPYAITNMGSALLGIDLGFMG  211



>gb|ABJ90468.1| beta-ketoacyl-ACP synthase I [Jatropha curcas]
Length=468

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 176/210 (84%), Gaps = 2/210 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHF--PSGvavrplprrlrvvSATAAPKREKDPKKRVVI  246
            MQAL S ++R SPL P  K + +   P    +  +       S   APKREKDPKKRVVI
Sbjct  1    MQALQSPSIRASPLSPFHKKSHNATKPPTKKISFITASSTNSSTVTAPKREKDPKKRVVI  60

Query  247  TGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKND  426
            TGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF AEGYIDGKND
Sbjct  61   TGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTRFAGQIRGFGAEGYIDGKND  120

Query  427  RRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEK  606
            RRLDDCLRYCIVAGKK+LE+ADLG D + K+DKERAG+LVGTGMGGLTVFSDGVQALIEK
Sbjct  121  RRLDDCLRYCIVAGKKSLEHADLGGDNLSKVDKERAGVLVGTGMGGLTVFSDGVQALIEK  180

Query  607  GYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+RKITPFFIPYAITNMGSALLA+++GFMG
Sbjct  181  GHRKITPFFIPYAITNMGSALLAMEIGFMG  210



>gb|KDP37953.1| hypothetical protein JCGZ_04596 [Jatropha curcas]
Length=468

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 176/210 (84%), Gaps = 2/210 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHF--PSGvavrplprrlrvvSATAAPKREKDPKKRVVI  246
            MQAL S ++R SPL P  K + +   P    +  +       S   APKREKDPKKRVVI
Sbjct  1    MQALQSPSIRASPLSPFHKKSHNATKPPTKKISFITASSTNNSTVTAPKREKDPKKRVVI  60

Query  247  TGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKND  426
            TGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF A+GYIDGKND
Sbjct  61   TGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTRFAGQIRGFGAQGYIDGKND  120

Query  427  RRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEK  606
            RRLDDCLRYCIVAGKK+LE+ADLG D + K+DKERAG+LVGTGMGGLTVFSDGVQALIEK
Sbjct  121  RRLDDCLRYCIVAGKKSLEHADLGGDNLSKVDKERAGVLVGTGMGGLTVFSDGVQALIEK  180

Query  607  GYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+RKITPFFIPYAITNMGSALLA+++GFMG
Sbjct  181  GHRKITPFFIPYAITNMGSALLAMEIGFMG  210



>ref|XP_002305334.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
 gb|EEE85845.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
Length=471

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 179/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK-----TTSHFPSGvavrplprrlrvvSATAAPKREKDPKKR  237
            MQAL ST LR SPL+PL K     T S       ++         S  +APKREKDPKKR
Sbjct  1    MQALQSTPLRSSPLNPLHKKPHNATKSPTQRLSFIKASSSSSTSNSTVSAPKREKDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            +VITGMGLVSVFGN+VDAYYDKLLAGESGI  IDRFDASKFPTRFGGQIRGF A+GYIDG
Sbjct  61   IVITGMGLVSVFGNEVDAYYDKLLAGESGIGTIDRFDASKFPTRFGGQIRGFSAQGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKE+AG+LVGTGMGGLTVFSDGVQ+L
Sbjct  121  KNDRRLDDCLRYCIVAGKKALEDADLGGDNLSKIDKEKAGVLVGTGMGGLTVFSDGVQSL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALLAI+LGFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLAIELGFMG  213



>gb|AAF61738.1|AF244519_1 beta-ketoacyl-ACP synthetase 1 [Brassica napus]
Length=295

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTT---SHFPSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            MQAL S++LR SP +PLR  +   SH  +          +   ++ +APKRE DPKKRVV
Sbjct  1    MQALQSSSLRASPPNPLRTPSNRQSHQITNARPTTRRSFISASASVSAPKRETDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            +RRLDDCL+YCIVAGKKALE+A+LG D +  IDK++AG+LVGTGMGGLTVFSDGVQAL+E
Sbjct  121  ERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQKAGVLVGTGMGGLTVFSDGVQALVE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  KGHRRISPFFIPYAITNMGSALLAIDLGLMG  211



>ref|XP_004233105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=469

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 175/211 (83%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFP---SGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            M+A+ S + RPSPL+PLRK    F    S  A R         S  +APKREKDPKKRVV
Sbjct  1    MEAIQSLSFRPSPLEPLRKNIPQFTNVRSLGAKRVPLTVTASASTVSAPKREKDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITG GLVSVFGND D YYD+LLAGESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGTGLVSVFGNDADTYYDRLLAGESGISLIDRFDASKFPTRFGGQIRGFTSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCLRY IVAGKKALENADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQ LIE
Sbjct  121  DRRLDDCLRYAIVAGKKALENADLGGDRLEKIDKERAGVLVGTGMGGLTVFSDGVQNLIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+RKITPFF+PYAITNMGSALL IDLGFMG
Sbjct  181  KGHRKITPFFVPYAITNMGSALLGIDLGFMG  211



>gb|KHG12491.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Gossypium 
arboreum]
Length=473

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 177/215 (82%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKT--TSHFPSGv-----avrplprrlrvvSATAAPKREKDPK  231
            M+AL +++LR SPL PL+K     HFP+       A +            +APKREKDPK
Sbjct  1    MEALQASSLRASPLKPLQKPKFNIHFPNASRLVPRATKKFSSITASSPTVSAPKREKDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF ++GYI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGLIDRFDASKFPTRFAGQIRGFSSQGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQ
Sbjct  121  DGKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKGYRKITPFFIPYAITNM SALLAIDLG MG
Sbjct  181  NLIEKGYRKITPFFIPYAITNMSSALLAIDLGLMG  215



>gb|ACJ07141.1| beta-ketoacyl-ACP synthase I-2 [Arachis hypogaea]
Length=470

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 179/212 (84%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATA----APKREKDPKKRV  240
            MQAL++  LR SPLDPLRK+T+   S              +A +    AP+R+KDPKKRV
Sbjct  1    MQALHTPTLRVSPLDPLRKSTNAPISTRRASKRVSFTVSAAAVSPKVSAPQRQKDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGL SVFGNDVD +YD+LLAGESGI+ IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  61   VITGMGLASVFGNDVDTFYDRLLAGESGITTIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRRLDDCLRYCIVAGKKALENADLG + + K+DKE+AG+LVG+GMGGLTVFSDGVQALI
Sbjct  121  NDRRLDDCLRYCIVAGKKALENADLGGEKLNKLDKEKAGVLVGSGMGGLTVFSDGVQALI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  181  EKGHRKITPFFIPYAITNMGSALLGIDLGFMG  212



>ref|XP_010241300.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nelumbo nucifera]
Length=471

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 176/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFP-----SGvavrplprrlrvvSATAAPKREKDPKKR  237
            MQAL S  LR SPLDPLRK +         +     P      V   T+APKRE DPKKR
Sbjct  1    MQALQSPTLRVSPLDPLRKQSPQLTNIKPTTTTKKNPSTLICAVAPTTSAPKRETDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDVD YYD+LLAGESGIS IDRFDASKFPTRF GQIRGF ++GYIDG
Sbjct  61   VVITGMGLVSVFGNDVDTYYDRLLAGESGISLIDRFDASKFPTRFAGQIRGFTSQGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYC+V+GKKALENA LG D + KIDKERAG+LVGTGMGGLTVFSDGV+AL
Sbjct  121  KNDRRLDDCLRYCLVSGKKALENAGLGGDNLSKIDKERAGVLVGTGMGGLTVFSDGVKAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALLAI+LGFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLAIELGFMG  213



>gb|KJB57278.1| hypothetical protein B456_009G156400 [Gossypium raimondii]
Length=473

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 176/215 (82%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK--TTSHFPSGva-----vrplprrlrvvSATAAPKREKDPK  231
            M+AL +++LR SPL PL+K     HFP+         +            +APKREKDPK
Sbjct  1    MEALQASSLRASPLKPLQKPKLNIHFPNASRLVPRPTKKFSSITASSPTVSAPKREKDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF ++GYI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGLIDRFDASKFPTRFAGQIRGFSSQGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQ
Sbjct  121  DGKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKGYRKITPFFIPYAITNM SALLAIDLG MG
Sbjct  181  NLIEKGYRKITPFFIPYAITNMSSALLAIDLGLMG  215



>ref|NP_001238610.1| beta-ketoacyl-ACP synthetase I [Glycine max]
 gb|AAF61730.1|AF243182_1 beta-ketoacyl-ACP synthetase I [Glycine max]
Length=469

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 177/211 (84%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            MQAL+S  LR SPLDPLR      ++  S  A R       V    +AP+R+KDPKKRVV
Sbjct  1    MQALHSPTLRASPLDPLRGPNNAAANRRSSSAKRVFFVSATVAPKVSAPQRQKDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGL SVFGNDV+ YY+KLLAGESGI+AIDRFDASKFPTRFGGQIRGF AEGYIDGKN
Sbjct  61   ITGMGLASVFGNDVEGYYEKLLAGESGITAIDRFDASKFPTRFGGQIRGFSAEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCLRYCIVAGKKALENADL  D   KIDKERAG+LVG+GMGGLTVFSDGVQALIE
Sbjct  121  DRRLDDCLRYCIVAGKKALENADLAPDNHSKIDKERAGVLVGSGMGGLTVFSDGVQALIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  181  KGHRKITPFFIPYAITNMGSALLGIDLGFMG  211



>gb|KHG12490.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Gossypium 
arboreum]
Length=497

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 177/215 (82%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKT--TSHFPSGv-----avrplprrlrvvSATAAPKREKDPK  231
            M+AL +++LR SPL PL+K     HFP+       A +            +APKREKDPK
Sbjct  1    MEALQASSLRASPLKPLQKPKFNIHFPNASRLVPRATKKFSSITASSPTVSAPKREKDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF ++GYI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGLIDRFDASKFPTRFAGQIRGFSSQGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQ
Sbjct  121  DGKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKGYRKITPFFIPYAITNM SALLAIDLG MG
Sbjct  181  NLIEKGYRKITPFFIPYAITNMSSALLAIDLGLMG  215



>gb|ACJ07140.1| beta-ketoacyl-ACP synthase I-1 [Arachis hypogaea]
Length=470

 Score =   323 bits (829),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 179/212 (84%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATA----APKREKDPKKRV  240
            MQAL++  LR SPLDPLRK+T+   S              +A +    AP+R+KDPKKRV
Sbjct  1    MQALHTPTLRVSPLDPLRKSTNPPISTRRASKRVSFTVSAAAVSPKVSAPQRQKDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGL SVFGNDVD +YD+LLAGESGI+ IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  61   VITGMGLASVFGNDVDTFYDRLLAGESGITTIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRRLDDCLRYCIVAGKKALENADLG + + K+DKE+AG+LVG+GMGGLTVFSDGVQALI
Sbjct  121  NDRRLDDCLRYCIVAGKKALENADLGGEKLNKLDKEKAGVLVGSGMGGLTVFSDGVQALI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  181  EKGHRKITPFFIPYAITNMGSALLGIDLGFMG  212



>ref|XP_007025115.1| 3-ketoacyl-acyl carrier protein synthase I isoform 3 [Theobroma 
cacao]
 gb|EOY27737.1| 3-ketoacyl-acyl carrier protein synthase I isoform 3 [Theobroma 
cacao]
Length=397

 Score =   321 bits (823),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 180/217 (83%), Gaps = 9/217 (4%)
 Frame = +1

Query  70   TMQALNSTALRPSPLDPLRKTTS--HFPSGvavrplprrlrvvSATA------APKREKD  225
            TMQAL + +LR SPL+PL+K     HF S V+        R  S TA      APKREKD
Sbjct  75   TMQALQAPSLRGSPLNPLQKPNPNPHF-SNVSRLRPRPTKRFSSITASSPTVSAPKREKD  133

Query  226  PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEG  405
            PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRFGGQIRGF ++G
Sbjct  134  PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTRFGGQIRGFTSQG  193

Query  406  YIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDG  585
            YIDGKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKER G+LVGTGMGGLTVFSDG
Sbjct  194  YIDGKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERTGVLVGTGMGGLTVFSDG  253

Query  586  VQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            VQ LIEKGYRKITPFFIPYAITNM SALL I+LGFMG
Sbjct  254  VQNLIEKGYRKITPFFIPYAITNMASALLGIELGFMG  290



>gb|ACZ06069.1| beta-ketoacyl-ACP synthetase I [Arachis hypogaea]
Length=470

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 179/212 (84%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATA----APKREKDPKKRV  240
            MQA+++  LR SPLDPLRK+T+   S              +A +    AP+R+KDPKKRV
Sbjct  1    MQAIHTPTLRVSPLDPLRKSTNAPISTRRASKRVSFTVSAAAVSPKVSAPQRQKDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGL SVFGNDVD +YD+LLAGESGI+ IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  61   VITGMGLASVFGNDVDTFYDRLLAGESGITTIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRRLDDCLRYCIVAGKKALENADLG + + K+DKE+AG+LVG+GMGGLTVFSDGVQALI
Sbjct  121  NDRRLDDCLRYCIVAGKKALENADLGGEKLNKLDKEKAGVLVGSGMGGLTVFSDGVQALI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  181  EKGHRKITPFFIPYAITNMGSALLGIDLGFMG  212



>gb|KJB66776.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=455

 Score =   323 bits (827),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 175/215 (81%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR--KTTSHFPSGva-----vrplprrlrvvSATAAPKREKDPK  231
            MQAL  ++LRPS L PL+  K   HFP+         +            +APKREKDPK
Sbjct  1    MQALQPSSLRPSSLKPLKNPKPNPHFPNVSTLPPRPAKKFSSITASSPTVSAPKREKDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYY+KLLAGESGI  IDRFDASKFPTRF GQIRGF +E YI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYEKLLAGESGIGIIDRFDASKFPTRFAGQIRGFTSESYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKNDRRLDDCLRYCIVAGKKALE+ADLGAD + KIDKER G+LVGTGMGGLTVFSDGVQ
Sbjct  121  DGKNDRRLDDCLRYCIVAGKKALEDADLGADNLSKIDKERTGVLVGTGMGGLTVFSDGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKGYRKITPFFIPY+ITNM SALLAI+LGFMG
Sbjct  181  NLIEKGYRKITPFFIPYSITNMSSALLAIELGFMG  215



>gb|KJB57279.1| hypothetical protein B456_009G156400 [Gossypium raimondii]
Length=515

 Score =   324 bits (831),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 176/215 (82%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK--TTSHFPSGva-----vrplprrlrvvSATAAPKREKDPK  231
            M+AL +++LR SPL PL+K     HFP+         +            +APKREKDPK
Sbjct  1    MEALQASSLRASPLKPLQKPKLNIHFPNASRLVPRPTKKFSSITASSPTVSAPKREKDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF ++GYI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGLIDRFDASKFPTRFAGQIRGFSSQGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQ
Sbjct  121  DGKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKGYRKITPFFIPYAITNM SALLAIDLG MG
Sbjct  181  NLIEKGYRKITPFFIPYAITNMSSALLAIDLGLMG  215



>gb|KJB66777.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=473

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 175/215 (81%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR--KTTSHFPSGva-----vrplprrlrvvSATAAPKREKDPK  231
            MQAL  ++LRPS L PL+  K   HFP+         +            +APKREKDPK
Sbjct  1    MQALQPSSLRPSSLKPLKNPKPNPHFPNVSTLPPRPAKKFSSITASSPTVSAPKREKDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYY+KLLAGESGI  IDRFDASKFPTRF GQIRGF +E YI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYEKLLAGESGIGIIDRFDASKFPTRFAGQIRGFTSESYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKNDRRLDDCLRYCIVAGKKALE+ADLGAD + KIDKER G+LVGTGMGGLTVFSDGVQ
Sbjct  121  DGKNDRRLDDCLRYCIVAGKKALEDADLGADNLSKIDKERTGVLVGTGMGGLTVFSDGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKGYRKITPFFIPY+ITNM SALLAI+LGFMG
Sbjct  181  NLIEKGYRKITPFFIPYSITNMSSALLAIELGFMG  215



>ref|XP_010529153.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Tarenaya hassleriana]
Length=469

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 176/211 (83%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTT---SHFPSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            M AL S  LR SP +PLRK +   SH  +          +   +A +APKRE DPKKRVV
Sbjct  1    MHALQSPPLRASPPNPLRKHSNRQSHQIANARPTRKQAFIAASAAVSAPKRETDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITG GLVSVFGNDVDAYY+KLLAG+SGIS IDRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGTGLVSVFGNDVDAYYEKLLAGKSGISNIDRFDASKFPTRFGGQIRGFSSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCL+YCIVAGKKALENADLG D + KIDK RAG+LVGTGMGGLTVFSDGVQALIE
Sbjct  121  DRRLDDCLKYCIVAGKKALENADLGGDKLNKIDKLRAGVLVGTGMGGLTVFSDGVQALIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+R+ITPFFIPYAITNMGSALLAIDLG MG
Sbjct  181  KGHRRITPFFIPYAITNMGSALLAIDLGLMG  211



>gb|ABM53471.1| plastid 3-keto-acyl-ACP synthase I [Helianthus annuus]
Length=462

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 179/214 (84%), Gaps = 16/214 (7%)
 Frame = +1

Query  73   MQA---LNSTALRPSPLDPLR---KTTSHFPSGvavrplprrlrvvSATAAPKREKDPKK  234
            MQA   L S  LR SPLDPLR   K T+  P             V+++  APKREKDPKK
Sbjct  1    MQAQALLQSPHLRVSPLDPLRTRPKPTNFKPR----------TTVIASATAPKREKDPKK  50

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDVD YY+KLLAGESGI  IDRFDASKFPTRFGGQIRGFK++GYID
Sbjct  51   RVVITGMGLVSVFGNDVDTYYEKLLAGESGIGLIDRFDASKFPTRFGGQIRGFKSDGYID  110

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKERAG+LVGTGMGGLTVFSDGVQ 
Sbjct  111  GKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQN  170

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKGYRKITPFFIPYAITNMGSALLAID+GFMG
Sbjct  171  LIEKGYRKITPFFIPYAITNMGSALLAIDVGFMG  204



>ref|XP_002316735.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
 gb|EEE97347.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
Length=466

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITG  252
            M+AL S  L  SPL+PL + + +       R    +    S  +APKREKDPKKRVVITG
Sbjct  1    MEALQSLYLSSSPLNPLHQKSHNATKPPPERISFIKASSSSTVSAPKREKDPKKRVVITG  60

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF A+GYIDGKNDRR
Sbjct  61   MGLVSVFGNDVDAYYDKLLAGESGIGTIDRFDASKFPTRFAGQIRGFNAQGYIDGKNDRR  120

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LD+CLRYCIVAGKKALE+ADLG + + KIDKE+AG+LVGTGMGGLTVFSDGVQ+LIEKG+
Sbjct  121  LDNCLRYCIVAGKKALEDADLGGNNLSKIDKEKAGVLVGTGMGGLTVFSDGVQSLIEKGH  180

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            RKITPFFIPYAITNMGSALL I+LGFMG
Sbjct  181  RKITPFFIPYAITNMGSALLGIELGFMG  208



>ref|XP_007211401.1| hypothetical protein PRUPE_ppa005228mg [Prunus persica]
 gb|EMJ12600.1| hypothetical protein PRUPE_ppa005228mg [Prunus persica]
Length=471

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 179/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPS-----GvavrplprrlrvvSATAAPKREKDPKKR  237
            MQAL S++LRP+PLDP+RK T HFPS       + R          A +APKREKDPKKR
Sbjct  1    MQALQSSSLRPAPLDPIRKRTPHFPSVTPRPTSSRRVSFISASSAPAVSAPKREKDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDV+AYYDKLLAGESG+  IDRFDASKFPTRFGGQI GF +EGYIDG
Sbjct  61   VVITGMGLVSVFGNDVNAYYDKLLAGESGVGPIDRFDASKFPTRFGGQIHGFSSEGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRY IVAGKKALE+ADLG D   K+DK RAG+LVG+GMGGLTVFSDGV AL
Sbjct  121  KNDRRLDDCLRYSIVAGKKALEDADLGGDKRSKLDKSRAGVLVGSGMGGLTVFSDGVHAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLGIDLGFMG  213



>ref|XP_007158937.1| hypothetical protein PHAVU_002G194300g [Phaseolus vulgaris]
 gb|ESW30931.1| hypothetical protein PHAVU_002G194300g [Phaseolus vulgaris]
Length=467

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 182/213 (85%), Gaps = 9/213 (4%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPK-----REKDPKKR  237
            MQAL+S  LR SPL+PLR   +        R   +R+  VSATAAPK     R+KDPKKR
Sbjct  1    MQALHSPTLRASPLEPLRAPNN----AANRRTAAKRVFFVSATAAPKVSAPQRQKDPKKR  56

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGL SVFGNDV+ YY+KLL+G+SGI+AIDRFDASKFPTRFGGQIRGF AEGYIDG
Sbjct  57   VVITGMGLASVFGNDVEGYYEKLLSGQSGITAIDRFDASKFPTRFGGQIRGFSAEGYIDG  116

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALE+ADL AD + K+DKERAG+LVG+GMGGLTVFSDGVQAL
Sbjct  117  KNDRRLDDCLRYCIVAGKKALESADLAADNLTKLDKERAGVLVGSGMGGLTVFSDGVQAL  176

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  177  IEKGHRKITPFFIPYAITNMGSALLGIDLGFMG  209



>gb|EYU43272.1| hypothetical protein MIMGU_mgv1a005817mg [Erythranthe guttata]
Length=469

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 176/211 (83%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK---TTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            MQALN T  RPSPL+PLRK   +T +     A R   +        A PKRE DPKKRVV
Sbjct  1    MQALNPTTFRPSPLEPLRKPQISTGNNAKTPAKRLPFKVSASAVTAAPPKRETDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGLVSVFGNDVDAYY+KLL+G SGI+ IDRFD SKFPTRFGGQIRGFK+EGYIDGKN
Sbjct  61   ITGMGLVSVFGNDVDAYYEKLLSGVSGITPIDRFDVSKFPTRFGGQIRGFKSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCLRYCIVAGKKA+E+ADLG D +  IDK RAG+LVGTGMGGLTVFSDGVQALIE
Sbjct  121  DRRLDDCLRYCIVAGKKAIEDADLGGDKLNTIDKTRAGVLVGTGMGGLTVFSDGVQALIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+RKITPFFIPYAITNMGSALLAIDLG MG
Sbjct  181  KGHRKITPFFIPYAITNMGSALLAIDLGLMG  211



>ref|XP_007025114.1| 3-ketoacyl-acyl carrier protein synthase I isoform 2 [Theobroma 
cacao]
 gb|EOY27736.1| 3-ketoacyl-acyl carrier protein synthase I isoform 2 [Theobroma 
cacao]
Length=537

 Score =   323 bits (828),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 180/217 (83%), Gaps = 9/217 (4%)
 Frame = +1

Query  70   TMQALNSTALRPSPLDPLRKTTS--HFPSGvavrplprrlrvvSATA------APKREKD  225
            TMQAL + +LR SPL+PL+K     HF S V+        R  S TA      APKREKD
Sbjct  75   TMQALQAPSLRGSPLNPLQKPNPNPHF-SNVSRLRPRPTKRFSSITASSPTVSAPKREKD  133

Query  226  PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEG  405
            PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRFGGQIRGF ++G
Sbjct  134  PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTRFGGQIRGFTSQG  193

Query  406  YIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDG  585
            YIDGKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKER G+LVGTGMGGLTVFSDG
Sbjct  194  YIDGKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERTGVLVGTGMGGLTVFSDG  253

Query  586  VQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            VQ LIEKGYRKITPFFIPYAITNM SALL I+LGFMG
Sbjct  254  VQNLIEKGYRKITPFFIPYAITNMASALLGIELGFMG  290



>gb|KEH43811.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=472

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 179/209 (86%), Gaps = 2/209 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprr-lrvvSATAAPKREKDPKKRVVIT  249
             Q L ST LRPSPL+PLR+ +S+  +  A      R    V+ T AP+REKDPKKRVVIT
Sbjct  7    QQQLPST-LRPSPLEPLRRKSSNAATATAKTKRVTRISAAVTTTTAPQREKDPKKRVVIT  65

Query  250  GMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  429
            GMGL SVFGNDVDAYYDKLLAGESGI++IDRFDASKFPTRF GQIR F +EGYIDGKNDR
Sbjct  66   GMGLASVFGNDVDAYYDKLLAGESGITSIDRFDASKFPTRFAGQIRDFSSEGYIDGKNDR  125

Query  430  RLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKG  609
            RLDDCLRYCIVAGKKALE+A+LGA  + KIDKERAG+LVG+GMGGLTVFS+GV+ LIEKG
Sbjct  126  RLDDCLRYCIVAGKKALEHANLGAANLSKIDKERAGVLVGSGMGGLTVFSEGVKNLIEKG  185

Query  610  YRKITPFFIPYAITNMGSALLAIDLGFMG  696
            YRKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  186  YRKITPFFIPYAITNMGSALLGIDLGFMG  214



>ref|XP_004504688.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cicer arietinum]
Length=472

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 179/210 (85%), Gaps = 3/210 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSA--TAAPKREKDPKKRVVI  246
            +Q L ST LRPSPLDPLR+ TS+  +        R   + +A  T AP+REKDPKKRVVI
Sbjct  6    IQQLPST-LRPSPLDPLRRKTSNAAATKIKPTSKRLSHISAAVTTTAPQREKDPKKRVVI  64

Query  247  TGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKND  426
            TGMGL SVFGNDVD +YDKLLAGESGI++IDRFDASKFPTRF GQIR F +EGYIDGKND
Sbjct  65   TGMGLASVFGNDVDGFYDKLLAGESGITSIDRFDASKFPTRFAGQIRDFNSEGYIDGKND  124

Query  427  RRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEK  606
            RRLDDCLRYCIVAGKKALENADLGA  + KIDKERAG+LVG+GMGGLTVFS+GV+ LIEK
Sbjct  125  RRLDDCLRYCIVAGKKALENADLGAGNLSKIDKERAGVLVGSGMGGLTVFSEGVKNLIEK  184

Query  607  GYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  185  GHRKITPFFIPYAITNMGSALLGIDLGFMG  214



>ref|XP_007025113.1| 3-ketoacyl-acyl carrier protein synthase I isoform 1 [Theobroma 
cacao]
 gb|EOY27735.1| 3-ketoacyl-acyl carrier protein synthase I isoform 1 [Theobroma 
cacao]
Length=548

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 180/217 (83%), Gaps = 9/217 (4%)
 Frame = +1

Query  70   TMQALNSTALRPSPLDPLRKTTS--HFPSGvavrplprrlrvvSATA------APKREKD  225
            TMQAL + +LR SPL+PL+K     HF S V+        R  S TA      APKREKD
Sbjct  75   TMQALQAPSLRGSPLNPLQKPNPNPHF-SNVSRLRPRPTKRFSSITASSPTVSAPKREKD  133

Query  226  PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEG  405
            PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRFGGQIRGF ++G
Sbjct  134  PKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTRFGGQIRGFTSQG  193

Query  406  YIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDG  585
            YIDGKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKER G+LVGTGMGGLTVFSDG
Sbjct  194  YIDGKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERTGVLVGTGMGGLTVFSDG  253

Query  586  VQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            VQ LIEKGYRKITPFFIPYAITNM SALL I+LGFMG
Sbjct  254  VQNLIEKGYRKITPFFIPYAITNMASALLGIELGFMG  290



>ref|XP_004293525.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=469

 Score =   320 bits (821),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 180/212 (85%), Gaps = 5/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATA----APKREKDPKKRV  240
            MQA+ S+ LRP+PLDPLRK T HFP+        R   + +++A    AP REKDPKKRV
Sbjct  1    MQAIQSSTLRPAPLDPLRKRT-HFPNLTPRPAPRRVSFISASSATTVSAPTREKDPKKRV  59

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITG+G VSVFGNDV+AYYDKLLAGESG+  IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  60   VITGLGCVSVFGNDVNAYYDKLLAGESGVGPIDRFDASKFPTRFGGQIRGFTSEGYIDGK  119

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRRLDDCLRY IVAGKKALE+ADLGAD   K+DK RAG+LVG+GMGGLTVFSDGV ALI
Sbjct  120  NDRRLDDCLRYAIVAGKKALEDADLGADNRPKLDKSRAGVLVGSGMGGLTVFSDGVHALI  179

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +KG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  180  DKGHRKITPFFIPYAITNMGSALLGIDLGFMG  211



>ref|XP_011011532.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=466

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITG  252
            M+AL S  L  SPL+PL + + +       R    +    S  +APKREKDPKKRVVITG
Sbjct  1    MEALQSLYLSSSPLNPLHQKSHNATKPPPERISFIKASSSSTVSAPKREKDPKKRVVITG  60

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFGNDVDAYYDKLLAGESGI  IDRFDASKFPTRF GQIRGF A+GYIDGKNDRR
Sbjct  61   MGLVSVFGNDVDAYYDKLLAGESGIGTIDRFDASKFPTRFAGQIRGFNAQGYIDGKNDRR  120

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LD+CLRYCIVAGKKALE+ADLG + + KIDKE+AG+LVGTGMGGLTVFSDGVQ+LIEKG+
Sbjct  121  LDNCLRYCIVAGKKALEDADLGGNNLSKIDKEKAGVLVGTGMGGLTVFSDGVQSLIEKGH  180

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            RKITPFFIPYAITNM SALL I+LGFMG
Sbjct  181  RKITPFFIPYAITNMASALLGIELGFMG  208



>ref|XP_011012842.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Populus euphratica]
Length=471

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvav-----rplprrlrvvSATAAPKREKDPKKR  237
            MQAL ST+LR SPL+PL +   +            +         S  +APKREKDPKKR
Sbjct  1    MQALQSTSLRSSPLNPLHQKPHNAIKSPTQRLSFIKASSSSSTSNSTVSAPKREKDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            +VITGMGLVSVFGN+VDAYYDKLLAGESGI  IDRFDASKFPTRFGGQIRGF A+GYIDG
Sbjct  61   IVITGMGLVSVFGNEVDAYYDKLLAGESGIGTIDRFDASKFPTRFGGQIRGFSAQGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALE+A+LG D + KIDKE+AG+LVGTGMGGLTVFSDGVQ+L
Sbjct  121  KNDRRLDDCLRYCIVAGKKALEDANLGGDNLFKIDKEKAGVLVGTGMGGLTVFSDGVQSL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALLAI++GFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLAIEIGFMG  213



>ref|XP_010538529.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Tarenaya hassleriana]
Length=469

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 175/211 (83%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTT---SHFPSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            MQ L S +LR SP +PLRK +   SH  +          +   +A +APKRE DP KRVV
Sbjct  1    MQVLQSPSLRASPPNPLRKHSNRQSHQIANARPTRKQHFIAASAAVSAPKRETDPNKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITG GLVSVFGNDVDAYY+KLLAGESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGTGLVSVFGNDVDAYYEKLLAGESGISNIDRFDASKFPTRFGGQIRGFSSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRR DDCL+YCIVAGKKALE+ADLG D + KIDK RAG+LVGTGMGGLTVFSDGVQALIE
Sbjct  121  DRRQDDCLKYCIVAGKKALESADLGGDKLNKIDKIRAGVLVGTGMGGLTVFSDGVQALIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+R+ITPFFIPYAITNMGSALLAIDLG MG
Sbjct  181  KGHRRITPFFIPYAITNMGSALLAIDLGLMG  211



>gb|KJB34973.1| hypothetical protein B456_006G093400 [Gossypium raimondii]
Length=489

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 176/219 (80%), Gaps = 15/219 (7%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK-----------TTSHFPSGvavrplprrlrvvSATAAPKRE  219
            MQAL +  LR SPL+PL+K           T  H P+    +         +  +APKRE
Sbjct  1    MQALQAPTLRASPLNPLKKPNPNPHFRYVFTLPHRPT----KRFTSITASSTTVSAPKRE  56

Query  220  KDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKA  399
            KDPKKRVV+TGMGLVSVFGNDVD YYDKLL+GESGI  IDRFDASKFPTRF GQIRGF +
Sbjct  57   KDPKKRVVVTGMGLVSVFGNDVDVYYDKLLSGESGIGLIDRFDASKFPTRFAGQIRGFTS  116

Query  400  EGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFS  579
            EGYIDGKNDRRLDDCLRYCIVAGKKALE+ADLG D + KIDKER G+LVGTGMGGLTVFS
Sbjct  117  EGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERTGVLVGTGMGGLTVFS  176

Query  580  DGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            DGVQ LIEKG+RKITPFFIPYAITNMGSALLAI+LGFMG
Sbjct  177  DGVQNLIEKGHRKITPFFIPYAITNMGSALLAIELGFMG  215



>emb|CDX77646.1| BnaC07g19000D [Brassica napus]
Length=469

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTT---SHFPSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            MQ+L S++LR SP +PLR  +   SH  +          +   ++ +APKRE DPKKRVV
Sbjct  1    MQSLQSSSLRASPPNPLRTPSNRQSHQITNARPTMRRSFISASASVSAPKRETDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            +RRLDDCL+YCIVAGKKALE+A+LG D +  IDK+RAG+LVGTGMGGLTVFSDGVQAL+E
Sbjct  121  ERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQALVE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  KGHRRISPFFIPYAITNMGSALLAIDLGLMG  211



>ref|XP_003638193.1| Beta-ketoacyl-ACP synthase I [Medicago truncatula]
Length=466

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 179/209 (86%), Gaps = 2/209 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprr-lrvvSATAAPKREKDPKKRVVIT  249
             Q L ST LRPSPL+PLR+ +S+  +  A      R    V+ T AP+REKDPKKRVVIT
Sbjct  7    QQQLPST-LRPSPLEPLRRKSSNAATATAKTKRVTRISAAVTTTTAPQREKDPKKRVVIT  65

Query  250  GMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  429
            GMGL SVFGNDVDAYYDKLLAGESGI++IDRFDASKFPTRF GQIR F +EGYIDGKNDR
Sbjct  66   GMGLASVFGNDVDAYYDKLLAGESGITSIDRFDASKFPTRFAGQIRDFSSEGYIDGKNDR  125

Query  430  RLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKG  609
            RLDDCLRYCIVAGKKALE+A+LGA  + KIDKERAG+LVG+GMGGLTVFS+GV+ LIEKG
Sbjct  126  RLDDCLRYCIVAGKKALEHANLGAANLSKIDKERAGVLVGSGMGGLTVFSEGVKNLIEKG  185

Query  610  YRKITPFFIPYAITNMGSALLAIDLGFMG  696
            YRKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  186  YRKITPFFIPYAITNMGSALLGIDLGFMG  214



>gb|AAC04691.1| beta-ketoacyl-ACP synthase I [Perilla frutescens]
Length=474

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 182/216 (84%), Gaps = 8/216 (4%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPL----RKTTSHFPSGvavrplprrlrvvSATAA----PKREKDP  228
            MQ+L+ST LRPSPLDPL    R + +  P   A  P  +    VSA AA    PKRE DP
Sbjct  1    MQSLHSTGLRPSPLDPLLKPHRSSAAALPGSNARPPAKKLPFRVSAAAAVAAAPKRETDP  60

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKRVVITGMGLVSVFGNDVDAYY+KLL+GESGI+ IDRFDASKFPTRFGGQIRGFKAEGY
Sbjct  61   KKRVVITGMGLVSVFGNDVDAYYEKLLSGESGITLIDRFDASKFPTRFGGQIRGFKAEGY  120

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            IDGKNDRRLDDCLRYCIVAGKKALE ADLG + + KIDK RAG+LVGTGMGGLTVFSDGV
Sbjct  121  IDGKNDRRLDDCLRYCIVAGKKALEGADLGGEKLNKIDKIRAGVLVGTGMGGLTVFSDGV  180

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +ALIEKG+RKITPFFIPYAITNM SALLAIDLG MG
Sbjct  181  KALIEKGHRKITPFFIPYAITNMASALLAIDLGLMG  216



>emb|CDY33467.1| BnaA06g36060D [Brassica napus]
Length=469

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTT---SHFPSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            MQAL S++LR SP +PLR  +   SH  +          +   ++ +APKRE DPKKRVV
Sbjct  1    MQALQSSSLRASPPNPLRTPSNRQSHQITNARPTTRRSFISASASVSAPKRETDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            +RRLDDCL+YCIVAGKKALE+A+LG D +  IDK++AG+LVGTGMGGLTVFSDGVQAL+E
Sbjct  121  ERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQKAGVLVGTGMGGLTVFSDGVQALVE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  KGHRRISPFFIPYAITNMGSALLAIDLGLMG  211



>ref|XP_010275024.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nelumbo nucifera]
Length=471

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 177/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFP-----SGvavrplprrlrvvSATAAPKREKDPKKR  237
            M+AL+S ALR SPL+PLRK +         +       P    V + T+APKRE DPKKR
Sbjct  1    MEALHSPALRISPLEPLRKQSPQLTNVKPITTKKNASTPICAAVSTTTSAPKRETDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDVD YYD+LLAGESGI+ IDRFDASKFPTRF GQIRGF ++GYIDG
Sbjct  61   VVITGMGLVSVFGNDVDTYYDRLLAGESGIAPIDRFDASKFPTRFAGQIRGFTSQGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYC+V+GK ALENA L  D + KIDKERAG+LVGTGMGGLTVFS+GVQAL
Sbjct  121  KNDRRLDDCLRYCLVSGKMALENAGLRGDNLSKIDKERAGVLVGTGMGGLTVFSNGVQAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALLAI+LGFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLAIELGFMG  213



>ref|XP_006398324.1| hypothetical protein EUTSA_v10000874mg [Eutrema salsugineum]
 gb|ESQ39777.1| hypothetical protein EUTSA_v10000874mg [Eutrema salsugineum]
Length=469

 Score =   318 bits (814),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 179/211 (85%), Gaps = 3/211 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTT---SHFPSGvavrplprrlrvvSATAAPKREKDPKKRVV  243
            MQAL S++LR SP +PL + +   SH  +          +   +A +APKRE DPKKRVV
Sbjct  1    MQALQSSSLRASPPNPLLRPSNRQSHQITNARPTRRRSFISASAAVSAPKRETDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            +RRLDDCL+YCIVAGKKALE+A+LG D +  IDK++AG+LVGTGMGGLTVFSDGVQALIE
Sbjct  121  ERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQKAGVLVGTGMGGLTVFSDGVQALIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  KGHRRISPFFIPYAITNMGSALLAIDLGLMG  211



>ref|XP_008225453.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Prunus mume]
Length=471

 Score =   318 bits (814),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 177/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFP-----SGvavrplprrlrvvSATAAPKREKDPKKR  237
            MQAL S++LRP+PLDP+RK T HFP        + R          A +APKREKDPKKR
Sbjct  1    MQALQSSSLRPAPLDPIRKRTPHFPIVSPRPTSSRRVSFISASSAPAVSAPKREKDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDV+AYYDKLLAGESG+  IDRFDASKFPTRFGGQI GF +EGYIDG
Sbjct  61   VVITGMGLVSVFGNDVNAYYDKLLAGESGVGPIDRFDASKFPTRFGGQIHGFSSEGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRY IVAGKKALE+ADLG D    +DK RAG+LVG+GMGGLTVFSDGV AL
Sbjct  121  KNDRRLDDCLRYSIVAGKKALEDADLGGDKRSTLDKSRAGVLVGSGMGGLTVFSDGVHAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLGIDLGFMG  213



>emb|CDY03228.1| BnaC09g19280D [Brassica napus]
Length=470

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 177/212 (83%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPL----RKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRV  240
            MQAL S++LR SP +PL     + +    +          +   +A +APKRE DPKKRV
Sbjct  1    MQALQSSSLRASPPNPLIKPSNRQSHQITNARQPTRRRTFISASAAVSAPKRETDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  61   VITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            N+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK+RAG+LVGTGMGGLTVFSDGVQALI
Sbjct  121  NERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQALI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  EKGHRRISPFFIPYAITNMGSALLAIDLGLMG  212



>emb|CDY35156.1| BnaA09g17930D [Brassica napus]
Length=470

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 177/212 (83%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK----TTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRV  240
            MQAL S++LR SP +PL K     +    +          +   +A +APKRE DPKKRV
Sbjct  1    MQALQSSSLRASPPNPLLKPSNRQSHQITNARHPTRRRTFISASAAVSAPKRETDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  61   VITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            N+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK+RAG+LVGTGMGGLTVFSDGVQALI
Sbjct  121  NERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQALI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  EKGHRRISPFFIPYAITNMGSALLAIDLGLMG  212



>ref|XP_009101526.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Brassica rapa]
Length=470

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 178/212 (84%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR----KTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRV  240
            MQAL S++LR SP +PLR    + +    +          +   ++ +APKRE DPKKRV
Sbjct  1    MQALQSSSLRASPPNPLRTPSNRQSHQITTNARPTTRRSFISASASVSAPKRETDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  61   VITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            N+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK++AG+LVGTGMGGLTVFSDGVQAL+
Sbjct  121  NERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQKAGVLVGTGMGGLTVFSDGVQALV  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  EKGHRRISPFFIPYAITNMGSALLAIDLGLMG  212



>ref|XP_002272874.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Vitis vinifera]
Length=463

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 172/208 (83%), Gaps = 3/208 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITG  252
            M  L S AL P+P   L +  +  P     +            AAPKREKDPKKRVVITG
Sbjct  1    MHVLQSPALCPTPPHRLGRFNAKQPR---KKVSFILSAASPTVAAPKREKDPKKRVVITG  57

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFGNDVDAYY+KLLAGESGIS IDRFDASKFPTRFGGQIRGF ++GYIDGKNDRR
Sbjct  58   MGLVSVFGNDVDAYYEKLLAGESGISPIDRFDASKFPTRFGGQIRGFDSQGYIDGKNDRR  117

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LDDCLRYCIVAGKKALE+ADLG   I KIDKERAG+LVGTGMGGLTVFSDGVQALIE+G+
Sbjct  118  LDDCLRYCIVAGKKALEDADLGGADISKIDKERAGVLVGTGMGGLTVFSDGVQALIERGH  177

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  178  RKITPFFIPYAITNMGSALLAIDLGFMG  205



>gb|KFK31480.1| hypothetical protein AALP_AA6G117600 [Arabis alpina]
Length=472

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 179/212 (84%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK----TTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRV  240
            MQAL S++LR SP +PLR+     ++   +          +   ++ +APKRE DPKKRV
Sbjct  3    MQALQSSSLRASPPNPLRRPSNLQSNQICTNARPMRRRSYISASASVSAPKRETDPKKRV  62

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  63   VITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGK  122

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            N+RRLDDCL+YCIVAGKKALE+++LG D +  IDK+RAG+LVGTGMGGLTVFSDGVQAL+
Sbjct  123  NERRLDDCLKYCIVAGKKALESSNLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQALL  182

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  183  EKGHRRISPFFIPYAITNMGSALLAIDLGLMG  214



>gb|KHG22354.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=473

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 175/219 (80%), Gaps = 15/219 (7%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK-----------TTSHFPSGvavrplprrlrvvSATAAPKRE  219
            MQAL +  LR SPL+PL+K           T  H P+    +         +  +APKRE
Sbjct  1    MQALQAPTLRASPLNPLKKPNPNPHFRYVFTLPHRPT----KRFTSITASSTTVSAPKRE  56

Query  220  KDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKA  399
            KDPKKRVV+TGMGLVSVFGNDVD YYDKLL+GESGI  IDRFDASKFPTRF GQIRGF +
Sbjct  57   KDPKKRVVVTGMGLVSVFGNDVDVYYDKLLSGESGIGLIDRFDASKFPTRFAGQIRGFTS  116

Query  400  EGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFS  579
            EGYIDGKNDRRLDDCLRYC+VAGKKALE+ADLG D +  IDKER G+LVGTGMGGLTVFS
Sbjct  117  EGYIDGKNDRRLDDCLRYCMVAGKKALEDADLGGDKLSMIDKERTGVLVGTGMGGLTVFS  176

Query  580  DGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            DGVQ LIEKG+RKITPFFIPYAITNMGSALLAI+LGFMG
Sbjct  177  DGVQNLIEKGHRKITPFFIPYAITNMGSALLAIELGFMG  215



>gb|ABA07910.1| plastid 3-ketoacyl-ACP synthase I [Cuphea avigera var. pulcherrima]
Length=465

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 178/209 (85%), Gaps = 3/209 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR-KTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVIT  249
            M +L S +LR SPLDP R K+++  P  +    +P         +APKRE DPKKRVVIT
Sbjct  1    MHSLQSPSLRASPLDPFRPKSSTVRP--LHRASIPNVRAASPTVSAPKRETDPKKRVVIT  58

Query  250  GMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  429
            GMGLVSVFG+DVDAYYDKLL+GESGI  IDRFDASKFPTRFGGQIRGF + GYIDGKNDR
Sbjct  59   GMGLVSVFGSDVDAYYDKLLSGESGIGPIDRFDASKFPTRFGGQIRGFNSMGYIDGKNDR  118

Query  430  RLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKG  609
            RLDDCLRYCIVAGKK+LE+ADLGAD + KIDKERAG+LVGTGMGGLTVFSDGVQ+LIEKG
Sbjct  119  RLDDCLRYCIVAGKKSLEDADLGADRLSKIDKERAGVLVGTGMGGLTVFSDGVQSLIEKG  178

Query  610  YRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +RKITPFFIPYAITNMGSALLAI+LG MG
Sbjct  179  HRKITPFFIPYAITNMGSALLAIELGLMG  207



>ref|NP_001237654.1| beta-ketoacyl-ACP synthetase I-2 [Glycine max]
 gb|AAF61731.1|AF243183_1 beta-ketoacyl-ACP synthetase I-2 [Glycine max]
Length=469

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 177/213 (83%), Gaps = 7/213 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPK-----REKDPKKR  237
            MQAL+S  LR SPLDPLR   +   +        +R+  VSAT APK     R+KD KKR
Sbjct  1    MQALHSPTLRTSPLDPLRGPNNA--AAKRRASSAKRVFFVSATVAPKVSAPQRQKDSKKR  58

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGL SVFGNDV+ YY+KLLAGESGI+ IDRFDASKFPTRFGGQIRGF AEGYIDG
Sbjct  59   VVITGMGLASVFGNDVEGYYEKLLAGESGITPIDRFDASKFPTRFGGQIRGFSAEGYIDG  118

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALENADL  D   KIDKERAG+LVG+GMGGLTVFSDGVQAL
Sbjct  119  KNDRRLDDCLRYCIVAGKKALENADLAPDNHSKIDKERAGVLVGSGMGGLTVFSDGVQAL  178

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALL IDLGFMG
Sbjct  179  IEKGHRKITPFFIPYAITNMGSALLGIDLGFMG  211



>gb|AGV54408.1| beta-ketoacyl-ACP synthetase I [Phaseolus vulgaris]
Length=467

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 181/213 (85%), Gaps = 9/213 (4%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPK-----REKDPKKR  237
            MQAL+S  LR SPL+PLR   +        R   +R+  VSATAAPK     R+KDPKKR
Sbjct  1    MQALHSPTLRASPLEPLRAPNN----AANRRTAAKRVFFVSATAAPKVSAPQRQKDPKKR  56

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGL SVFGNDV+ YY+KLL+G+SGI+AIDRFDASKFPTRFGGQIRGF AEGYIDG
Sbjct  57   VVITGMGLASVFGNDVEGYYEKLLSGQSGITAIDRFDASKFPTRFGGQIRGFSAEGYIDG  116

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALE+ADL AD + K+DKERAG+LVG+GMGGLTVFSDGVQAL
Sbjct  117  KNDRRLDDCLRYCIVAGKKALEHADLAADNLTKLDKERAGVLVGSGMGGLTVFSDGVQAL  176

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RK TPFFIPYAITNMGSALL ++LGFMG
Sbjct  177  IEKGHRKNTPFFIPYAITNMGSALLGMNLGFMG  209



>ref|XP_011085258.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Sesamum indicum]
Length=471

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 186/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKT--TSHFPSGvav---rplprrlrvvSATAAPKREKDPKKR  237
            MQ+L+ST+LRPSPLD LR+   ++ FP   A    + LP ++   + TAAPKRE DPKKR
Sbjct  1    MQSLHSTSLRPSPLDRLRRPRRSTIFPGNNAKPPPQRLPFKVSSSAVTAAPKRETDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDVD YY+KLL+GESGI+ IDRFDASKFPTRFGGQIRGFKAEGYIDG
Sbjct  61   VVITGMGLVSVFGNDVDVYYEKLLSGESGITLIDRFDASKFPTRFGGQIRGFKAEGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALE ADLG D + KIDK RAG+L+GTGMGGLTVFSDGVQAL
Sbjct  121  KNDRRLDDCLRYCIVAGKKALEGADLGGDKLDKIDKIRAGVLIGTGMGGLTVFSDGVQAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNM SALLAIDLGFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMASALLAIDLGFMG  213



>ref|XP_009114364.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Brassica rapa]
Length=470

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 178/212 (84%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTT---SH-FPSGvavrplprrlrvvSATAAPKREKDPKKRV  240
            MQAL S++LR SP +PL K +   SH   +          +   +A +APKRE DPKKRV
Sbjct  1    MQALQSSSLRASPPNPLLKPSNRQSHQITNARHPTRRRTFISASAAVSAPKRETDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGLVSVFGNDVDAYY+ LL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDGK
Sbjct  61   VITGMGLVSVFGNDVDAYYETLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            N+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK+RAG+LVGTGMGGLTVFSDGVQALI
Sbjct  121  NERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQALI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  EKGHRRISPFFIPYAITNMGSALLAIDLGLMG  212



>ref|XP_008383499.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 175/214 (82%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplpr------rlrvvSATAAPKREKDPKK  234
            MQ+L S+ LRP+PLDP+RK T HFPS                     A +APKRE DPKK
Sbjct  1    MQSLQSSTLRPAPLDPIRKRTPHFPSVTTKTATSSGRISFISASSAPAVSAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDV+ +YDKLLAGESG+  +DRFDASKF TRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDVNTFYDKLLAGESGVXPLDRFDASKFSTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKNDRRLDDCLRY +VAGKKALE+A LGAD   K+DK RAG+LVG+GMGGLTVFSDGV A
Sbjct  121  GKNDRRLDDCLRYSLVAGKKALEDAGLGADNRSKLDKSRAGVLVGSGMGGLTVFSDGVHA  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  181  LIEKGHRKITPFFIPYAITNMGSALLAIDLGFMG  214



>emb|CAN70157.1| hypothetical protein VITISV_030014 [Vitis vinifera]
Length=441

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  TAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGG  378
             AAPKREKDPKKRVVITGMGLVSVFGNDVDAYY+KLLAGESGIS IDRFDASKFPTRFGG
Sbjct  18   VAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYEKLLAGESGISPIDRFDASKFPTRFGG  77

Query  379  QIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGM  558
            QIRGF ++GYIDGKNDRRLDDCLRYCIVAGKKALE+ADLG   I KIDKERAG+LVGTGM
Sbjct  78   QIRGFDSQGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGGADISKIDKERAGVLVGTGM  137

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GGLTVFSDGVQALIE+G+RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  138  GGLTVFSDGVQALIERGHRKITPFFIPYAITNMGSALLAIDLGFMG  183



>ref|XP_008444105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Cucumis melo]
Length=471

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQA-LNSTALRPSPLDPLR--KTTSHFPSGvavr--plprrlrvvSATAAPKREKDPKKR  237
            MQA ++S+ L+PSPLD  R  K +    S    R           S  +APKREKDPKKR
Sbjct  1    MQAAVHSSTLKPSPLDSFRRRKCSPFLVSAPKSRPRVSFVSASAASTVSAPKREKDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDVD YYDKLL+GESG++ IDRFDASKFPTRFGGQIRGF ++GYIDG
Sbjct  61   VVITGMGLVSVFGNDVDTYYDKLLSGESGVTLIDRFDASKFPTRFGGQIRGFASQGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALE+ADLG D   KIDKERAG+LVGTGMGGLTVFSDGVQAL
Sbjct  121  KNDRRLDDCLRYCIVAGKKALEDADLGGDKRSKIDKERAGVLVGTGMGGLTVFSDGVQAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALLAID+GFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLAIDIGFMG  213



>ref|XP_004147414.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65557.1| hypothetical protein Csa_1G447400 [Cucumis sativus]
Length=471

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQA-LNSTALRPSPLDPLR--KTTSHFPSGvavr--plprrlrvvSATAAPKREKDPKKR  237
            MQA ++S+ L+PSPLD  R  K +    S    R           S  +APKREKDPKKR
Sbjct  1    MQAAVHSSTLKPSPLDSFRSRKCSPFLVSAPKSRPRLSFISASAASTVSAPKREKDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDVD YYDKLL+GESG++ IDRFDASKFPTRFGGQIRGF ++GYIDG
Sbjct  61   VVITGMGLVSVFGNDVDTYYDKLLSGESGVTLIDRFDASKFPTRFGGQIRGFASQGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALE+ADLG D   KIDKERAG+LVGTGMGGLTVFSDGVQAL
Sbjct  121  KNDRRLDDCLRYCIVAGKKALEDADLGGDKRSKIDKERAGVLVGTGMGGLTVFSDGVQAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALLAID+GFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLAIDIGFMG  213



>ref|XP_004161144.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[acyl-carrier-protein] 
synthase I, chloroplastic-like [Cucumis sativus]
Length=471

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQA-LNSTALRPSPLDPLR--KTTSHFPSGvavr--plprrlrvvSATAAPKREKDPKKR  237
            MQA ++S+ L+PSPLD  R  K +    S    R           S  +APKREKDPKKR
Sbjct  1    MQAAVHSSTLKPSPLDSFRSRKCSPFLVSAPKSRPRLSFISASAASTVSAPKREKDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDVD YYDKLL+GESG++ IDRFDASKFPTRFGGQIRGF ++GYIDG
Sbjct  61   VVITGMGLVSVFGNDVDTYYDKLLSGESGVTLIDRFDASKFPTRFGGQIRGFASQGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KNDRRLDDCLRYCIVAGKKALE+ADLG D   KIDKERAG+LVGTGMGGLTVFSDGVQAL
Sbjct  121  KNDRRLDDCLRYCIVAGKKALEDADLGGDKRSKIDKERAGVLVGTGMGGLTVFSDGVQAL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+RKITPFFIPYAITNMGSALLAID+GFMG
Sbjct  181  IEKGHRKITPFFIPYAITNMGSALLAIDIGFMG  213



>gb|EPS68881.1| hypothetical protein M569_05881, partial [Genlisea aurea]
Length=494

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 178/211 (84%), Gaps = 6/211 (3%)
 Frame = +1

Query  82   LNSTALRPSPLDPLRKTTSH--FPSGvavrplprrlrvvSATA----APKREKDPKKRVV  243
            +   +LR SPLD L K +S   FP      P  R L  +SA+A    APKRE DPKKRVV
Sbjct  1    IECASLRSSPLDRLCKPSSETFFPRRNVFPPAKRSLFKISASAPTVSAPKRETDPKKRVV  60

Query  244  ITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKN  423
            ITGMGLVSVFGNDVDAYY+KLL GESGI+ +DRFDASKFPTRFGGQIRGF +EGYIDGKN
Sbjct  61   ITGMGLVSVFGNDVDAYYNKLLEGESGIALLDRFDASKFPTRFGGQIRGFNSEGYIDGKN  120

Query  424  DRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIE  603
            DRRLDDCLRYCIVAGKKALENADLG + +G IDK RAG+LVGTGMGG++VFSDGVQALIE
Sbjct  121  DRRLDDCLRYCIVAGKKALENADLGQEKLGAIDKVRAGVLVGTGMGGISVFSDGVQALIE  180

Query  604  KGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            KG+RKITPFFIPYAITNMGSALLAID+GFMG
Sbjct  181  KGHRKITPFFIPYAITNMGSALLAIDIGFMG  211



>ref|XP_006280411.1| hypothetical protein CARUB_v10026344mg [Capsella rubella]
 gb|EOA13309.1| hypothetical protein CARUB_v10026344mg [Capsella rubella]
Length=471

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 177/213 (83%), Gaps = 5/213 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGvavrplprrlrvvSAT--AAPKREKDPKKR  237
            MQAL S++LR SP +PLR      SH  +        R     SA+  +APKRE DPKKR
Sbjct  1    MQALQSSSLRASPPNPLRLPSNRQSHQIANARPVRRQRSFISASASTVSAPKRETDPKKR  60

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYIDG
Sbjct  61   VVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDG  120

Query  418  KNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQAL  597
            KN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGLTVFS+GVQ L
Sbjct  121  KNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGMGGLTVFSEGVQNL  180

Query  598  IEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            IEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  IEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  213



>ref|XP_002863412.1| kas I [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39671.1| kas I [Arabidopsis lyrata subsp. lyrata]
Length=473

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 180/215 (84%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGvavrplprrlrvvSATA----APKREKDPK  231
            MQAL S++LR SP +PLR      SH       RPL R    +SA+A    APKRE DPK
Sbjct  1    MQALQSSSLRASPPNPLRLPSNRQSHQIITTNARPLRRHRSFISASASTVSAPKRETDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYYDKLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYDKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGLTVFS+GVQ
Sbjct  121  DGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGMGGLTVFSEGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  NLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  215



>ref|XP_008349175.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplpr------rlrvvSATAAPKREKDPKK  234
            MQ+L S+ LRP+PLDP+RK T HF S                     A +APKRE DPKK
Sbjct  1    MQSLQSSTLRPAPLDPIRKRTPHFXSVTTKTATSSGRISFISASSAPAVSAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDV+ +YDKLLAGESG+  +DRFDASKF TRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDVNTFYDKLLAGESGVXPLDRFDASKFSTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKNDRRLDDCLRY +VAGKKALE+A LGAD   K+DK RAG+LVG+GMGGLTVFSDGV A
Sbjct  121  GKNDRRLDDCLRYSLVAGKKALEDAGLGADNRSKLDKSRAGVLVGSGMGGLTVFSDGVHA  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  181  LIEKGHRKITPFFIPYAITNMGSALLAIDLGFMG  214



>ref|NP_199441.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 sp|P52410.2|KASC1_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic; 
AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS 
I; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11084.1| 3-oxoacyl-[acyl-carrier-protein] synthase I precursor [Arabidopsis 
thaliana]
 gb|AAK59862.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AAM16266.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AAM65396.1| 3-oxoacyl-(acyl-carrier-protein) synthase I precursor (beta-ketoacyl-acp 
synthase I) (KAS I) [Arabidopsis thaliana]
 gb|AAM74493.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AED95363.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=473

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 179/215 (83%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGvavrplprrlrvvSATA----APKREKDPK  231
            MQAL S++LR SP +PLR      SH     A     ++   +SA+A    APKRE DPK
Sbjct  1    MQALQSSSLRASPPNPLRLPSNRQSHQLITNARPLRRQQRSFISASASTVSAPKRETDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGLTVFS+GVQ
Sbjct  121  DGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGMGGLTVFSEGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  NLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  215



>ref|NP_001190479.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 gb|AED95365.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=489

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 179/215 (83%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGvavrplprrlrvvSATA----APKREKDPK  231
            MQAL S++LR SP +PLR      SH     A     ++   +SA+A    APKRE DPK
Sbjct  1    MQALQSSSLRASPPNPLRLPSNRQSHQLITNARPLRRQQRSFISASASTVSAPKRETDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGLTVFS+GVQ
Sbjct  121  DGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGMGGLTVFSEGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  NLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  215



>gb|KHG12107.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=474

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  TAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGG  378
             +APKREKDPKKRVVITGMGLVSVFGNDVDAYY+KLLAGESGI  IDRFDASKFPTRF G
Sbjct  51   VSAPKREKDPKKRVVITGMGLVSVFGNDVDAYYEKLLAGESGIGLIDRFDASKFPTRFAG  110

Query  379  QIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGM  558
            QIRGF +EGYIDGKNDRRLDDCLRYCIVAGKKALE+ADLGAD + KIDKER G+LVGTGM
Sbjct  111  QIRGFTSEGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGADNLSKIDKERTGVLVGTGM  170

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GGLTVFSDGVQ LIEKGYRKITPFFIPY+ITNM SALLAI+LGFMG
Sbjct  171  GGLTVFSDGVQNLIEKGYRKITPFFIPYSITNMSSALLAIELGFMG  216



>ref|XP_009128853.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Brassica rapa]
Length=472

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 178/214 (83%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRK----TTSHFPSGvav--rplprrlrvvSATAAPKREKDPKK  234
            MQAL+ ++LR SP +PL K     + H  +      R         SA +APKRE DPKK
Sbjct  1    MQALHPSSLRASPPNPLLKPSNRQSHHITTNARQPTRRRSFISASSSAVSAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK+RAG+LVGTGMGGLTVFSDGVQA
Sbjct  121  GKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQA  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  LIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  214



>ref|XP_009360871.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Pyrus x bretschneideri]
Length=472

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 173/214 (81%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplpr------rlrvvSATAAPKREKDPKK  234
            MQ+L S  LRP+P DP+RK   HFPS                     A +APKRE DPKK
Sbjct  1    MQSLQSPTLRPAPFDPIRKRDPHFPSITTKTSTSSGRISFISASSAPAVSAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGND++ +YDKLLAGESG+  +DRFDASKF TRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDINTFYDKLLAGESGVGPLDRFDASKFSTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKNDRRLDDCLRY +VAGKKALE+ADLGAD   K+DK RAG+LVG+GMGGLTVFSDGV A
Sbjct  121  GKNDRRLDDCLRYSLVAGKKALEDADLGADNRSKLDKSRAGVLVGSGMGGLTVFSDGVHA  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  181  LIEKGHRKITPFFIPYAITNMGSALLAIDLGFMG  214



>gb|AAC49118.1| 3-ketoacyl-acyl carrier protein synthase I [Arabidopsis thaliana]
Length=473

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 178/215 (83%), Gaps = 7/215 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGvavrplprrlrvvSATA----APKREKDPK  231
            MQAL S++LR SP +PLR      SH     A     ++   +SA+A    APKRE DPK
Sbjct  1    MQALQSSSLRASPPNPLRLPSNRQSHQLITNARPLRRQQRSFISASASTVSAPKRETDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSV GNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYI
Sbjct  61   KRVVITGMGLVSVCGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGLTVFS+GVQ
Sbjct  121  DGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGMGGLTVFSEGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  NLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  215



>emb|CDY43962.1| BnaA02g24400D [Brassica napus]
Length=472

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 177/214 (83%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPL----RKTTSHFPSGvav--rplprrlrvvSATAAPKREKDPKK  234
            MQAL+ ++LR SP +PL     + + H  +      R         SA +APKRE DPKK
Sbjct  1    MQALHPSSLRASPPNPLLRPSNRQSHHITTNARQPTRRRSFISASSSAVSAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKN+RRLDDCL+YCIVAGKKALE+A LG D +  IDK++AG+LVGTGMGGLTVFSDGVQA
Sbjct  121  GKNERRLDDCLKYCIVAGKKALESAGLGGDKLNTIDKQKAGVLVGTGMGGLTVFSDGVQA  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  LIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  214



>ref|XP_010441599.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Camelina sativa]
Length=472

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 175/214 (82%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGva---vrplprrlrvvSATAAPKREKDPKK  234
            MQAL S++LR SP +PLR      SH  +       +         +  +APKRE DPKK
Sbjct  1    MQALQSSSLRASPPNPLRLPSNRQSHQITNARPVRRQRSFISASASATVSAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGLTVFS+GVQ 
Sbjct  121  GKNERRLDDCLKYCIVAGKKALESANLGGDKLNSIDKRKAGVLVGTGMGGLTVFSEGVQN  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  LIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  214



>ref|XP_010481467.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Camelina sativa]
Length=472

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGva---vrplprrlrvvSATAAPKREKDPKK  234
            MQ L S++LR SP +PLR      SH  +       +         +  +APKRE DPKK
Sbjct  1    MQFLQSSSLRASPPNPLRLPSNRQSHQITNARPLRRQRSFISASASATVSAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGLTVFS+GVQ 
Sbjct  121  GKNERRLDDCLKYCIVAGKKALESANLGGDKLNSIDKRKAGVLVGTGMGGLTVFSEGVQN  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  181  LIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  214



>gb|ACJ85057.1| unknown [Medicago truncatula]
Length=291

 Score =   296 bits (757),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNST---ALRPSPLDPLRKTTSHFPSGvavrplprrlrvvS-ATAAPKREKDPKKRV  240
            MQ+L       LRPSPL+PLRK  S+  +  A  P    +   S  TAAP+REKDPKKRV
Sbjct  1    MQSLQHQLPFTLRPSPLEPLRKKPSNAATTAARTPKRLSVVSSSVTTAAPQREKDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMG V+V GNDVD +Y+KLLAG+SGI+ IDRFDASKFPTRF GQIRGF +EGYIDGK
Sbjct  61   VITGMGGVTVHGNDVDIFYEKLLAGDSGITLIDRFDASKFPTRFAGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRR DDCLRYC VAGKKALE+A LGA+ + KIDKERAG+LVG+GMGGLTVFSDGV+ LI
Sbjct  121  NDRRQDDCLRYCNVAGKKALEDAGLGAENLDKIDKERAGVLVGSGMGGLTVFSDGVKNLI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+RKI+PFFIPYAITNM SALL IDLGF G
Sbjct  181  EKGHRKISPFFIPYAITNMASALLGIDLGFRG  212



>ref|XP_010052073.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Eucalyptus grandis]
 gb|KCW75930.1| hypothetical protein EUGRSUZ_D00305 [Eucalyptus grandis]
Length=465

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 174/209 (83%), Gaps = 3/209 (1%)
 Frame = +1

Query  73   MQALNSTALR-PSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVIT  249
            MQ+L+S +LR  SPLDPLR                  +R  S +A PKRE DP+KRVV+T
Sbjct  1    MQSLHSPSLRGASPLDPLRAAAPR--RRRPAPGRVAVVRAASMSAPPKRETDPRKRVVVT  58

Query  250  GMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  429
            G GLVSVFGNDVDAYY+KLLAGESGI  IDRFDASKFPTRF GQIRGF ++GYIDGKNDR
Sbjct  59   GTGLVSVFGNDVDAYYEKLLAGESGIGPIDRFDASKFPTRFAGQIRGFSSQGYIDGKNDR  118

Query  430  RLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKG  609
            RLDDCLRYCIVAGKKALE+ADLG D + KI+KERAG+LVGTGMGGLTVFSDGV+ LIEKG
Sbjct  119  RLDDCLRYCIVAGKKALEHADLGGDRLSKIEKERAGVLVGTGMGGLTVFSDGVKNLIEKG  178

Query  610  YRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +RKITPFFIPYAITNMGSAL+AI+LGFMG
Sbjct  179  HRKITPFFIPYAITNMGSALIAIELGFMG  207



>gb|KCW75931.1| hypothetical protein EUGRSUZ_D00305 [Eucalyptus grandis]
Length=466

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 174/209 (83%), Gaps = 3/209 (1%)
 Frame = +1

Query  73   MQALNSTALR-PSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVIT  249
            MQ+L+S +LR  SPLDPLR                  +R  S +A PKRE DP+KRVV+T
Sbjct  1    MQSLHSPSLRGASPLDPLRAAAPR--RRRPAPGRVAVVRAASMSAPPKRETDPRKRVVVT  58

Query  250  GMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDR  429
            G GLVSVFGNDVDAYY+KLLAGESGI  IDRFDASKFPTRF GQIRGF ++GYIDGKNDR
Sbjct  59   GTGLVSVFGNDVDAYYEKLLAGESGIGPIDRFDASKFPTRFAGQIRGFSSQGYIDGKNDR  118

Query  430  RLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKG  609
            RLDDCLRYCIVAGKKALE+ADLG D + KI+KERAG+LVGTGMGGLTVFSDGV+ LIEKG
Sbjct  119  RLDDCLRYCIVAGKKALEHADLGGDRLSKIEKERAGVLVGTGMGGLTVFSDGVKNLIEKG  178

Query  610  YRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +RKITPFFIPYAITNMGSAL+AI+LGFMG
Sbjct  179  HRKITPFFIPYAITNMGSALIAIELGFMG  207



>ref|XP_003608492.1| Beta-ketoacyl-ACP synthase I [Medicago truncatula]
 gb|AES90689.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=470

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNST---ALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSAT-AAPKREKDPKKRV  240
            MQ+L       LRPSPL+PLRK  S+  +  A  P    +   S T AAP+REKDPKKRV
Sbjct  1    MQSLQHQLPFTLRPSPLEPLRKKPSNAATTAARTPKRLSVVSSSVTTAAPQREKDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMG V+V GNDVD +Y+KLLAG+SGI+ IDRFDASKFPTRF GQIRGF +EGYIDGK
Sbjct  61   VITGMGGVTVHGNDVDIFYEKLLAGDSGITLIDRFDASKFPTRFAGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRR DDCLRYC VAGKKALE+A LGA+ + KIDKERAG+LVG+GMGGLTVFSDGV+ LI
Sbjct  121  NDRRQDDCLRYCNVAGKKALEDAGLGAENLDKIDKERAGVLVGSGMGGLTVFSDGVKNLI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+RKI+PFFIPYAITNM SALL IDLGF G
Sbjct  181  EKGHRKISPFFIPYAITNMASALLGIDLGFRG  212



>gb|AFK43304.1| unknown [Medicago truncatula]
Length=470

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = +1

Query  73   MQALNST---ALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSAT-AAPKREKDPKKRV  240
            MQ+L       LRPSPL+PLRK  S+  +  A  P    +   S T AAP+REKDPKKRV
Sbjct  1    MQSLQHQLPFTLRPSPLEPLRKKPSNAATTAARTPKRLSVVSSSVTTAAPQREKDPKKRV  60

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMG V+V GNDVD +Y+KLLAG+SGI+ IDRFDASKFPTRF GQIRGF +EGYIDGK
Sbjct  61   VITGMGGVTVHGNDVDIFYEKLLAGDSGITLIDRFDASKFPTRFAGQIRGFSSEGYIDGK  120

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRR DDCLRYC VAGKKALE+A LGA+ + KIDKERAG+LVG+GMGGLTVFSDGV+ LI
Sbjct  121  NDRRQDDCLRYCNVAGKKALEDAGLGAENLDKIDKERAGVLVGSGMGGLTVFSDGVKNLI  180

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            EKG+RKI+PFFIPYAITNM SALL IDLGF G
Sbjct  181  EKGHRKISPFFIPYAITNMASALLGIDLGFRG  212



>emb|CDX87726.1| BnaC02g32230D [Brassica napus]
Length=462

 Score =   297 bits (760),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 174/208 (84%), Gaps = 2/208 (1%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITG  252
            MQAL+ ++LR SP +PL K ++       +    RR  + ++T+APKRE DPKKRVVITG
Sbjct  1    MQALHPSSLRASPPNPLLKPSNR--QSHHITTNTRRSFISASTSAPKRETDPKKRVVITG  58

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFGNDVDAYY+KLL+ ES IS IDRFDASKFPTRFGGQ+ GF +EGYIDGKN+R 
Sbjct  59   MGLVSVFGNDVDAYYEKLLSVESRISLIDRFDASKFPTRFGGQVCGFSSEGYIDGKNERS  118

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LDDCL+YCIVAGKKALE+A+LG D +  IDK RAG+LVGTGMG LTVFSDGVQALIEKG+
Sbjct  119  LDDCLKYCIVAGKKALESANLGGDKLNTIDKRRAGVLVGTGMGVLTVFSDGVQALIEKGH  178

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            R+I+ FFIPYAITNMGSALLAIDLG MG
Sbjct  179  RRISLFFIPYAITNMGSALLAIDLGLMG  206



>ref|XP_010666593.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010666594.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=472

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 163/214 (76%), Gaps = 6/214 (3%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrl------rvvSATAAPKREKDPKK  234
            MQAL S  LRPS L PL    +   S       P +              APKRE DPKK
Sbjct  1    MQALLSPTLRPSSLSPLHTKPNSLSSNSPKCKPPNKAFFFTPRASSQVAVAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGND D +Y+KLL G SGI  IDRFDASKFPTRF GQI  F +EGYID
Sbjct  61   RVVITGMGLVSVFGNDPDVFYEKLLDGVSGIGPIDRFDASKFPTRFAGQIHNFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKNDRRLDDCLRYCIVAGKKALE+ADL AD + KIDK RAG+LVGTGMGGLTVFSDGVQA
Sbjct  121  GKNDRRLDDCLRYCIVAGKKALESADLAADKLSKIDKVRAGVLVGTGMGGLTVFSDGVQA  180

Query  595  LIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LIEKG+R+ITPFFIPYAITNM SALLAIDLG MG
Sbjct  181  LIEKGHRRITPFFIPYAITNMASALLAIDLGLMG  214



>ref|XP_006845316.1| hypothetical protein AMTR_s00141p00029880 [Amborella trichopoda]
 gb|ERN06991.1| hypothetical protein AMTR_s00141p00029880 [Amborella trichopoda]
Length=468

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFGNDVDAYY KLL G+SGI  IDRFDASKFPTRFGGQI
Sbjct  47   APKREKDPKKRVVITGMGLVSVFGNDVDAYYGKLLEGQSGIGPIDRFDASKFPTRFGGQI  106

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
            RGF A+GYIDGKNDRRLDDCLRYCIV+GKKALENA L    + KIDKERAG+LVGTGMGG
Sbjct  107  RGFTADGYIDGKNDRRLDDCLRYCIVSGKKALENAGLPIVNLSKIDKERAGVLVGTGMGG  166

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LTVFS+GVQALIEKG R+ITPFFIPYAITNMGSALLAI+LGFMG
Sbjct  167  LTVFSEGVQALIEKGPRRITPFFIPYAITNMGSALLAIELGFMG  210



>ref|XP_009391220.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=468

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 153/167 (92%), Gaps = 2/167 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            AAP+RE DPKKRVVITGMGLVSVFGNDVDAYY+KLL GESGI  IDRFDASK PTRF GQ
Sbjct  44   AAPRRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLEGESGIGPIDRFDASKLPTRFAGQ  103

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTG  555
            IRGF +EGYIDGKNDRRLDDCLRYC+V+GKKALE+A L  G+  I KIDK RAG+LVGTG
Sbjct  104  IRGFSSEGYIDGKNDRRLDDCLRYCLVSGKKALESAGLGVGSQAISKIDKVRAGVLVGTG  163

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGGLTVFSDGVQALIEKG+RKITPFFIPYAITNMGSALLA+D+GFMG
Sbjct  164  MGGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAMDIGFMG  210



>ref|XP_010917436.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=469

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 154/170 (91%), Gaps = 2/170 (1%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S  AAP+RE DP+KRVVITGMGLVSVFGNDVD YY+KLL GESGI  IDRFDASKFPTRF
Sbjct  42   SVAAAPRRETDPRKRVVITGMGLVSVFGNDVDVYYEKLLEGESGIGPIDRFDASKFPTRF  101

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENA--DLGADGIGKIDKERAGILV  546
             GQIRGF +EGYIDGKNDRRLDDCLRYC+V+GKKALE+   ++G+  + KIDK RAG+LV
Sbjct  102  AGQIRGFSSEGYIDGKNDRRLDDCLRYCLVSGKKALESTGLEVGSKALSKIDKVRAGVLV  161

Query  547  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLA+D+GFMG
Sbjct  162  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAMDIGFMG  211



>ref|XP_010495756.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Camelina sativa]
Length=569

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            PKRE DPKKRVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIR
Sbjct  149  PKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIR  208

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGL  567
            GF +EGYIDGKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGL
Sbjct  209  GFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDNLNSIDKRKAGVLVGTGMGGL  268

Query  568  TVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            TVFS+GVQ LIEKG+R+I+PFFIPYAITNMGSALLAIDLG MG
Sbjct  269  TVFSEGVQNLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMG  311


 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 121/184 (66%), Gaps = 10/184 (5%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGva---vrplprrlrvvSATAAPKREKDPKK  234
            MQAL S++LR SP +PLR      SH  +       +         +  +APKRE DPKK
Sbjct  1    MQALQSSSLRASPPNPLRLPSNRQSHQITNARPIRRQRSFISASSSATVSAPKRETDPKK  60

Query  235  RVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYID  414
            RVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYID
Sbjct  61   RVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYID  120

Query  415  GKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQA  594
            GKN+RRLDDCL+      +  +  +        K + +    +V TGMG ++VF + V A
Sbjct  121  GKNERRLDDCLKR----QRSFISASASATVSAPKRETDPKKRVVITGMGLVSVFGNDVDA  176

Query  595  LIEK  606
              EK
Sbjct  177  YYEK  180



>ref|XP_003564149.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Brachypodium distachyon]
Length=463

 Score =   289 bits (740),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DPKKRVVITGMGLVSVFGNDVDAYYD+LLAGESG+  IDRFDASKFPTRF GQIR
Sbjct  41   PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGVGPIDRFDASKFPTRFAGQIR  100

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENAD--LGADGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDCLRYCIV+GKKALE A   LG++ +GKIDK RAG+LVGTGMG
Sbjct  101  GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGLPLGSEAMGKIDKARAGVLVGTGMG  160

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GL VFSDGVQ LIEKGYRKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  161  GLQVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMG  205



>dbj|BAJ86549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DPKKRVVITGMGLVSVFGNDVDAYYD+LLAGESG+  IDRFDASKFPTRF GQIR
Sbjct  41   PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGVGPIDRFDASKFPTRFAGQIR  100

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENAD--LGADGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDCLRYCIV+GKKALE+A   LG+D + KIDK RAG+LVGTGMG
Sbjct  101  GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALESAGLPLGSDAMAKIDKARAGVLVGTGMG  160

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GL VFSDGVQ L+EKGYRKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  161  GLQVFSDGVQNLLEKGYRKITPFFIPYAITNMGSALLGMDIGFMG  205



>ref|XP_008784346.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Phoenix dactylifera]
Length=469

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 2/170 (1%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S   AP+RE DPKKRVVITGMGLVSVFGNDVDAYY+KLL GESGI  IDRFDASKFPTRF
Sbjct  42   SVAGAPRRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLEGESGIGPIDRFDASKFPTRF  101

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILV  546
             GQIRGF +EG+IDGKNDRRLDDCLRYC+V+GKKALE+  L  G+  + KIDK RAG+LV
Sbjct  102  AGQIRGFSSEGFIDGKNDRRLDDCLRYCLVSGKKALESTGLGVGSKALSKIDKVRAGVLV  161

Query  547  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GTGMGGLTVFSDGVQALIEKG+RKITPFFIPYAITNMGSALLA+D+GFMG
Sbjct  162  GTGMGGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAMDIGFMG  211



>ref|XP_004964587.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=462

 Score =   287 bits (735),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DPKKRVVITGMGLVSVFGNDVDAYYD+LLAGESGI  IDRFDASKFPTRF GQIR
Sbjct  40   PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  99

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENAD--LGADGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDCLRYCIV+GKKALE+A   LG+  + KIDK RAG+LVGTGMG
Sbjct  100  GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALESAGIALGSKPMEKIDKARAGVLVGTGMG  159

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLTVFSDGVQ LIEKGYRKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  160  GLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMG  204



>ref|XP_010932377.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=470

 Score =   287 bits (735),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S   AP+RE DPKKRVVITGMGLVSVFGNDVD YY+KLL GESGI  IDRFDASKFPT+F
Sbjct  43   SVAVAPRRETDPKKRVVITGMGLVSVFGNDVDVYYEKLLEGESGIGLIDRFDASKFPTKF  102

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILV  546
             GQIRGF +EGYIDGKNDRRLDDCLRYC+V+GKKALE+A L  G+  + KIDK RAG+LV
Sbjct  103  AGQIRGFSSEGYIDGKNDRRLDDCLRYCLVSGKKALESAGLGVGSKDLSKIDKVRAGVLV  162

Query  547  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITN GSALLA+D+GFMG
Sbjct  163  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNTGSALLAMDIGFMG  212



>ref|NP_001149639.1| 3-oxoacyl-synthase I [Zea mays]
 gb|ACG36200.1| 3-oxoacyl-synthase I [Zea mays]
 gb|AFW76633.1| 3-oxoacyl-synthase I [Zea mays]
Length=461

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            +  AAP+RE DPKKRVVITGMGLVSVFGNDVDAYYD+LL GESGI  IDRFDASKFPTRF
Sbjct  34   TVVAAPRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLVGESGIGPIDRFDASKFPTRF  93

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILV  546
             GQIRGF +EGYIDGKNDRRLDDCLRYCIV+GKKALE + +  G+  + KIDK RAG+LV
Sbjct  94   AGQIRGFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEASGIAHGSKPMEKIDKTRAGVLV  153

Query  547  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GTGMGGLTVFSDGVQ LIEKGYRKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  154  GTGMGGLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMG  203



>ref|NP_001146139.1| uncharacterized protein LOC100279707 [Zea mays]
 gb|ACL53339.1| unknown [Zea mays]
Length=437

 Score =   286 bits (731),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DPKKRVVITGMGLVSVFGNDVDAYYD+LLAGESGI  IDRFDASKFPTRF GQIR
Sbjct  15   PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  74

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDCLRYCIV+GKKALE A +  G+  + KIDK RAG+LVGTGMG
Sbjct  75   GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGIAHGSKPMEKIDKTRAGVLVGTGMG  134

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLTVFSDGVQ LIEKGYRKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  135  GLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMG  179



>gb|AFW85455.1| hypothetical protein ZEAMMB73_016804 [Zea mays]
Length=461

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DPKKRVVITGMGLVSVFGNDVDAYYD+LLAGESGI  IDRFDASKFPTRF GQIR
Sbjct  39   PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  98

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDCLRYCIV+GKKALE A +  G+  + KIDK RAG+LVGTGMG
Sbjct  99   GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGIAHGSKPMEKIDKTRAGVLVGTGMG  158

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLTVFSDGVQ LIEKGYRKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  159  GLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMG  203



>gb|AFW85456.1| hypothetical protein ZEAMMB73_016804 [Zea mays]
Length=481

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DPKKRVVITGMGLVSVFGNDVDAYYD+LLAGESGI  IDRFDASKFPTRF GQIR
Sbjct  39   PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  98

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDCLRYCIV+GKKALE A +  G+  + KIDK RAG+LVGTGMG
Sbjct  99   GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGIAHGSKPMEKIDKTRAGVLVGTGMG  158

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLTVFSDGVQ LIEKGYRKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  159  GLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMG  203



>ref|XP_009401483.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = +1

Query  88   STALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITGMGLVS  267
             T L P+ +D LR ++   P  +  R       V ++ A P+RE DPKKRVVITGMGLVS
Sbjct  2    QTLLLPA-VDGLRLSSPEPPPTLRRRSPRPLTAVRASAAPPRRETDPKKRVVITGMGLVS  60

Query  268  VFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRLDDCL  447
            VFGNDVDAYYDKLL GE GI  IDRFDASKFPTRF GQIRGF +EGYIDGKNDRRLD CL
Sbjct  61   VFGNDVDAYYDKLLQGECGIGLIDRFDASKFPTRFAGQIRGFSSEGYIDGKNDRRLDGCL  120

Query  448  RYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGYRKI  621
            RYC+V+GKKALE+A L  G+  + KIDK RAG+LVGTGMGGL++FSDGVQALIEKG+RKI
Sbjct  121  RYCLVSGKKALESAGLGVGSQTLNKIDKVRAGVLVGTGMGGLSIFSDGVQALIEKGHRKI  180

Query  622  TPFFIPYAITNMGSALLAIDLGFMG  696
            TPFFIPYAITNMGSALLA+D+GFMG
Sbjct  181  TPFFIPYAITNMGSALLAMDIGFMG  205



>ref|XP_002438009.1| hypothetical protein SORBIDRAFT_10g006430 [Sorghum bicolor]
 gb|EER89376.1| hypothetical protein SORBIDRAFT_10g006430 [Sorghum bicolor]
Length=461

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DPKKRVVITGMGLVSVFGNDVDAYYD+LLAGESGI  IDRFDASKFPTRF GQIR
Sbjct  39   PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  98

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENA--DLGADGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDCLRYCIV+GKKALE A   LG+  + KIDK RAG+LVGTGMG
Sbjct  99   GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGIGLGSKPMEKIDKTRAGVLVGTGMG  158

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLTVF DGVQ LIEKGYRKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  159  GLTVFQDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMG  203



>ref|XP_006653452.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Oryza brachyantha]
Length=450

 Score =   284 bits (727),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DP+KRVVITGMGLVSVFGN+VDA+YD+LLAGESG+  IDRFDA  FPTRF GQIR
Sbjct  28   PRRETDPRKRVVITGMGLVSVFGNEVDAFYDRLLAGESGVGPIDRFDAGSFPTRFAGQIR  87

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDCLRYCIV+GKKALENA L  G+DG  K+DK RAG+LVGTGMG
Sbjct  88   GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHSKLDKVRAGVLVGTGMG  147

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLTVFSDGVQ LIEKGY+KI+PFFIPYAITNMGSALLA+D+GFMG
Sbjct  148  GLTVFSDGVQNLIEKGYKKISPFFIPYAITNMGSALLAMDVGFMG  192



>gb|EAY94286.1| hypothetical protein OsI_16057 [Oryza sativa Indica Group]
Length=462

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +AP+RE DP+KRVVITGMGLVSVFGN+VDA+Y++LLAGESG+ AIDRFDA  FPTRF GQ
Sbjct  38   SAPRRETDPRKRVVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQ  97

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTG  555
            IRGF +EGYIDGKNDRRLDDCLRYCIV+GKKALENA L  G+DG  K+DK RAG+LVGTG
Sbjct  98   IRGFSSEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTG  157

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGGLTVFSDGVQ LIEKGY+KI+PFFIPYAITNMGSALLA+D  FMG
Sbjct  158  MGGLTVFSDGVQNLIEKGYKKISPFFIPYAITNMGSALLAMDASFMG  204



>ref|XP_001762048.1| predicted protein [Physcomitrella patens]
 gb|EDQ73152.1| predicted protein, partial [Physcomitrella patens]
Length=431

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S ++APKRE DPKKRVVITGMGLVSVFGNDVD +YDKLL G SGI  IDRFD SKFPT+F
Sbjct  6    SVSSAPKRETDPKKRVVITGMGLVSVFGNDVDTFYDKLLEGTSGIDIIDRFDTSKFPTKF  65

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGT  552
             GQIRGF A+GYIDGKNDRRLDD LRYC+V+GK+ALE+A LG + + ++DK++ G+LVGT
Sbjct  66   AGQIRGFSAKGYIDGKNDRRLDDSLRYCLVSGKRALEDAGLGGENLNQVDKQKVGVLVGT  125

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGGLTVFSDGVQAL+EKG+++ITPFFIPYAITNMGSALLAIDLG MG
Sbjct  126  GMGGLTVFSDGVQALVEKGHKRITPFFIPYAITNMGSALLAIDLGLMG  173



>gb|ABR18442.1| unknown [Picea sitchensis]
Length=545

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            A +REKDPKKRVVITGMGLVSVFGN+VD YY++LL G+SGI+ IDRFDASKFPTRFGGQI
Sbjct  124  ALQREKDPKKRVVITGMGLVSVFGNNVDTYYERLLEGQSGIAPIDRFDASKFPTRFGGQI  183

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
            RGF +E YID KNDRRLDDC+RYC+V+G+KALE+ADLG D I KIDKERAG+LVG+GMGG
Sbjct  184  RGFSSEDYIDPKNDRRLDDCIRYCLVSGQKALEDADLGKDKINKIDKERAGVLVGSGMGG  243

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            L VFSDGVQAL++KGYRKITPFFIPYAITNMGSALL I++GFMG
Sbjct  244  LKVFSDGVQALLDKGYRKITPFFIPYAITNMGSALLGIEVGFMG  287



>ref|XP_006656734.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Oryza brachyantha]
Length=438

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +1

Query  214  REKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGF  393
            RE DP+KRVVITGMGLVSVFGN+VDAYYD+LLAGESG+  IDRFDAS FPTRF GQIRGF
Sbjct  18   RETDPRKRVVITGMGLVSVFGNEVDAYYDRLLAGESGVGPIDRFDASNFPTRFAGQIRGF  77

Query  394  KAEGYIDGKNDRRLDDCLRYCIVAGKKALENAD--LGADGIGKIDKERAGILVGTGMGGL  567
             +EGYIDGKNDRRLDDCLRYCIV+GKKALE+AD  LG+  + KI+K RAG+LVGTGMGGL
Sbjct  78   SSEGYIDGKNDRRLDDCLRYCIVSGKKALESADLALGSKSMDKIEKTRAGVLVGTGMGGL  137

Query  568  TVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            TVFSDGVQ LIEKG+RKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  138  TVFSDGVQNLIEKGHRKITPFFIPYAITNMGSALLGMDIGFMG  180



>ref|NP_001052904.1| Os04g0445700 [Oryza sativa Japonica Group]
 dbj|BAF14818.1| Os04g0445700 [Oryza sativa Japonica Group]
Length=442

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +1

Query  211  KREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRG  390
            +RE DP+KRVVITGMGLVSVFGN+VDA+Y++LLAGESG+ AIDRFDA  FPTRF GQIRG
Sbjct  21   RRETDPRKRVVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRG  80

Query  391  FKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGG  564
            F +EGYIDGKNDRRLDDCLRYCIV+GKKALENA L  G+DG  K+DK RAG+LVGTGMGG
Sbjct  81   FSSEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGG  140

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LTVFSDGVQ LIEKGY+KI+PFFIPYAITNMGSALLA+D GFMG
Sbjct  141  LTVFSDGVQNLIEKGYKKISPFFIPYAITNMGSALLAMDAGFMG  184



>ref|XP_001776124.1| predicted protein [Physcomitrella patens]
 gb|EDQ59035.1| predicted protein [Physcomitrella patens]
Length=470

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            SA +APKRE DPKKRVVITGMGLVSVFGNDV+ +YDKLL G SGI  IDRFD SKFPT+F
Sbjct  45   SAQSAPKRETDPKKRVVITGMGLVSVFGNDVNTFYDKLLEGTSGIDIIDRFDISKFPTKF  104

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGT  552
             GQIRGF A+GYIDGKNDRRLDD LRYC+V+GK+ALE+A LG + + ++DK++ G+LVGT
Sbjct  105  AGQIRGFSAKGYIDGKNDRRLDDSLRYCLVSGKRALEDAGLGGENLNQVDKQKVGVLVGT  164

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGGLTVFSDGVQAL+EKG+++ITPFFIPYAITNMGSALLAIDLG MG
Sbjct  165  GMGGLTVFSDGVQALVEKGHKRITPFFIPYAITNMGSALLAIDLGLMG  212



>ref|NP_001032018.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 gb|AED95364.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=418

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 169/212 (80%), Gaps = 13/212 (6%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLR---KTTSHFPSGvavrplprrlrvvSATA----APKREKDPK  231
            MQAL S++LR SP +PLR      SH     A     ++   +SA+A    APKRE DPK
Sbjct  1    MQALQSSSLRASPPNPLRLPSNRQSHQLITNARPLRRQQRSFISASASTVSAPKRETDPK  60

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIRGF +EGYI
Sbjct  61   KRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYI  120

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            DGKN+RRLDDCL+YCIVAGKKALE+A+LG D +  IDK +AG+LVGTGMGGLTVFS+GVQ
Sbjct  121  DGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGMGGLTVFSEGVQ  180

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLG  687
             LIEKG+R+I+PFFIPYA      A++ I LG
Sbjct  181  NLIEKGHRRISPFFIPYA------AIIPIGLG  206



>emb|CBI30851.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +1

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFGNDVDAYY+KLLAGESGIS IDRFDASKFPTRFGGQIRGF ++GYIDGKNDRR
Sbjct  1    MGLVSVFGNDVDAYYEKLLAGESGISPIDRFDASKFPTRFGGQIRGFDSQGYIDGKNDRR  60

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LDDCLRYCIVAGKKALE+ADLG   I KIDKERAG+LVGTGMGGLTVFSDGVQALIE+G+
Sbjct  61   LDDCLRYCIVAGKKALEDADLGGADISKIDKERAGVLVGTGMGGLTVFSDGVQALIERGH  120

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            RKITPFFIPYAITNMGSALLAIDLGFMG
Sbjct  121  RKITPFFIPYAITNMGSALLAIDLGFMG  148



>gb|AAK58535.1| beta-ketoacyl-ACP synthetase I [Coriandrum sativum]
Length=456

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            + +A+PKREKDPKKRVV+TG+G+VSVFGNDVD YYDKLLAGESG+  IDRFDAS+FPTRF
Sbjct  33   ATSASPKREKDPKKRVVVTGLGVVSVFGNDVDTYYDKLLAGESGVDFIDRFDASEFPTRF  92

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGT  552
              QIR F +EGYID KNDRRLD+CLRY IVAGKKALENA LG D   KIDKERAG+LVG+
Sbjct  93   AAQIRAFSSEGYIDSKNDRRLDNCLRYNIVAGKKALENAGLGEDMRSKIDKERAGVLVGS  152

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGG+T F DGV+ LI KGY+KI+PFFIPY ITNMGSALLAIDLGFMG
Sbjct  153  GMGGITAFCDGVENLITKGYKKISPFFIPYTITNMGSALLAIDLGFMG  200



>dbj|BAH00228.1| unnamed protein product [Oryza sativa Japonica Group]
Length=462

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = +1

Query  217  EKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFK  396
            E DP+KRVVITGMGLVSVFGN+VDA+Y++LLAGESG+ AIDRFDA  FPTRF GQIRGF 
Sbjct  43   ETDPRKRVVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFS  102

Query  397  AEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGGLT  570
            +EGYIDGKNDRRLDDCLRYCIV+GKKALENA L  G+DG  K+DK RAG+LVGTGMGGLT
Sbjct  103  SEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLT  162

Query  571  VFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            VFSDGVQ LIEKGY+KI+PFFIPYAITNMGSALLA+D GFMG
Sbjct  163  VFSDGVQNLIEKGYKKISPFFIPYAITNMGSALLAMDAGFMG  204



>ref|NP_001057053.1| Os06g0196600 [Oryza sativa Japonica Group]
 dbj|BAD35225.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplast 
precursor [Oryza sativa Japonica Group]
 dbj|BAF18967.1| Os06g0196600 [Oryza sativa Japonica Group]
 dbj|BAG87476.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   277 bits (708),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 2/162 (1%)
 Frame = +1

Query  217  EKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFK  396
            E DP+KRVVITGMGLVSVFGNDVDAYYD+LLAGESGI  IDRFDAS FPTRF GQIRGF 
Sbjct  46   ETDPRKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASNFPTRFAGQIRGFS  105

Query  397  AEGYIDGKNDRRLDDCLRYCIVAGKKALENAD--LGADGIGKIDKERAGILVGTGMGGLT  570
            +EGYIDGKNDRRLDDCLRYCIV+GKKALE+A   LG+  + KI+K RAG+LVGTGMGGLT
Sbjct  106  SEGYIDGKNDRRLDDCLRYCIVSGKKALESAGLALGSKSMDKIEKTRAGVLVGTGMGGLT  165

Query  571  VFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            VFSDGVQ LIEKG+RKITPFFIPYAITNMGSALL +D+GFMG
Sbjct  166  VFSDGVQNLIEKGHRKITPFFIPYAITNMGSALLGMDIGFMG  207



>ref|XP_002960175.1| hypothetical protein SELMODRAFT_229853 [Selaginella moellendorffii]
 ref|XP_002967530.1| hypothetical protein SELMODRAFT_231054 [Selaginella moellendorffii]
 gb|EFJ32129.1| hypothetical protein SELMODRAFT_231054 [Selaginella moellendorffii]
 gb|EFJ37714.1| hypothetical protein SELMODRAFT_229853 [Selaginella moellendorffii]
Length=430

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            PKRE DPKKRVVITGMGLVSVFGNDVD YYDKLL G+SG+  IDRFDAS+FPT+F  QIR
Sbjct  10   PKRETDPKKRVVITGMGLVSVFGNDVDTYYDKLLDGQSGVGLIDRFDASQFPTKFAAQIR  69

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGL  567
             F A+GYIDGKNDRRLDDCLRY IV GK+ALE+ADLG D + K+DK+R G+L+G+GMGGL
Sbjct  70   DFSAKGYIDGKNDRRLDDCLRYGIVGGKRALEHADLGGDKLDKVDKQRVGVLIGSGMGGL  129

Query  568  TVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +VFSDGVQ+LIEKGYR+ITPFFIPY+ITNM SALLAI+LG MG
Sbjct  130  SVFSDGVQSLIEKGYRRITPFFIPYSITNMASALLAIELGLMG  172



>ref|XP_007040574.1| 3-ketoacyl-acyl carrier protein synthase I [Theobroma cacao]
 gb|EOY25075.1| 3-ketoacyl-acyl carrier protein synthase I [Theobroma cacao]
Length=494

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 165/208 (79%), Gaps = 5/208 (2%)
 Frame = +1

Query  73   MQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITG  252
            ++A+ S  L  +   P R  +S  P G  +R +          +APKREKDPKKR+VITG
Sbjct  34   LRAVESVQLALTCTKPNRFISSSAPKGRTIRAVAS-----PTVSAPKREKDPKKRIVITG  88

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS +  RFGGQIR F ++GYIDGKNDRR
Sbjct  89   MGLVSVFGSDIDNFYNKLLEGESGISEIDRFDASTYSVRFGGQIRDFSSKGYIDGKNDRR  148

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LDDC RYC+VAGK+ALE+A+LG+  + K+D+ R G+LVGTGMGGLTVFS+GV+ALI+KGY
Sbjct  149  LDDCWRYCLVAGKRALEDANLGSQVLEKMDRTRVGVLVGTGMGGLTVFSNGVEALIQKGY  208

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            +KITPFFIPY+ITNMGSALLAID G MG
Sbjct  209  KKITPFFIPYSITNMGSALLAIDTGLMG  236



>ref|XP_007160188.1| hypothetical protein PHAVU_002G300400g [Phaseolus vulgaris]
 gb|ESW32182.1| hypothetical protein PHAVU_002G300400g [Phaseolus vulgaris]
Length=495

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 153/193 (79%), Gaps = 1/193 (1%)
 Frame = +1

Query  121  LRKTTSHFPSGvavrplprrlrvvSAT-AAPKREKDPKKRVVITGMGLVSVFGNDVDAYY  297
            L    SH+ S  +         + S T AAP REKDPKKRVVITGMGLVSVFG+D+DA+Y
Sbjct  45   LATNPSHYISASSSPRCRTIKAMASPTVAAPNREKDPKKRVVITGMGLVSVFGSDIDAFY  104

Query  298  DKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKA  477
            +KLL GESGIS IDRFDAS F  RFGGQIR F +EGYIDGKNDRRLDDC RYCIVAGK+A
Sbjct  105  NKLLEGESGISLIDRFDASSFSVRFGGQIRDFSSEGYIDGKNDRRLDDCWRYCIVAGKRA  164

Query  478  LENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNM  657
            L +A+LG   +  +DK R G+LVGTGMGGLT FS GVQALI+KGY+KITPFFIPY+ITNM
Sbjct  165  LNDANLGQQVLDTMDKTRIGVLVGTGMGGLTAFSSGVQALIQKGYKKITPFFIPYSITNM  224

Query  658  GSALLAIDLGFMG  696
            GSALLAID G MG
Sbjct  225  GSALLAIDTGLMG  237



>sp|P23902.1|KASC1_HORVU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic; 
AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS 
I; Flags: Precursor [Hordeum vulgare]
 gb|AAA32968.1| beta-ketoacyl-ACP synthase I [Hordeum vulgare]
 dbj|BAJ88844.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   274 bits (701),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DP+KRVVITGMGL SVFG+DVD +YD+LLAGESG+  IDRFDAS FPTRF GQIR
Sbjct  40   PQRETDPRKRVVITGMGLASVFGSDVDTFYDRLLAGESGVGPIDRFDASSFPTRFAGQIR  99

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGA--DGIGKIDKERAGILVGTGMG  561
            GF +EGYIDGKNDRRLDDC+RYCI++GKKALE+A LGA  D   K+D  RAG+LVGTGMG
Sbjct  100  GFSSEGYIDGKNDRRLDDCIRYCILSGKKALESAGLGAGSDAHVKLDVGRAGVLVGTGMG  159

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GL+VFSDGVQ LIEKGYRKI+PFFIPYAITNMGSALLAID+GFMG
Sbjct  160  GLSVFSDGVQNLIEKGYRKISPFFIPYAITNMGSALLAIDVGFMG  204



>ref|XP_001762687.1| predicted protein [Physcomitrella patens]
 gb|EDQ72486.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
             A +APKRE DPKKRVVITGMGLVSVFGNDV+ +YDKLL G SGI  IDRFD SKFPT+F
Sbjct  35   QAQSAPKRETDPKKRVVITGMGLVSVFGNDVNTFYDKLLEGASGIDTIDRFDISKFPTKF  94

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGT  552
             GQI+GF ++GYIDGKNDRRLDD LRYC+V+GK+ALE+A LG + + ++DK++ G+L+GT
Sbjct  95   AGQIKGFSSQGYIDGKNDRRLDDTLRYCLVSGKRALEDAGLGGENLNQVDKKKVGVLIGT  154

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGGL+VFSDGVQAL+EKG+++ITPFFIPY ITNMGSALLAIDLG MG
Sbjct  155  GMGGLSVFSDGVQALVEKGHKRITPFFIPYTITNMGSALLAIDLGLMG  202



>ref|XP_006603178.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Glycine max]
Length=269

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFG+DVDA+Y+KLL GESGIS IDRFDAS F  RFGGQI
Sbjct  19   APKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASNFSVRFGGQI  78

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
            R F +EGYIDGKNDRRLD+C RYCIVAGK+AL++A+LG   +  +DK R G+LVG+GMGG
Sbjct  79   RDFCSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTMDKTRIGVLVGSGMGG  138

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +T FS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  139  ITTFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  182



>gb|KDP25270.1| hypothetical protein JCGZ_20426 [Jatropha curcas]
Length=489

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKRVVITGMG+VSVFGNDVDA+Y+KLL GESGIS IDRFDAS F  RF GQ
Sbjct  67   SAPKREKDPKKRVVITGMGVVSVFGNDVDAFYNKLLEGESGISLIDRFDASSFSVRFAGQ  126

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAGK+ALE+A+LG + +  +D+ R G+L+GTGMG
Sbjct  127  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALEDANLGPEVLDNMDRTRTGVLIGTGMG  186

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS+GV+ALI+KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  187  GLTAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  231



>ref|NP_001241906.1| uncharacterized protein LOC100808453 [Glycine max]
 gb|ACU19800.1| unknown [Glycine max]
Length=490

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            AAPKREKDPKKRVVITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS FP RFGGQ
Sbjct  68   AAPKREKDPKKRVVITGMGLVSVFGSDIDGFYNKLLEGESGISLIDRFDASNFPVRFGGQ  127

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F +EGYIDG NDRRLDDC RYCIVAGK+AL++A+LG   +  +DK R G+LVG+GMG
Sbjct  128  IRDFSSEGYIDGMNDRRLDDCWRYCIVAGKRALDDANLGQQVLDTMDKTRVGVLVGSGMG  187

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T FS GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  188  GITAFSTGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  232



>gb|KHN12535.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=381

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFG+DVDA+Y+KLL GESGIS IDRF+AS F  RFGGQI
Sbjct  8    APKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFNASNFSVRFGGQI  67

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
            R F +EGYIDGKNDRRLD+C RYCIVAGK+AL++A+LG   +  +DK R G+LVG+GMGG
Sbjct  68   RDFCSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTMDKTRIGVLVGSGMGG  127

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +T FS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  128  ITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  171



>ref|XP_003530435.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN16724.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=491

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFG+DVDA+Y+KLL GESGIS IDRFDAS F  RFGGQI
Sbjct  70   APKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASNFSVRFGGQI  129

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
            R F +EGYIDGKNDRRLD+C RYCIVAGK+AL++A+LG   +  +DK R G+LVG+GMGG
Sbjct  130  RDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTMDKTRIGVLVGSGMGG  189

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +T FS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  190  ITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  233



>ref|XP_006579443.1| PREDICTED: uncharacterized protein LOC100808453 isoform X2 [Glycine 
max]
 ref|XP_006579444.1| PREDICTED: uncharacterized protein LOC100808453 isoform X3 [Glycine 
max]
Length=430

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            AAPKREKDPKKRVVITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS FP RFGGQ
Sbjct  7    AAPKREKDPKKRVVITGMGLVSVFGSDIDGFYNKLLEGESGISLIDRFDASNFPVRFGGQ  66

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIG-KIDKERAGILVGTGM  558
            IR F +EGYIDGKNDRRLDDC RYCIVAGK+AL++A+LG   +  ++DK R G+LVG+GM
Sbjct  67   IRDFSSEGYIDGKNDRRLDDCWRYCIVAGKRALDDANLGQQVLDTQMDKTRIGVLVGSGM  126

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GG+T FS GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  127  GGITAFSTGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  172



>ref|XP_006584770.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X3 [Glycine max]
Length=492

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFG+DVDA+Y+KLL GESGIS IDRFDAS F  RFGGQI
Sbjct  71   APKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASNFSVRFGGQI  130

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
            R F +EGYIDGKNDRRLD+C RYCIVAGK+AL++A+LG   +  +DK R G+LVG+GMGG
Sbjct  131  RDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTMDKTRIGVLVGSGMGG  190

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +T FS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  191  ITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  234



>ref|XP_010053160.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Eucalyptus grandis]
 ref|XP_010053161.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW77416.1| hypothetical protein EUGRSUZ_D01763 [Eucalyptus grandis]
Length=429

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKRVVITGMGLVSVFGNDVD +Y KLL GESGIS IDRFDAS F  RF GQ
Sbjct  7    SAPKREKDPKKRVVITGMGLVSVFGNDVDNFYSKLLEGESGISLIDRFDASSFSVRFAGQ  66

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYI GKNDRRLDDC RYCIVAGK+ALE+A+LG+  +  +DK R G+LVGTGMG
Sbjct  67   IRNFSSDGYIVGKNDRRLDDCWRYCIVAGKRALEDANLGSMVLDTMDKTRIGVLVGTGMG  126

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G++VFS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  127  GISVFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  171



>ref|XP_003579824.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
isoform X2 [Brachypodium distachyon]
Length=462

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 2/169 (1%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A  AP+RE DP+KRVVITG+GLVSVFG++VD +YD+LLAGESG+  IDRFD   FPTRF 
Sbjct  36   AAVAPQRETDPRKRVVITGLGLVSVFGSEVDGFYDRLLAGESGVRTIDRFDPGSFPTRFA  95

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENA--DLGADGIGKIDKERAGILVG  549
            GQIRGF +EGYID KNDRR+DDC+RYCIV+G+KALE+A  D G+D  GKID  RAG+LVG
Sbjct  96   GQIRGFSSEGYIDAKNDRRMDDCIRYCIVSGRKALESAGLDRGSDAHGKIDLGRAGVLVG  155

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            TGMGGL+VFS+GVQ LIEKGYRKI+PFFIPYAI+NMGSALLA D+GFMG
Sbjct  156  TGMGGLSVFSNGVQNLIEKGYRKISPFFIPYAISNMGSALLATDVGFMG  204



>ref|XP_011022477.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=493

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKREKDPKKRVVITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS FP RF 
Sbjct  69   AVSAPKREKDPKKRVVITGMGLVSVFGSDIDTFYNKLLEGESGISLIDRFDASSFPVRFA  128

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F ++GYIDGKNDRRLDDC RYC+VAGK+AL +A+LG++ +  +D+ R G+LVGTG
Sbjct  129  GQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALVDANLGSEVLENMDRTRIGVLVGTG  188

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGGLT FS+GV++L++KGY+KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  189  MGGLTAFSNGVESLVQKGYKKISPFFIPYSITNMGSALLAIDTGLMG  235



>ref|XP_006579442.1| PREDICTED: uncharacterized protein LOC100808453 isoform X1 [Glycine 
max]
Length=491

 Score =   270 bits (689),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            AAPKREKDPKKRVVITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS FP RFGGQ
Sbjct  68   AAPKREKDPKKRVVITGMGLVSVFGSDIDGFYNKLLEGESGISLIDRFDASNFPVRFGGQ  127

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGI-GKIDKERAGILVGTGM  558
            IR F +EGYIDGKNDRRLDDC RYCIVAGK+AL++A+LG   +  ++DK R G+LVG+GM
Sbjct  128  IRDFSSEGYIDGKNDRRLDDCWRYCIVAGKRALDDANLGQQVLDTQMDKTRIGVLVGSGM  187

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GG+T FS GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  188  GGITAFSTGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  233



>ref|XP_010239948.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
isoform X1 [Brachypodium distachyon]
Length=493

 Score =   270 bits (689),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 2/169 (1%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A  AP+RE DP+KRVVITG+GLVSVFG++VD +YD+LLAGESG+  IDRFD   FPTRF 
Sbjct  36   AAVAPQRETDPRKRVVITGLGLVSVFGSEVDGFYDRLLAGESGVRTIDRFDPGSFPTRFA  95

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENA--DLGADGIGKIDKERAGILVG  549
            GQIRGF +EGYID KNDRR+DDC+RYCIV+G+KALE+A  D G+D  GKID  RAG+LVG
Sbjct  96   GQIRGFSSEGYIDAKNDRRMDDCIRYCIVSGRKALESAGLDRGSDAHGKIDLGRAGVLVG  155

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            TGMGGL+VFS+GVQ LIEKGYRKI+PFFIPYAI+NMGSALLA D+GFMG
Sbjct  156  TGMGGLSVFSNGVQNLIEKGYRKISPFFIPYAISNMGSALLATDVGFMG  204



>ref|XP_004975742.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Setaria italica]
Length=461

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +1

Query  217  EKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFK  396
            E DP+KRVVITGMGLVSVFG+DV A+YD+LL GESG+  IDRFDA  FPTRF  QIR F 
Sbjct  42   ETDPRKRVVITGMGLVSVFGSDVGAFYDRLLQGESGVGPIDRFDAGSFPTRFAAQIRDFS  101

Query  397  AEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGGLT  570
            +EGYIDGKNDRRLDDCLRYCIV+GKKALENA L  G+D   K+DK RAG+LVGTGMGGLT
Sbjct  102  SEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLAKGSDAHVKLDKVRAGVLVGTGMGGLT  161

Query  571  VFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            VFSDGVQ LIEKGYRKI+PFFIPYAITNMGSALLA+D+GFMG
Sbjct  162  VFSDGVQNLIEKGYRKISPFFIPYAITNMGSALLAMDVGFMG  203



>ref|XP_002265207.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Vitis vinifera]
 emb|CBI34509.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKR+VITGMGLVSVFG+D+D +YDKLL G SGIS IDRFDAS F  RFGGQ
Sbjct  66   SAPKREKDPKKRIVITGMGLVSVFGSDIDTFYDKLLQGVSGISLIDRFDASNFSVRFGGQ  125

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAG++AL+NA LG + +  +D+ R G+LVG+GMG
Sbjct  126  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALDNASLGTEVLETMDRSRIGVLVGSGMG  185

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS+GV+ALI+KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  186  GLTAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  230



>ref|XP_006584769.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Glycine max]
Length=493

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFG+DVDA+Y+KLL GESGIS IDRFDAS F  RFGGQI
Sbjct  71   APKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASNFSVRFGGQI  130

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGI-GKIDKERAGILVGTGMG  561
            R F +EGYIDGKNDRRLD+C RYCIVAGK+AL++A+LG   +  ++DK R G+LVG+GMG
Sbjct  131  RDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTQMDKTRIGVLVGSGMG  190

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T FS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  191  GITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  235



>ref|XP_006584772.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X5 [Glycine max]
Length=491

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFG+DVDA+Y+KLL GESGIS IDRFDAS F  RFGGQI
Sbjct  69   APKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASNFSVRFGGQI  128

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGI-GKIDKERAGILVGTGMG  561
            R F +EGYIDGKNDRRLD+C RYCIVAGK+AL++A+LG   +  ++DK R G+LVG+GMG
Sbjct  129  RDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTQMDKTRIGVLVGSGMG  188

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T FS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  189  GITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  233



>ref|XP_006584771.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X4 [Glycine max]
Length=492

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFG+DVDA+Y+KLL GESGIS IDRFDAS F  RFGGQI
Sbjct  70   APKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASNFSVRFGGQI  129

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGI-GKIDKERAGILVGTGMG  561
            R F +EGYIDGKNDRRLD+C RYCIVAGK+AL++A+LG   +  ++DK R G+LVG+GMG
Sbjct  130  RDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTQMDKTRIGVLVGSGMG  189

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T FS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  190  GITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  234



>emb|CAD40964.2| OSJNBa0027P08.14 [Oryza sativa Japonica Group]
Length=442

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGN+VDA+Y++LLAGESG+ AIDRFDA  FPTRF GQIRGF +EGYIDG
Sbjct  30   VVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFSSEGYIDG  89

Query  418  KNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            KNDRRLDDCLRYCIV+GKKALENA L  G+DG  K+DK RAG+LVGTGMGGLTVFSDGVQ
Sbjct  90   KNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLTVFSDGVQ  149

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKGY+KI+PFFIPYAITNMGSALLA+D GFMG
Sbjct  150  NLIEKGYKKISPFFIPYAITNMGSALLAMDAGFMG  184



>emb|CAH67240.1| OSIGBa0140O07.8 [Oryza sativa Indica Group]
Length=442

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  VVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDG  417
            VVITGMGLVSVFGN+VDA+Y++LLAGESG+ AIDRFDA  FPTRF GQIRGF +EGYIDG
Sbjct  30   VVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFSSEGYIDG  89

Query  418  KNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            KNDRRLDDCLRYCIV+GKKALENA L  G+DG  K+DK RAG+LVGTGMGGLTVFSDGVQ
Sbjct  90   KNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLTVFSDGVQ  149

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             LIEKGY+KI+PFFIPYAITNMGSALLA+D GFMG
Sbjct  150  NLIEKGYKKISPFFIPYAITNMGSALLAMDAGFMG  184



>ref|XP_004975743.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Setaria italica]
Length=459

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  217  EKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFK  396
            E DP+KRVVITGMGLVSVFG+DV A+YD+LL GESG+  IDRFDA  FPTRF  QIR F 
Sbjct  42   ETDPRKRVVITGMGLVSVFGSDVGAFYDRLLQGESGVGPIDRFDAGSFPTRFAAQIRDFS  101

Query  397  AEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVF  576
            +EGYIDGKNDRRLDDCLRYCIV+GKKALENA L       +DK RAG+LVGTGMGGLTVF
Sbjct  102  SEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLAKGSDAHLDKVRAGVLVGTGMGGLTVF  161

Query  577  SDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            SDGVQ LIEKGYRKI+PFFIPYAITNMGSALLA+D+GFMG
Sbjct  162  SDGVQNLIEKGYRKISPFFIPYAITNMGSALLAMDVGFMG  201



>gb|ADE76842.1| unknown [Picea sitchensis]
Length=481

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            + PKREKDPKKR+VITGMGLVSVFG+DVD++YDKLL G+SGI  IDRFDAS +  RF GQ
Sbjct  59   SVPKREKDPKKRIVITGMGLVSVFGSDVDSFYDKLLEGQSGIGFIDRFDASSYSVRFAGQ  118

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IRGF A GYIDGKNDRRLDDC RYC+V+GK ALENADLG + + K+DK R G+LVG+G+G
Sbjct  119  IRGFSANGYIDGKNDRRLDDCWRYCLVSGKMALENADLGKEKLEKLDKSRIGVLVGSGIG  178

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT +SDG++AL++KGY++ITPFFIPY I+NMGSALLAID G MG
Sbjct  179  GLTAYSDGIKALLQKGYKRITPFFIPYTISNMGSALLAIDTGLMG  223



>gb|AGJ84410.1| beta-ketoacyl-ACP synthase I [Cocos nucifera]
Length=494

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +1

Query  121  LRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYD  300
            +RK    FPS  +++    R       AAPKREKDPKKR+V+TG+GLVSVFG+D+D +Y+
Sbjct  45   MRKPNGPFPSLPSLKSPRIRAVASPTVAAPKREKDPKKRIVVTGIGLVSVFGSDIDTFYN  104

Query  301  KLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKAL  480
            KLL G+SGIS IDRFDAS +  RFGGQIR F ++GYIDGKNDRRLDDC RYC+VAGK+AL
Sbjct  105  KLLEGQSGISLIDRFDASSYSVRFGGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRAL  164

Query  481  ENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMG  660
            ++A+LG + +  +D+ R G+LVGTGMGGLT FS+GV+ALI+KGY+KITPFFIPY+ITNMG
Sbjct  165  DDANLGPEVLQSMDRSRIGVLVGTGMGGLTAFSNGVEALIQKGYKKITPFFIPYSITNMG  224

Query  661  SALLAIDLGFMG  696
            SALLAI+ G MG
Sbjct  225  SALLAIETGLMG  236



>ref|XP_002299456.1| hypothetical protein POPTR_0001s10890g [Populus trichocarpa]
 gb|EEE84261.1| hypothetical protein POPTR_0001s10890g [Populus trichocarpa]
Length=495

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 161/212 (76%), Gaps = 9/212 (4%)
 Frame = +1

Query  61   PATTMQALNSTALRPSPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRV  240
            P   MQ L  T  RPS         S   SG+  +    R  V    +APKREKDPKKRV
Sbjct  35   PVENMQ-LAPTGRRPSG--------SISTSGMTSKSRTIRAMVSQTVSAPKREKDPKKRV  85

Query  241  VITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGK  420
            VITGMGLVSVFG+ +D +YDKLL GESGIS IDRFDAS F  RF GQIR F ++GYIDGK
Sbjct  86   VITGMGLVSVFGSGIDTFYDKLLEGESGISLIDRFDASSFSVRFAGQIRDFSSKGYIDGK  145

Query  421  NDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALI  600
            NDRRLDDC RYC+VAGK+ALE+A+LG++ +  +D+ R G+LVGTGMGGLT FS+GV++L+
Sbjct  146  NDRRLDDCWRYCLVAGKRALEDANLGSEVLENMDRTRIGVLVGTGMGGLTAFSNGVESLV  205

Query  601  EKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +KGY+K++PFFIPY+ITNMGSALLAID G MG
Sbjct  206  QKGYKKMSPFFIPYSITNMGSALLAIDTGLMG  237



>ref|XP_002303661.2| hypothetical protein POPTR_0003s14190g [Populus trichocarpa]
 gb|EEE78640.2| hypothetical protein POPTR_0003s14190g [Populus trichocarpa]
Length=493

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKRVVITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS F  RF GQ
Sbjct  71   SAPKREKDPKKRVVITGMGLVSVFGSDIDTFYNKLLEGESGISLIDRFDASSFSVRFAGQ  130

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAGK+AL +A+LG++ +  +D+ R G+LVGTGMG
Sbjct  131  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALVDANLGSELLENMDRTRIGVLVGTGMG  190

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS+GV++L++KGY+KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  191  GLTAFSNGVESLVQKGYKKISPFFIPYSITNMGSALLAIDTGLMG  235



>gb|KHG26930.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=486

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKRE DPKKR+VITGMGLVSVFG+D+D +Y+KLL GESGI+ ID+FDA+ +  RF GQ
Sbjct  69   SAPKRETDPKKRIVITGMGLVSVFGSDIDNFYNKLLEGESGITQIDKFDATNYSVRFAGQ  128

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAG++AL+ A+LG++ + K+DK R G+LVGTGMG
Sbjct  129  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALDEANLGSEALEKLDKTRIGVLVGTGMG  188

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS+GV+ALI+KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  189  GLTAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  233



>gb|KJB24182.1| hypothetical protein B456_004G131800 [Gossypium raimondii]
Length=491

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKRE DPKKR+VITGMGLVSVFG+D+D +Y+KLL GESGI+ ID+FDA+ +  RF GQ
Sbjct  69   SAPKRETDPKKRIVITGMGLVSVFGSDIDNFYNKLLEGESGITQIDKFDATNYSVRFAGQ  128

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAG++AL+ A+LG++ + K+DK R G+LVGTGMG
Sbjct  129  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALDEANLGSEALEKLDKTRIGVLVGTGMG  188

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS+GV+ALI+KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  189  GLTAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  233



>ref|XP_010915981.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=493

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +1

Query  121  LRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYD  300
            +RK    FPS  +++ L  R       AAPKREKDPKKR+V+TG+GLVSVFG+D+D +Y+
Sbjct  44   VRKPNGSFPSVPSLKSLRIRAVASPTVAAPKREKDPKKRIVVTGIGLVSVFGSDIDTFYN  103

Query  301  KLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKAL  480
            KLL G+SGIS IDRFDAS +  RFGGQIR F ++GYIDGKNDRRLDDC RYC+VAGK+AL
Sbjct  104  KLLEGQSGISLIDRFDASSYSVRFGGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRAL  163

Query  481  ENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMG  660
            ++A+LG + +  +D+ R G+LVG+GMGGLT FS+GV+ALI+KGY+KITPFFIPY+ITN G
Sbjct  164  DDANLGPEVLQSMDRSRIGVLVGSGMGGLTAFSNGVEALIQKGYKKITPFFIPYSITNTG  223

Query  661  SALLAIDLGFMG  696
            SALLAI+ G MG
Sbjct  224  SALLAIETGLMG  235



>ref|XP_002518849.1| 3-oxoacyl-[acyl-carrier-protein] synthase, putative [Ricinus 
communis]
 gb|EEF43382.1| 3-oxoacyl-[acyl-carrier-protein] synthase, putative [Ricinus 
communis]
Length=485

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKRE+DPKKRVVITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS F  RF GQ
Sbjct  63   SAPKRERDPKKRVVITGMGLVSVFGSDIDTFYNKLLEGESGISLIDRFDASGFSVRFAGQ  122

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAGK+AL++A+LG+  +  +D+ + G+L+GTGMG
Sbjct  123  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALDDANLGSQVLEDMDRTKIGVLIGTGMG  182

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS+GV+AL++KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  183  GLTAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  227



>ref|XP_011026849.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=493

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKRVVITGMGLVSVFG+ +D +YDKLL GESGIS IDRFDAS F  RF GQ
Sbjct  71   SAPKREKDPKKRVVITGMGLVSVFGSGIDTFYDKLLEGESGISLIDRFDASSFSVRFAGQ  130

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAGK+ALE+A+LG++ +  +D+ R G+LVGTGMG
Sbjct  131  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALEDANLGSEVLENMDRTRIGVLVGTGMG  190

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS+GV++L++KGY+K++PFFIPY+ITNMGSALLA D G MG
Sbjct  191  GLTAFSNGVESLVQKGYKKMSPFFIPYSITNMGSALLARDTGLMG  235



>gb|KEH21261.1| 3-oxoacyl-[acyl-carrier] synthase [Medicago truncatula]
Length=291

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  TAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGG  378
             AAPKREKDPKKRVVITGMGLVSVFG+++D +Y+KLL GESGIS IDRFDAS FP  FGG
Sbjct  65   VAAPKREKDPKKRVVITGMGLVSVFGSNIDTFYNKLLEGESGISLIDRFDASSFPVHFGG  124

Query  379  QIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGM  558
            QIR F ++GYIDGKNDRRLDDCL+YC+VAGK+ALE+A+LG + +  +DK R G+LVG+GM
Sbjct  125  QIRDFSSKGYIDGKNDRRLDDCLKYCLVAGKRALEDANLGNEVLNNMDKTRIGVLVGSGM  184

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G LT  SD V   IEKG+RKI+PFF+P+ I NMGSALLAI+ G MG
Sbjct  185  GSLTTISDAVSGYIEKGHRKISPFFVPHTIPNMGSALLAIETGLMG  230



>ref|XP_004245499.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=485

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKRE DPKKRVVITGMGLVSVFG+D+D +Y+KLL G+SGIS ID FDAS +P RF 
Sbjct  61   AVSAPKRETDPKKRVVITGMGLVSVFGSDIDNFYNKLLEGQSGISLIDSFDASSYPVRFA  120

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDRRLD+C RYC+VAGK+AL++A+LG   +  +DK R G+LVG+G
Sbjct  121  GQIRDFSSEGYIDGKNDRRLDNCWRYCLVAGKRALDDANLGQQVLETMDKTRIGVLVGSG  180

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGGL VFSDGV+AL+++GY+K++PFFIPY+ITNMGSALLAI+ G MG
Sbjct  181  MGGLNVFSDGVEALLQRGYKKVSPFFIPYSITNMGSALLAIETGLMG  227



>ref|XP_008783167.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Phoenix dactylifera]
Length=493

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            AAP REKDPKKR+V+TGMGLVSVFG+D D +Y KLL G+SGIS IDRFDAS +  RFGGQ
Sbjct  71   AAPTREKDPKKRIVVTGMGLVSVFGSDADTFYSKLLEGQSGISLIDRFDASSYSVRFGGQ  130

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAGK+AL++A+LG + +  +D+ R G+LVG+GMG
Sbjct  131  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALDDANLGPEVLQSMDRSRIGVLVGSGMG  190

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS GV+ALI+KGY KITPFFIPY+ITNMGSALLAID G MG
Sbjct  191  GLTAFSKGVEALIQKGYNKITPFFIPYSITNMGSALLAIDTGLMG  235



>ref|XP_009590113.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=481

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKR+VI+GMGLVSVFG+D+D +Y+KLL G+SGI+ IDRFDAS +  RF GQ
Sbjct  59   SAPKREKDPKKRIVISGMGLVSVFGSDIDNFYNKLLEGQSGITLIDRFDASNYSVRFAGQ  118

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F + GYIDGKNDRRLDDC RYC+VAGKKAL +A+LG + +  +DK R G+LVGTGMG
Sbjct  119  IRDFSSVGYIDGKNDRRLDDCWRYCLVAGKKALNDANLGQEVLETMDKTRIGVLVGTGMG  178

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS GV++L++KGY+KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  179  GLTAFSSGVESLVQKGYKKISPFFIPYSITNMGSALLAIDTGLMG  223



>emb|CDP12182.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKRE DPKKR+VITGMGLVSVFG+D D +Y KLL GESGIS IDRFDAS +  RF GQ
Sbjct  68   SAPKRETDPKKRIVITGMGLVSVFGSDNDTFYSKLLEGESGISLIDRFDASNYSVRFAGQ  127

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAG++AL++A LG + +  +D+ R G+LVG+GMG
Sbjct  128  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALDDASLGQEVLETMDRSRIGVLVGSGMG  187

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS+GV+ALI+KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  188  GLTAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  232



>gb|EAZ30871.1| hypothetical protein OsJ_14945 [Oryza sativa Japonica Group]
Length=408

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFGN+VDA+Y++LLAGESG+ AIDRFDA  FPTRF GQIRGF +EGYIDGKNDRR
Sbjct  1    MGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFSSEGYIDGKNDRR  60

Query  433  LDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEK  606
            LDDCLRYCIV+GKKALENA L  G+DG  K+DK RAG+LVGTGMGGLTVFSDGVQ LIEK
Sbjct  61   LDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLTVFSDGVQNLIEK  120

Query  607  GYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GY+KI+PFFIPYAITNMGSALLA+D GFMG
Sbjct  121  GYKKISPFFIPYAITNMGSALLAMDAGFMG  150



>ref|XP_008239156.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Prunus mume]
Length=494

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKR VITGMGLVSVFG+D+D +Y+KLL GESGI+ IDRFDAS F  RF GQ
Sbjct  72   SAPKREKDPKKRTVITGMGLVSVFGSDIDTFYNKLLEGESGITLIDRFDASNFSVRFAGQ  131

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RY IVAGKKALE+A+LG   +  +D+ R G++VGTGMG
Sbjct  132  IRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPQVLETMDRTRIGVIVGTGMG  191

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS GV++LI+KGY+KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  192  GLTAFSAGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMG  236



>gb|EYU23310.1| hypothetical protein MIMGU_mgv1a005480mg [Erythranthe guttata]
Length=482

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            ++PKRE DPKKR+VITGMGLVSVFGND+D +Y+KLL G SGI+ IDRFDAS++  RFGGQ
Sbjct  60   SSPKRETDPKKRIVITGMGLVSVFGNDIDTFYNKLLDGVSGITPIDRFDASEYSVRFGGQ  119

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAG++AL++A LG + +  +DK R G+LVG+GMG
Sbjct  120  IRDFTSKGYIDGKNDRRLDDCWRYCLVAGRRALDDASLGKEVLDTMDKTRIGVLVGSGMG  179

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T FS+GV+ALI+KGY+K++PFFIPY+ITNMGSALLAID G MG
Sbjct  180  GITSFSNGVEALIQKGYKKMSPFFIPYSITNMGSALLAIDTGLMG  224



>gb|AAC78479.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Capsicum chinense]
Length=488

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKRE DPKKR+VITGMGLVSVFG+D+D +Y+KLL G+SGIS IDRFDAS +  RF 
Sbjct  64   AVSAPKRETDPKKRIVITGMGLVSVFGSDIDNFYNKLLEGQSGISLIDRFDASSYTVRFA  123

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDRRLDDC RYC+VAGK+ALE+A+LG   +  +DK R G+LVG+ 
Sbjct  124  GQIRDFSSEGYIDGKNDRRLDDCWRYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSS  183

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGG  VF+D V+AL+++GY+KI PFFIPY+ITNMGSALLAID G MG
Sbjct  184  MGGSKVFADAVEALVQRGYKKINPFFIPYSITNMGSALLAIDTGLMG  230



>ref|XP_006343829.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=485

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKRE DPKKRVVITGMGLVSVFG+D+D +Y+KLL G+SGIS ID FDAS +  RF 
Sbjct  61   AVSAPKRETDPKKRVVITGMGLVSVFGSDIDNFYNKLLEGQSGISLIDSFDASNYSVRFA  120

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDRRLD+C RYC+VAGK+AL++A+LG   +  +DK R G+LVG+G
Sbjct  121  GQIRDFSSEGYIDGKNDRRLDNCWRYCLVAGKRALDDANLGRQVLETMDKTRIGVLVGSG  180

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGGL VFSDGV+ L+++GY+KI+PFFIPY+ITNMGSALLAI+ G MG
Sbjct  181  MGGLKVFSDGVETLLQRGYKKISPFFIPYSITNMGSALLAIETGLMG  227



>ref|XP_010917434.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=477

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  DPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAE  402
            DP+KRVVITGMGLVSVFGNDVD YY KLL GESGI  IDRFDASK PTRF GQIRGF +E
Sbjct  60   DPRKRVVITGMGLVSVFGNDVDVYYQKLLEGESGIGPIDRFDASKLPTRFAGQIRGFSSE  119

Query  403  GYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGGLTVF  576
            GYIDGKN RRLDDCLRYC+V+GK+ALE+A L  G+  +GK+DK RAG+LVGTGMGG+TV 
Sbjct  120  GYIDGKNGRRLDDCLRYCLVSGKRALESAGLGVGSKALGKVDKARAGVLVGTGMGGVTVL  179

Query  577  SDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             DG+ +L E  Y+K+TPF IPYAITNMGSALLA+D+GFMG
Sbjct  180  CDGIWSLTESNYKKVTPFSIPYAITNMGSALLAMDIGFMG  219



>ref|XP_008352312.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Malus domestica]
Length=453

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S  +APKRE DPKKR VITGMGLVSVFG+D+D +Y++LL GESGI+ IDRFDAS F  RF
Sbjct  28   STVSAPKRETDPKKRTVITGMGLVSVFGSDIDTFYNRLLEGESGITLIDRFDASTFSVRF  87

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGT  552
             GQIR F ++GYIDGKNDRRLDDC RY IVAGKKALE+A+LG + +  +D+ R G++VGT
Sbjct  88   AGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLPTMDRTRIGVIVGT  147

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGGLT FS GV++LI+KG++KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  148  GMGGLTAFSAGVESLIQKGFKKISPFFIPYSITNMGSALLAIDTGLMG  195



>ref|XP_009358636.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Pyrus x bretschneideri]
Length=493

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S  +APKRE DPKKR VITGMGLVSVFG+D+D +Y++LL GESGI+ IDRFDAS F  RF
Sbjct  68   STVSAPKRETDPKKRTVITGMGLVSVFGSDIDTFYNRLLEGESGITLIDRFDASTFSVRF  127

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGT  552
             GQIR F ++GYIDGKNDRRLDDC RY IVAGKKALE+A+LG + +  +D+ R G++VGT
Sbjct  128  AGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLPTMDRTRIGVIVGT  187

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGGLT FS GV++LI+KG++KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  188  GMGGLTAFSAGVESLIQKGFKKISPFFIPYSITNMGSALLAIDTGLMG  235



>ref|XP_008341776.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=493

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S  +APKRE D KKR VITGMGLVSVFG+D+D +Y+KLL GESGI+ IDRFDAS F  RF
Sbjct  68   STVSAPKRETDSKKRTVITGMGLVSVFGSDIDTFYNKLLEGESGITLIDRFDASTFSVRF  127

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGT  552
             GQIR F ++GYIDGKNDRRLDDC RY IVAGKKALE+A+LG + +  +D+ R G++VGT
Sbjct  128  AGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLQTMDRTRIGVIVGT  187

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGGLT FS GV++LI+KGY+KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  188  GMGGLTAFSAGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMG  235



>ref|XP_007209938.1| hypothetical protein PRUPE_ppa004714mg [Prunus persica]
 gb|EMJ11137.1| hypothetical protein PRUPE_ppa004714mg [Prunus persica]
Length=494

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKR VITGMGLVSVFG+++D +Y+KLL GESGI+ IDRFDAS F  +F GQ
Sbjct  72   SAPKREKDPKKRTVITGMGLVSVFGSEIDTFYNKLLEGESGITLIDRFDASNFSVQFAGQ  131

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RY IVAGKKALE+A+LG   +  +D+ R G++VGTGMG
Sbjct  132  IRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPQVLETMDRTRIGVIVGTGMG  191

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS GV++LI+KGY+KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  192  GLTAFSAGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMG  236



>ref|XP_008352311.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Malus domestica]
Length=493

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S  +APKRE DPKKR VITGMGLVSVFG+D+D +Y++LL GESGI+ IDRFDAS F  RF
Sbjct  68   STVSAPKRETDPKKRTVITGMGLVSVFGSDIDTFYNRLLEGESGITLIDRFDASTFSVRF  127

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGT  552
             GQIR F ++GYIDGKNDRRLDDC RY IVAGKKALE+A+LG + +  +D+ R G++VGT
Sbjct  128  AGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLPTMDRTRIGVIVGT  187

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGGLT FS GV++LI+KG++KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  188  GMGGLTAFSAGVESLIQKGFKKISPFFIPYSITNMGSALLAIDTGLMG  235



>ref|XP_009341875.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Pyrus x bretschneideri]
Length=493

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKRE DPKKR VITGMGLVSVFG+D+D +Y+KLL GESGI+ IDRFDAS F  RF GQ
Sbjct  71   SAPKRETDPKKRTVITGMGLVSVFGSDIDTFYNKLLEGESGITLIDRFDASTFSVRFAGQ  130

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            I  F ++GYIDGKNDRRLDDC RY IVAGKKALE+A+LG + +  +D+ R G++VGTGMG
Sbjct  131  IHAFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLQTMDRTRIGVIVGTGMG  190

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS GV++LI+KGY+KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  191  GLTAFSAGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMG  235



>ref|XP_002969875.1| hypothetical protein SELMODRAFT_171238 [Selaginella moellendorffii]
 ref|XP_002985208.1| hypothetical protein SELMODRAFT_446227 [Selaginella moellendorffii]
 gb|EFJ13702.1| hypothetical protein SELMODRAFT_446227 [Selaginella moellendorffii]
 gb|EFJ28999.1| hypothetical protein SELMODRAFT_171238 [Selaginella moellendorffii]
Length=439

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 3/162 (2%)
 Frame = +1

Query  211  KREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRG  390
            +RE+DPKKRVVITGMGLVSVFGNDVD++YDKLL GESGI+ IDRFDASKFPTRFGGQIR 
Sbjct  22   ERERDPKKRVVITGMGLVSVFGNDVDSFYDKLLQGESGITLIDRFDASKFPTRFGGQIRN  81

Query  391  FKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLT  570
            F ++GYIDGKNDRRLDDCLRYC+V+GKKALENA+L      KIDKER G++VG+GMGGL+
Sbjct  82   FSSQGYIDGKNDRRLDDCLRYCLVSGKKALENAELDT---SKIDKERVGVVVGSGMGGLS  138

Query  571  VFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            VFSD VQAL +KG+R+ITPFFIPY ITNMGSAL+AI+LGFMG
Sbjct  139  VFSDAVQALGDKGHRRITPFFIPYTITNMGSALIAIELGFMG  180



>ref|XP_003074998.1| beta-ketoacyl-ACP synthase (ISS) [Ostreococcus tauri]
Length=453

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            AT A  RE DPKKRVVITGMGL SVFGN+ D YYDKLL+G+SG++ IDRFD + FPT+F 
Sbjct  28   ATVAMARETDPKKRVVITGMGLCSVFGNNYDTYYDKLLSGQSGVAPIDRFDTTDFPTKFA  87

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
             QIR F +EGYID KNDRRLDDCLRY +V+G KALE+A L A  I  IDK+R G+LVG+G
Sbjct  88   AQIRAFDSEGYIDKKNDRRLDDCLRYALVSGNKALEDAGLDAAAIENIDKQRIGVLVGSG  147

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGGLTVF DGV+AL+EKG +KITPFFIPYAITNMG A+LAI+ GFMG
Sbjct  148  MGGLTVFQDGVKALVEKGPKKITPFFIPYAITNMGGAMLAIEKGFMG  194



>emb|CEG00998.1| Beta-ketoacyl synthase, active site [Ostreococcus tauri]
Length=454

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            AT A  RE DPKKRVVITGMGL SVFGN+ D YYDKLL+G+SG++ IDRFD + FPT+F 
Sbjct  29   ATVAMARETDPKKRVVITGMGLCSVFGNNYDTYYDKLLSGQSGVAPIDRFDTTDFPTKFA  88

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
             QIR F +EGYID KNDRRLDDCLRY +V+G KALE+A L A  I  IDK+R G+LVG+G
Sbjct  89   AQIRAFDSEGYIDKKNDRRLDDCLRYALVSGNKALEDAGLDAAAIENIDKQRIGVLVGSG  148

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGGLTVF DGV+AL+EKG +KITPFFIPYAITNMG A+LAI+ GFMG
Sbjct  149  MGGLTVFQDGVKALVEKGPKKITPFFIPYAITNMGGAMLAIEKGFMG  195



>ref|XP_004301818.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=489

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  118  PLRKTTSH-FPSGvavrplprrlrvvSATAAPKREKDPKKRVVITGMGLVSVFGNDVDAY  294
            PL  T SH   S  A +    +     A +APKRE DPKKR VITG GLVSVFG+D+D +
Sbjct  37   PLAPTKSHGLVSTSAPKCRTIKAMASPALSAPKRETDPKKRTVITGQGLVSVFGSDIDTF  96

Query  295  YDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKK  474
            Y++LL GESGI+ IDRFDAS F  RF GQIR F ++GYIDGKNDRRLDDC RY IVAGK+
Sbjct  97   YNRLLEGESGITLIDRFDASSFSVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKR  156

Query  475  ALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITN  654
            ALE+A+LG + +  +DK R G++VGTGMGGLT FS GV++L++KG++KI+PFFIPY+ITN
Sbjct  157  ALEDANLGPEALKSMDKTRIGVIVGTGMGGLTAFSAGVESLVQKGFKKISPFFIPYSITN  216

Query  655  MGSALLAIDLGFMG  696
            MGSALLAID G MG
Sbjct  217  MGSALLAIDTGLMG  230



>ref|XP_010109776.1| hypothetical protein L484_003136 [Morus notabilis]
 gb|EXC24694.1| hypothetical protein L484_003136 [Morus notabilis]
Length=511

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            ++PKREKDPKKRVVITGMGLVSVFGND+D +Y+KLL GESGIS IDRFD S +  RF GQ
Sbjct  73   SSPKREKDPKKRVVITGMGLVSVFGNDIDTFYNKLLEGESGISPIDRFDVSNYSVRFAGQ  132

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RY +V GK+ALE+A+LG + +  +DK R G+LVGTGMG
Sbjct  133  IRDFSSKGYIDGKNDRRLDDCWRYGLVGGKRALEDANLGHEVLDTMDKSRIGVLVGTGMG  192

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT F+ GV+ LI KGY+KI+PFFIPY+ITNMGSALLAID G MG
Sbjct  193  GLTAFTTGVENLILKGYKKISPFFIPYSITNMGSALLAIDTGLMG  237



>ref|XP_009803233.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana sylvestris]
Length=485

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKR+V+TGMGLVSVFG+D+D +Y+ LL G+SGI+ IDRFDAS +  RF GQ
Sbjct  63   SAPKREKDPKKRIVVTGMGLVSVFGSDIDNFYNSLLEGQSGITLIDRFDASNYSVRFAGQ  122

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F +  YIDGKNDRRLDDC RYC+VAGKKAL++A+LG + +  +DK R G+LVGTGMG
Sbjct  123  IRDFSSVDYIDGKNDRRLDDCWRYCLVAGKKALDDANLGQEVLEAMDKTRIGVLVGTGMG  182

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT FS GV++L++KGY+KI+PFFIPY+ITNMGSALLAI  G MG
Sbjct  183  GLTAFSSGVESLVQKGYKKISPFFIPYSITNMGSALLAIGTGLMG  227



>gb|AIQ82742.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKR  DPKKR+VITGMGLVSVFG+D+D +Y+KLL G+SGI+ IDRFDAS +  RF 
Sbjct  64   AVSAPKRATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFA  123

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDRRLDDC +YC+VAGK+ALE+A+LG   +  +DK R G+LVG+G
Sbjct  124  GQIRDFSSEGYIDGKNDRRLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSG  183

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGG  VF+D V+AL+++GY+KI+PFF+PY ITNMGSALLAI+ G MG
Sbjct  184  MGGSKVFTDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMG  230



>gb|AIQ82734.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82735.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82736.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82737.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82738.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82739.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82740.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82741.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82749.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKR  DPKKR+VITGMGLVSVFG+D+D +Y+KLL G+SGI+ IDRFDAS +  RF 
Sbjct  64   AVSAPKRATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFA  123

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDRRLDDC +YC+VAGK+ALE+A+LG   +  +DK R G+LVG+G
Sbjct  124  GQIRDFSSEGYIDGKNDRRLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSG  183

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGG  VF+D V+AL+++GY+KI+PFF+PY ITNMGSALLAI+ G MG
Sbjct  184  MGGSKVFTDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMG  230



>gb|AIQ82743.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82744.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKR  DPKKR+VITGMGLVSVFG+D+D +Y+KLL G+SGI+ IDRFDAS +  RF 
Sbjct  64   AVSAPKRATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFA  123

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDRRLDDC +YC+VAGK+ALE+A+LG   +  +DK R G+LVG+G
Sbjct  124  GQIRDFSSEGYIDGKNDRRLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSG  183

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGG  VF+D V+AL+++GY+KI+PFF+PY ITNMGSALLAI+ G MG
Sbjct  184  MGGSKVFTDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMG  230



>ref|XP_001416469.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94762.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=422

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  REKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGF  393
            RE DPKKRVVITGMGL SVFGND  AYYDKLL+G+SG++ IDRFD S FPT+F  QIR F
Sbjct  3    RETDPKKRVVITGMGLCSVFGNDYTAYYDKLLSGQSGVAPIDRFDTSDFPTKFAAQIRNF  62

Query  394  KAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTV  573
             +EGYID KNDRRLDDCLRY +V+G KALE+A L A  +  +DK+R G+LVG+GMGGLTV
Sbjct  63   DSEGYIDKKNDRRLDDCLRYALVSGNKALEDAGLDAAALENLDKQRVGVLVGSGMGGLTV  122

Query  574  FSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            F DGV+AL+EKG +KITPFFIPYAITNMG A+LAI+ GFMG
Sbjct  123  FQDGVKALVEKGPKKITPFFIPYAITNMGGAMLAIEKGFMG  163



>gb|AIQ82746.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKR  DPKKR+VITGMGLVSVFG+D+D +Y+KLL G+SGI+ IDRFDAS +  RF 
Sbjct  64   AVSAPKRATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFA  123

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDRRLDDC +YC+VAGK+ALE+A+LG   +  +DK R G+LVG+G
Sbjct  124  GQIRDFSSEGYIDGKNDRRLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSG  183

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGG  VF+D V+AL+++GY+KI+PFF+PY ITNMGS LLAI+ G MG
Sbjct  184  MGGSKVFTDAVEALVQRGYKKISPFFVPYTITNMGSTLLAINTGLMG  230



>gb|AIQ82747.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKR  DPKKR+VITGMGLVSVFG+D+D +Y+KLL G+SGI+ IDRFDAS +  RF 
Sbjct  64   AVSAPKRATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFA  123

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDR LDDC +YC+VAGK+ALE+A+LG   +  +DK R G+LVG+G
Sbjct  124  GQIRDFSSEGYIDGKNDRHLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSG  183

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGG  VF+D V+AL+++GY+KI+PFF+PY ITNMGSALLAI+ G MG
Sbjct  184  MGGSKVFTDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMG  230



>gb|AIQ82745.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82748.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82750.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82751.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82752.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82753.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKR  DPKKR+VITGMGLVSVFG+D+D +Y+KLL G+SGI+ IDRFDAS +  RF 
Sbjct  64   AVSAPKRATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFA  123

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDR LDDC +YC+VAGK+ALE+A+LG   +  +DK R G+LVG+G
Sbjct  124  GQIRDFSSEGYIDGKNDRHLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSG  183

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGG  VF+D V+AL+++GY+KI+PFF+PY ITNMGSALLAI+ G MG
Sbjct  184  MGGSKVFTDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMG  230



>gb|EYU26415.1| hypothetical protein MIMGU_mgv1a006855mg [Erythranthe guttata]
Length=429

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  TAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGG  378
             +APKRE DPKKRVVITGMGLVSVFG+DVDAYY++LL G SGI+ IDRFD S +  RF G
Sbjct  6    VSAPKRETDPKKRVVITGMGLVSVFGSDVDAYYNQLLDGVSGITPIDRFDVSDYSVRFAG  65

Query  379  QIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGM  558
            QIR F +EGYIDGK+DRRLDDC RYC+VAG KAL++A LG   +  +DK R G+LVG+ M
Sbjct  66   QIRNFSSEGYIDGKSDRRLDDCWRYCLVAGLKALDDASLGKRVLDNMDKTRMGVLVGSAM  125

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GG+T FS G++AL+ KG++K++PFFIPY+ITNMGSALLAI+ GFMG
Sbjct  126  GGVTAFSGGIEALVRKGHKKVSPFFIPYSITNMGSALLAIETGFMG  171



>ref|XP_011082304.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=493

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKRE DPKKR+VITGMGLVSVFG+DVD +Y+KLL G SGI+ IDRFDAS++  RF GQ
Sbjct  71   SAPKRETDPKKRIVITGMGLVSVFGSDVDTFYNKLLDGVSGITPIDRFDASEYSVRFSGQ  130

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGK+DRRLDD  RYC+V+GK+AL++A L  D + K+DK R G+LVG+GMG
Sbjct  131  IRDFTSKGYIDGKSDRRLDDVWRYCLVSGKRALDDASLSKDVLEKMDKTRIGVLVGSGMG  190

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G++ FS+GV+AL+ KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  191  GISAFSNGVEALVLKGYKKITPFFIPYSITNMGSALLAIDTGLMG  235



>ref|XP_011082303.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=511

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKRE DPKKR+VITGMGLVSVFG+DVD +Y+KLL G SGI+ IDRFDAS++  RF GQ
Sbjct  89   SAPKRETDPKKRIVITGMGLVSVFGSDVDTFYNKLLDGVSGITPIDRFDASEYSVRFSGQ  148

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGK+DRRLDD  RYC+V+GK+AL++A L  D + K+DK R G+LVG+GMG
Sbjct  149  IRDFTSKGYIDGKSDRRLDDVWRYCLVSGKRALDDASLSKDVLEKMDKTRIGVLVGSGMG  208

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G++ FS+GV+AL+ KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  209  GISAFSNGVEALVLKGYKKITPFFIPYSITNMGSALLAIDTGLMG  253



>gb|ADZ05697.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  196  ATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFG  375
            A +APKR  DPKKR+VITGMGLVSVFG+D+D +Y+KLL G+ GI+ IDRFDAS +  RF 
Sbjct  64   AVSAPKRATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQRGITLIDRFDASSYAVRFA  123

Query  376  GQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTG  555
            GQIR F +EGYIDGKNDR LDDC +YC+VAGK+ALE+A+LG   +  +DK R G+LVG+G
Sbjct  124  GQIRDFSSEGYIDGKNDRHLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSG  183

Query  556  MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            MGG  VF+D V+AL+++GY+KI+PFF+PY ITNMGSALLAI+ G MG
Sbjct  184  MGGSKVFTDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMG  230



>ref|XP_007509323.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19780.1| predicted protein [Bathycoccus prasinos]
Length=464

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  TAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGG  378
             +A  RE DPKKR+VITGMGL SVFGND +++YDKLL G SG++ IDRFD S FPT+F  
Sbjct  40   CSAMARETDPKKRIVITGMGLCSVFGNDYNSFYDKLLEGTSGVAPIDRFDTSDFPTKFAA  99

Query  379  QIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGM  558
            QIR F  EGYID KNDRRLDDCLRY +V+G KALE+A L  + + K+DK+R G+L G+GM
Sbjct  100  QIRNFDNEGYIDKKNDRRLDDCLRYALVSGNKALEDAGLAGEALAKVDKQRVGVLCGSGM  159

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GGLTVF DGV+AL+EKG +KITPFFIPYAITNMG A+LAI+ GFMG
Sbjct  160  GGLTVFQDGVKALVEKGPKKITPFFIPYAITNMGGAMLAIEKGFMG  205



>gb|KEH21260.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=482

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKRVVITGMGLVSVFG+D+D +Y KLL GESGIS ID+FDAS FP RFGGQI
Sbjct  61   APKREKDPKKRVVITGMGLVSVFGSDIDTFYTKLLEGESGISLIDKFDASSFPVRFGGQI  120

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
            R F ++GYIDGK DR LDDC++YC+VAGK+ALE+A+LG + +  +DK R G+LVG+GMGG
Sbjct  121  RDFSSKGYIDGKTDRCLDDCMKYCLVAGKRALEDANLGYETLNNMDKTRIGVLVGSGMGG  180

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            ++ F++ V AL  KG+RKI+PFFIPY I N  SALLAI+ G MG
Sbjct  181  VSTFNNAVDALTRKGHRKISPFFIPYTIPNSSSALLAIETGLMG  224



>dbj|BAK03950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S+ +AP+RE DP+KRVVITGMG+VSVFGNDVDAYY +LLAGESG+ AIDRFDAS FPTRF
Sbjct  32   SSPSAPRRETDPRKRVVITGMGVVSVFGNDVDAYYARLLAGESGVGAIDRFDASGFPTRF  91

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILV  546
              QIRGF +EGY+DGK DRRLDDC  Y +VA KKALE+A L  G+  + K+DKERAG++V
Sbjct  92   AAQIRGFSSEGYVDGKLDRRLDDCHHYALVASKKALESACLAAGSSVMEKVDKERAGVIV  151

Query  547  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAID--LGFMG  696
            G+GMGG+T FSDGV+ L+ KGYRKI+PF IP+AITN  SA++A+D  +GF G
Sbjct  152  GSGMGGITAFSDGVENLVTKGYRKISPFCIPHAITNTSSAMIAMDAAVGFRG  203



>ref|XP_002964698.1| hypothetical protein SELMODRAFT_230451 [Selaginella moellendorffii]
 gb|EFJ33536.1| hypothetical protein SELMODRAFT_230451 [Selaginella moellendorffii]
Length=406

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFG+D D YYDKLL G SG++AIDRFDAS+FPT+F  QIR F A+GYIDGKNDRR
Sbjct  1    MGLVSVFGSDTDKYYDKLLEGVSGVAAIDRFDASQFPTKFAAQIRDFSAKGYIDGKNDRR  60

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LDDCLRY IV GKKALE+A LG + + K+DK+R G+LVG+GMGGL+VFSDGVQ+LIE+GY
Sbjct  61   LDDCLRYGIVGGKKALEHAGLGGENLDKVDKQRVGVLVGSGMGGLSVFSDGVQSLIERGY  120

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            RKITPFFIPY+ITNM SA+LAI+LG MG
Sbjct  121  RKITPFFIPYSITNMASAMLAIELGLMG  148



>gb|KHM99882.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=406

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +1

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS FP RFGGQIR F +EGYIDGKNDRR
Sbjct  1    MGLVSVFGSDIDGFYNKLLEGESGISLIDRFDASNFPVRFGGQIRDFSSEGYIDGKNDRR  60

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LDDC RYCIVAGK+AL++A+LG   +  +DK R G+LVG+GMGG+T FS GV+AL++KGY
Sbjct  61   LDDCWRYCIVAGKRALDDANLGQQVLDTMDKTRIGVLVGSGMGGITAFSTGVEALVQKGY  120

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            +KITPFFIPY+ITNMGSALLAID G MG
Sbjct  121  KKITPFFIPYSITNMGSALLAIDTGLMG  148



>ref|XP_006476353.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Citrus sinensis]
Length=498

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKR+VITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS F  RFGGQ
Sbjct  76   SAPKREKDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGESGISPIDRFDASSFSVRFGGQ  135

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAG++ALE A L    +  +D+ R G++VG+GMG
Sbjct  136  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALEEASLSPQVLENMDRTRIGVVVGSGMG  195

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT F+ GV+ALI+KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  196  GLTSFTTGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  240



>gb|KDO76592.1| hypothetical protein CISIN_1g010896mg [Citrus sinensis]
Length=498

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKR+VITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS F  RFGGQ
Sbjct  76   SAPKREKDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGESGISPIDRFDASSFSVRFGGQ  135

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAG++ALE A L    +  +D+ R G++VG+GMG
Sbjct  136  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALEEASLSPQVLENMDRTRIGVVVGSGMG  195

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT F+ GV+ALI+KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  196  GLTSFTTGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  240



>ref|XP_002961627.1| hypothetical protein SELMODRAFT_230041 [Selaginella moellendorffii]
 gb|EFJ36887.1| hypothetical protein SELMODRAFT_230041 [Selaginella moellendorffii]
Length=384

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +1

Query  253  MGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRR  432
            MGLVSVFG+D D YYDKLL G SG++ IDRFDAS+FPT+F  QIR F A+GYIDGKNDRR
Sbjct  1    MGLVSVFGSDTDKYYDKLLEGVSGVAPIDRFDASQFPTKFAAQIRDFSAKGYIDGKNDRR  60

Query  433  LDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGY  612
            LDDCLRY IV GKKALE+A LG + + K+DK+R G+LVG+GMGGL+VFSDGVQ+LIE+GY
Sbjct  61   LDDCLRYGIVGGKKALEHAGLGGENLDKVDKQRVGVLVGSGMGGLSVFSDGVQSLIERGY  120

Query  613  RKITPFFIPYAITNMGSALLAIDLGFMG  696
            RKITPFFIPY+ITNM SA+LAI+LG MG
Sbjct  121  RKITPFFIPYSITNMASAMLAIELGLMG  148



>gb|EAZ36138.1| hypothetical protein OsJ_20447 [Oryza sativa Japonica Group]
Length=426

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 2/146 (1%)
 Frame = +1

Query  217  EKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFK  396
            E DP+KRVVITGMGLVSVFGNDVDAYYD+LLAGESGI  IDRFDAS FPTRF GQIRGF 
Sbjct  46   ETDPRKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASNFPTRFAGQIRGFS  105

Query  397  AEGYIDGKNDRRLDDCLRYCIVAGKKALENAD--LGADGIGKIDKERAGILVGTGMGGLT  570
            +EGYIDGKNDRRLDDCLRYCIV+GKKALE+A   LG+  + KI+K RAG+LVGTGMGGLT
Sbjct  106  SEGYIDGKNDRRLDDCLRYCIVSGKKALESAGLALGSKSMDKIEKTRAGVLVGTGMGGLT  165

Query  571  VFSDGVQALIEKGYRKITPFFIPYAI  648
            VFSDGVQ LIEKG+RKITP   P  I
Sbjct  166  VFSDGVQNLIEKGHRKITPSSFPNHI  191



>ref|XP_006439308.1| hypothetical protein CICLE_v10019855mg [Citrus clementina]
 gb|ESR52548.1| hypothetical protein CICLE_v10019855mg [Citrus clementina]
Length=494

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKRE DPKKR+VITGMGLVSVFG+D+D +Y+KLL GESGIS IDRFDAS F  RFGGQ
Sbjct  72   SAPKREIDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGESGISPIDRFDASSFSVRFGGQ  131

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            IR F ++GYIDGKNDRRLDDC RYC+VAG++ALE A L    +  +D+ R G++VG+GMG
Sbjct  132  IRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALEEASLSPQVLENMDRTRIGVVVGSGMG  191

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GLT F+ GV+ALI+KGY+KITPFFIPY+ITNMGSALLAID G MG
Sbjct  192  GLTSFTTGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMG  236



>ref|XP_003060067.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56019.1| predicted protein [Micromonas pusilla CCMP1545]
Length=467

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +1

Query  214  REKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGF  393
            RE DPKKR+V+TGMGL SVFGND D +YDKLLAGESG+  IDRFD   FPT+F  QI+ F
Sbjct  47   RETDPKKRIVVTGMGLCSVFGNDYDKFYDKLLAGESGVDMIDRFDTEDFPTKFAAQIKDF  106

Query  394  KAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTV  573
              EG+ID KN RR+D+CL+Y +V+G KAL +A L  D I K+DK R G+L G+GMGGLTV
Sbjct  107  DNEGFIDKKNARRMDNCLQYALVSGNKALLDAGLDDDAIEKLDKTRVGVLAGSGMGGLTV  166

Query  574  FSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            F DGV+AL+EKG +KITPFFIPYAITNMG ALLAI+ GFMG
Sbjct  167  FQDGVKALVEKGPKKITPFFIPYAITNMGGALLAIEKGFMG  207



>ref|XP_004503596.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cicer arietinum]
Length=468

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            APKREKDPKKR+VITGMG+VSVFGN++D +Y+KLL GESGI+ IDRFD S FP RF GQI
Sbjct  47   APKREKDPKKRIVITGMGVVSVFGNEIDTFYNKLLEGESGINFIDRFDVSTFPVRFAGQI  106

Query  385  RGFKAEGYIDGKNDR-RLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            R F +EGYID KN +  LDDC RY +VAGKKALE+A LG++ + K+DK R G+LVG+GMG
Sbjct  107  RNFSSEGYIDEKNGKMNLDDCWRYYLVAGKKALEDAKLGSEVLEKMDKTRIGVLVGSGMG  166

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G +  S  V+ALIEKG++KIT +FIP+ + NMGSALLA++ G MG
Sbjct  167  GTSSMSKAVEALIEKGHKKITEYFIPFFLPNMGSALLAMERGLMG  211



>ref|XP_005843858.1| hypothetical protein CHLNCDRAFT_27559 [Chlorella variabilis]
 gb|EFN51756.1| hypothetical protein CHLNCDRAFT_27559 [Chlorella variabilis]
Length=464

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 132/169 (78%), Gaps = 4/169 (2%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +A KRE DPKKR+VITGMG+ S FGNDVD +Y++LL G SG+  I RFDAS+FPT+F  Q
Sbjct  38   SAAKRETDPKKRIVITGMGIASCFGNDVDTFYNQLLEGVSGVDYISRFDASEFPTKFAAQ  97

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GA--DGIGKIDKERAGILVG  549
            I+ F     +D KN RR DDCL Y +VA KKAL+ A L  GA  DG G +DK R G+LVG
Sbjct  98   IKDFDVGNLVDKKNARRYDDCLSYTMVASKKALQAAGLEKGANPDGYGALDKSRVGVLVG  157

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +GMGGL+VF DGV+AL+EKGY+KITPFFIPYAITNMG ALLAID GFMG
Sbjct  158  SGMGGLSVFQDGVKALVEKGYKKITPFFIPYAITNMGGALLAIDQGFMG  206



>ref|XP_002504288.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65546.1| predicted protein [Micromonas sp. RCC299]
Length=514

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            A  RE DPKKRVVITGMGLVS FGND D +YDKLLAG SG+  IDRFD + FPT+F  QI
Sbjct  91   AMARETDPKKRVVITGMGLVSCFGNDYDKFYDKLLAGTSGVKMIDRFDTADFPTKFAAQI  150

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
              F  EG +D KN RR+DDCL+Y +V+G KAL +A L  D I  +DK + G+L G+GMGG
Sbjct  151  TDFDNEGIVDKKNARRMDDCLQYALVSGNKALMDAGLTDDVIEGMDKTKIGVLAGSGMGG  210

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LTVF DGV+AL+EKG +KITPFFIPYAITNMG ALLAI+ GFMG
Sbjct  211  LTVFQDGVKALVEKGPKKITPFFIPYAITNMGGALLAIEKGFMG  254



>gb|AEF13159.1| beta-ketoacyl acyl carrier protein synthase [Haematococcus pluvialis]
Length=462

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 127/169 (75%), Gaps = 4/169 (2%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            A+  +++DP +RVV+TG+GL SVFGND D +Y KLLAG SG++ IDRFDA  FPTRFG Q
Sbjct  35   ASALKQRDPSQRVVVTGIGLCSVFGNDPDEFYSKLLAGTSGVTTIDRFDAKDFPTRFGAQ  94

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL----GADGIGKIDKERAGILVG  549
            IR F  E  ID KN RR DDCL+Y +V+ KKAL  A L     A G G++D  R  +LVG
Sbjct  95   IRNFDDEKLIDAKNSRRYDDCLKYTVVSSKKALRMAGLEKEANAQGYGQLDLTRVRVLVG  154

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            TGMGGL+VF DGV  L+ KG+RKI+PFFIPYAITNMG ALLAID GFMG
Sbjct  155  TGMGGLSVFQDGVTNLVTKGHRKISPFFIPYAITNMGGALLAIDQGFMG  203



>gb|EYU26414.1| hypothetical protein MIMGU_mgv1a024999mg, partial [Erythranthe 
guttata]
Length=452

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  199  TAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGG  378
             +APK+E DP+KRVVITGMGLVSVFG+D+D YY+KLL G SGI+ IDRFDAS++  RF G
Sbjct  13   VSAPKKETDPRKRVVITGMGLVSVFGSDIDTYYNKLLDGVSGIAPIDRFDASEYSVRFAG  72

Query  379  QIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGM  558
            QIR F +EGYIDGKNDRRLDD  RYC+VAGK+AL++A LG   +  +DK R G+LVG+G+
Sbjct  73   QIRDFSSEGYIDGKNDRRLDDTWRYCLVAGKRALDDASLGKQVLQNMDKMRMGVLVGSGL  132

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GG T FS  ++ALI  GY+K++PFF+PY ITNMGSA+LAID GF G
Sbjct  133  GGATTFSKAMEALITSGYKKLSPFFVPYIITNMGSAVLAIDTGFRG  178



>ref|XP_001701199.1| 3-ketoacyl-CoA-synthase [Chlamydomonas reinhardtii]
 gb|EDO97709.1| 3-ketoacyl-CoA-synthase [Chlamydomonas reinhardtii]
Length=553

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +1

Query  217  EKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFK  396
            ++DPK+R+VITG+G+ SV GND D +Y KLL GESG+  IDRFDAS+FPTRF  QIR F 
Sbjct  32   KRDPKQRIVITGIGICSVHGNDPDTFYQKLLNGESGVGLIDRFDASEFPTRFAAQIRNFD  91

Query  397  AEGYIDGKNDRRLDDCLRYCIVAGKKALENADL----GADGIGKIDKERAGILVGTGMGG  564
             E  ID KN RR DDCL+Y +V+GKKAL  A L     ++G  K+D  R G+LVGTGMGG
Sbjct  92   DENLIDKKNARRYDDCLKYTMVSGKKALIMAGLEKERCSEGYKKVDPTRVGVLVGTGMGG  151

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            LTVF DGV  L++KGY+KI+PFFIPYAITNMG ALLAID GFMG
Sbjct  152  LTVFQDGVSNLVQKGYKKISPFFIPYAITNMGGALLAIDQGFMG  195



>ref|XP_002956811.1| hypothetical protein VOLCADRAFT_83790 [Volvox carteri f. nagariensis]
 gb|EFJ42114.1| hypothetical protein VOLCADRAFT_83790 [Volvox carteri f. nagariensis]
Length=461

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 126/163 (77%), Gaps = 4/163 (2%)
 Frame = +1

Query  220  KDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKA  399
            +DPK+R+VITG+G+ SV GND D +Y KLL G SG+ AIDRFDAS+FPTRF  QI+ F  
Sbjct  34   RDPKQRIVITGIGICSVHGNDPDTFYSKLLDGVSGVGAIDRFDASEFPTRFAAQIKNFDD  93

Query  400  EGYIDGKNDRRLDDCLRYCIVAGKKALENADL----GADGIGKIDKERAGILVGTGMGGL  567
            EG ID KN RR DDCL+Y +V+GKKAL  A L     A G  ++D  R G+LVGTGMGGL
Sbjct  94   EGMIDKKNARRYDDCLKYTMVSGKKALVMAGLEKERCAAGYQQVDPTRVGVLVGTGMGGL  153

Query  568  TVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            TVF DGV  L++KGY+KI+PFFIPYAITNMG ALLAID GFMG
Sbjct  154  TVFQDGVSNLVQKGYKKISPFFIPYAITNMGGALLAIDQGFMG  196



>ref|XP_011398280.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM25387.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Auxenochlorella 
protothecoides]
Length=446

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 129/173 (75%), Gaps = 5/173 (3%)
 Frame = +1

Query  193  SATAAPKREK-DPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTR  369
            S   A KR+  DPK RVVITG GL SVFGNDVD +YD LL G+SG+  I RFD ++FPT+
Sbjct  14   SPVLAVKRDAADPKSRVVITGQGLASVFGNDVDTFYDCLLEGKSGVDTITRFDITEFPTK  73

Query  370  FGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGA----DGIGKIDKERAG  537
            F GQI+ F  EG +D KN RR DD L Y +VA KKAL  A L      +G  K+DK R G
Sbjct  74   FAGQIKSFDVEGLVDKKNARRYDDALSYAMVASKKALRQAGLEKEACPEGYEKLDKTRVG  133

Query  538  ILVGTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +LVG+GMGGLTVF DGV+AL+EKG++KITPFFIPYAITNMGSAL+ ID GFMG
Sbjct  134  VLVGSGMGGLTVFQDGVKALVEKGHKKITPFFIPYAITNMGSALVGIDQGFMG  186



>ref|XP_005643461.1| 3-oxoacyl-synth [Coccomyxa subellipsoidea C-169]
 gb|EIE18917.1| 3-oxoacyl-synth [Coccomyxa subellipsoidea C-169]
Length=473

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  DPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAE  402
            DPK RVVITG G+ SVFGNDV+ +Y+ LL G+SG+  I RFDAS+FPT F  QI  F  E
Sbjct  53   DPKTRVVITGQGIASVFGNDVNTFYNTLLEGKSGVKPITRFDASEFPTTFAAQIENFDNE  112

Query  403  GYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMGGLTVF  576
            G ID KN RR DDC+ Y +V+ KKAL +A L  G++   K+DK RAGIL+G+GMGGLTVF
Sbjct  113  GLIDKKNARRYDDCISYSLVSAKKALADAGLEKGSEAFEKLDKTRAGILIGSGMGGLTVF  172

Query  577  SDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             DGV+ L+EKGY+KITPFFIPYAITNMG AL+ I+ GFMG
Sbjct  173  QDGVKNLVEKGYKKITPFFIPYAITNMGGALVGIETGFMG  212



>gb|EMT20383.1| 3-oxoacyl-(acyl-carrier-protein) synthase I, chloroplastic [Aegilops 
tauschii]
Length=450

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 129/159 (81%), Gaps = 2/159 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            P+RE DP+KRVVITGMGLVSVFGNDVD YY++LLAGESG+ AIDRFDAS FPTRF  QIR
Sbjct  37   PRRETDPRKRVVITGMGLVSVFGNDVDVYYERLLAGESGVGAIDRFDASGFPTRFAAQIR  96

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGTGMG  561
            GF +EGY+DGK DRRLDD  RY +VA KKALE A L  G   + K+DKERAG++VG+GMG
Sbjct  97   GFSSEGYVDGKLDRRLDDIHRYALVATKKALECASLAPGTSAMRKVDKERAGVVVGSGMG  156

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAI  678
            G+T  SDG+ +L+ KG  KI+P  IP+AITN+ SAL+ +
Sbjct  157  GITALSDGIASLVTKGCGKISPLCIPHAITNISSALVTM  195



>gb|ACL27963.1| chloroplast beta-ketoacyl-ACP synthase 1 a-1, partial [Brassica 
rapa subsp. pekinensis]
 gb|ACL27964.1| chloroplast beta-ketoacyl-ACP synthase 1 a-2, partial [Brassica 
rapa subsp. pekinensis]
Length=129

 Score =   191 bits (486),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            ++ +APKRE DPKKRVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRF
Sbjct  22   ASVSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRF  81

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGI  510
            GGQIRGF +EGYIDGKN+RRLDDCL+YCIVAGKKALE+A+LG D +
Sbjct  82   GGQIRGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKL  127



>emb|CAF23962.1| probable beta-ketoacyl-ACP synthetase [Candidatus Protochlamydia 
amoebophila UWE25]
 gb|KIC71331.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Candidatus 
Protochlamydia amoebophila]
Length=418

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = +1

Query  220  KDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKA  399
            K  KKR+VITGMG+VS FGNDVDA+Y  LLAG+SGI  I  F    +PTRF G I  F+A
Sbjct  3    KMSKKRIVITGMGIVSCFGNDVDAFYQNLLAGQSGIQPITEFPCEDYPTRFAGIIPNFEA  62

Query  400  EGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFS  579
              Y+D K  RR+D  + Y +VAGKK+LE+A+L  + + ++ KER GIL+G+GMGG+T+F+
Sbjct  63   GEYLDKKQARRVDKSIAYTMVAGKKSLESANLNEENLKRLQKERCGILIGSGMGGMTMFA  122

Query  580  DGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            DGVQ L+EKG RK++PFF+P+ +TNM  ALL ID+GFMG
Sbjct  123  DGVQTLVEKGPRKVSPFFVPFILTNMCGALLGIDIGFMG  161



>ref|WP_039359465.1| 3-oxoacyl-ACP synthase [Candidatus Protochlamydia amoebophila]
Length=415

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKR+VITGMG+VS FGNDVDA+Y  LLAG+SGI  I  F    +PTRF G I  F+A  Y
Sbjct  3    KKRIVITGMGIVSCFGNDVDAFYQNLLAGQSGIQPITEFPCEDYPTRFAGIIPNFEAGEY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            +D K  RR+D  + Y +VAGKK+LE+A+L  + + ++ KER GIL+G+GMGG+T+F+DGV
Sbjct  63   LDKKQARRVDKSIAYTMVAGKKSLESANLNEENLKRLQKERCGILIGSGMGGMTMFADGV  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            Q L+EKG RK++PFF+P+ +TNM  ALL ID+GFMG
Sbjct  123  QTLVEKGPRKVSPFFVPFILTNMCGALLGIDIGFMG  158



>ref|XP_004987019.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=454

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = +1

Query  205  APKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            AP+RE DPKKRVVITGMG+VSVFGND  A+YD+LLAGESG   IDRFD + F TRF  QI
Sbjct  27   APRRESDPKKRVVITGMGVVSVFGNDAGAFYDRLLAGESGAGHIDRFDPTGFTTRFAAQI  86

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENA--DLGADGIGKIDKERAGILVGTGM  558
            RGF +EG+ID K+DRRLDDC RY +VA +KALE+A   LG+  +GKID ERAG++VG+G+
Sbjct  87   RGFSSEGHIDSKSDRRLDDCQRYALVAARKALESAGLALGSRAMGKIDLERAGVVVGSGI  146

Query  559  GGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAID--LGFMG  696
            GG+  FS GV++L+ KG  KI+PF +P AI NM SAL+AID  +GF+G
Sbjct  147  GGVKEFSAGVESLVTKGPSKISPFSVPLAIPNMASALVAIDAGIGFLG  194



>ref|XP_004959862.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=463

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 135/172 (78%), Gaps = 4/172 (2%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S   AP+RE DPKKRVVITGMG+VSVFGND  A+YD+LLAGESG   IDRFD + F TRF
Sbjct  32   SMARAPRRESDPKKRVVITGMGVVSVFGNDAGAFYDRLLAGESGAGHIDRFDPTGFTTRF  91

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENA--DLGADGIGKIDKERAGILV  546
              QIRGF +EG+ID K+DRRLDDC RY +VA +KALE+A   LG+  +GKID ERAG++V
Sbjct  92   AAQIRGFSSEGHIDSKSDRRLDDCQRYALVAARKALESAGLALGSRAMGKIDLERAGVVV  151

Query  547  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAID--LGFMG  696
            G+G+GG+  FS GV++L+ KG  KI+PF +P AI NM SAL+AID  +GF+G
Sbjct  152  GSGIGGVKEFSAGVESLVTKGPSKISPFSVPLAIPNMASALVAIDAGIGFLG  203



>ref|WP_042282680.1| 3-oxoacyl-ACP synthase [Candidatus Protochlamydia sp. R18]
Length=415

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKR+VITGMG+VS FGNDVDA+Y  LLAG+SGI  I  F    +PTRF G I  F+A  Y
Sbjct  3    KKRIVITGMGIVSCFGNDVDAFYQNLLAGQSGIQPITEFPCEDYPTRFAGIIPNFEAGEY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            +D K  RR+D  + Y +VAGKK+LE+A+L  + +  + KER GIL+G+GMGG+T+F+DGV
Sbjct  63   LDKKQARRVDKSIAYTMVAGKKSLESANLNEENLKCLQKERCGILIGSGMGGMTMFADGV  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            Q L+EKG RK++PFF+P+ +TNM  ALL ID+GFMG
Sbjct  123  QTLVEKGPRKVSPFFVPFILTNMCGALLGIDIGFMG  158



>gb|ACL27959.1| chloroplast beta-ketoacyl-ACP synthase 1 c-1, partial [Brassica 
oleracea var. alboglabra]
 gb|ACL27961.1| chloroplast beta-ketoacyl-ACP synthase 1 d-2, partial [Brassica 
oleracea var. botrytis]
Length=128

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            PKRE DPKKRVVITGMGLVSVFGNDVDAYY+KLL+GESGIS IDRFDASKFPTRFGGQIR
Sbjct  26   PKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIR  85

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGI  510
            GF +EGYIDGKN+RRLDDCL+YCIVAGKKALE+A+LG D +
Sbjct  86   GFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKL  126



>gb|EKE08116.1| 3-oxoacyl-(acyl carrier protein) synthase II, partial [uncultured 
bacterium]
Length=182

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 119/156 (76%), Gaps = 3/156 (2%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            K+RVV+TGMG+VS FGNDVD +Y++LLAG+SGI  I+ F   + PTRF G IRGF    Y
Sbjct  4    KRRVVVTGMGVVSCFGNDVDLFYEQLLAGKSGIVPIEEFPCEELPTRFAGVIRGFDVGDY  63

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            +D K  RR+D  +RY +V GKKALE+A L    +G++DK R+GI++G+GMGG+ VF DGV
Sbjct  64   MDKKQARRVDPFIRYVMVGGKKALEHAQL---DLGRLDKRRSGIVIGSGMGGMNVFYDGV  120

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + ++ K ++++TPFF+PY ITNMG ALLAID GF G
Sbjct  121  ETILTKSFKRLTPFFVPYIITNMGGALLAIDTGFKG  156



>gb|ACL27957.1| chloroplast beta-ketoacyl-ACP synthase 1 b-1 [Brassica oleracea 
var. alboglabra]
 gb|ACL27958.1| chloroplast beta-ketoacyl-ACP synthase 1 b-2, partial [Brassica 
oleracea var. italica]
Length=108

 Score =   182 bits (461),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            ++T+APKRE DPKKRVVITGMGLVSVFGNDVDAYY+KLL+ ES IS IDRFDASKFPTRF
Sbjct  1    ASTSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSVESRISLIDRFDASKFPTRF  60

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGI  510
            GGQ+ GF +EGYIDGKN+RRLDDCL+YCIVAGKKALE+A+LG D +
Sbjct  61   GGQVCGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKL  106



>gb|ACM17228.1| chloroplast beta-ketoacyl-ACP synthase 1 [Brassica oleracea var. 
alboglabra]
Length=108

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            ++T+APKRE DPKKRVVITGMGLVSVFGNDVD YY+KLL+ ES IS IDRFDASKFPTRF
Sbjct  1    ASTSAPKRETDPKKRVVITGMGLVSVFGNDVDVYYEKLLSVESRISLIDRFDASKFPTRF  60

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGI  510
            GGQ+RGF +EGYIDGKN+R LDDCL+YCIVAGKKALE+A+LG D +
Sbjct  61   GGQVRGFSSEGYIDGKNERSLDDCLKYCIVAGKKALESANLGGDKL  106



>ref|WP_032125192.1| 3-oxoacyl-ACP synthase [Chlamydia sp. 'Diamant']
Length=415

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            K+R+VITGMG+VS FGNDVD +Y  LLAG SGI  I  F    +PTR  G I  F    Y
Sbjct  3    KRRIVITGMGIVSCFGNDVDIFYQNLLAGNSGIRTITDFPCEDYPTRIAGVIENFDTGEY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            +D K  RR+D  + Y +VAGKK+LE+A L  + + ++ K+R GIL+G+GMGG++VF+DGV
Sbjct  63   LDKKQARRVDKSIAYTMVAGKKSLESAQLSGEQLERLQKDRCGILIGSGMGGMSVFADGV  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            Q L+EKG R+++PFF+PY +TNM  ALL +D+GFMG
Sbjct  123  QTLVEKGQRRVSPFFVPYILTNMSGALLGMDIGFMG  158



>gb|KIC73224.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Neochlamydia 
sp. EPS4]
Length=415

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKR+VITGMG+VS FGN+VD YY  LL G+SG S I  F    +PTR    I+ F++  Y
Sbjct  3    KKRIVITGMGIVSCFGNEVDDYYQSLLDGKSGASLITSFPCEDYPTRIAASIKNFESGDY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            ID K  RR+D  + Y +VAGKKALE + L  + I K++KER G+++G+GMGG+ V+  GV
Sbjct  63   IDKKQARRIDKNIAYALVAGKKALEASQLNPEAIAKLNKERCGVVIGSGMGGMDVYCQGV  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            Q LI+KG R ++PFF+PY +TNMG A+LA+D+GFMG
Sbjct  123  QTLIQKGQRWVSPFFVPYILTNMGGAMLAMDIGFMG  158



>ref|XP_002463312.1| hypothetical protein SORBIDRAFT_02g041620 [Sorghum bicolor]
 gb|EER99833.1| hypothetical protein SORBIDRAFT_02g041620 [Sorghum bicolor]
Length=471

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 132/176 (75%), Gaps = 8/176 (5%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            S   AP+RE DPKKRVVITGMG+VSVFGNDV AYYD+LLAG SG+  IDRFDAS F TRF
Sbjct  34   SMARAPRRESDPKKRVVITGMGVVSVFGNDVGAYYDRLLAGSSGVGLIDRFDASGFSTRF  93

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGK----IDKERA  534
              QIRGF  EG+ID ++DRRLDDC RY +VA +KAL +A L  G+  + K    IDKERA
Sbjct  94   AAQIRGFSCEGHIDDESDRRLDDCQRYALVAARKALASAGLAIGSRAMYKRPPQIDKERA  153

Query  535  GILVGTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAID--LGFMG  696
            G++VG+G+GG T F+ G + L+ KG R I+P  IP+A+ N  SAL++ID  +GF+G
Sbjct  154  GVVVGSGIGGATAFTAGAEDLMRKGPRGISPCTIPFAMPNAASALVSIDAGIGFLG  209



>ref|WP_042239744.1| 3-oxoacyl-ACP synthase [Neochlamydia sp. S13]
Length=415

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKR+VITGMG+VS FGN+VD Y+  LL G+SG S I  F    +PTR    I+ F++  Y
Sbjct  3    KKRIVITGMGIVSCFGNEVDDYFQSLLDGKSGASLITSFPCEDYPTRIAASIKNFESGDY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            ID K  RR+D  + Y +VAGKKALE + L  + I K++KER G+++G+GMGG+ V+  GV
Sbjct  63   IDKKQARRIDKNIAYALVAGKKALEASQLSPEVIAKLNKERCGVVIGSGMGGMDVYCQGV  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            Q LI+KG R ++PFF+PY +TNMG A+LA+D+GFMG
Sbjct  123  QTLIQKGQRWVSPFFVPYILTNMGGAMLAMDIGFMG  158



>ref|WP_039384131.1| 3-oxoacyl-ACP synthase [Neochlamydia sp. TUME1]
 gb|KIC76638.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Neochlamydia sp. 
TUME1]
Length=415

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKR+VITGMG+VS FGN+V+ YY  LL G+SG S I  F    +PTR    I+ F++  Y
Sbjct  3    KKRIVITGMGIVSCFGNEVNDYYQSLLDGKSGASLITSFPCEDYPTRIAASIKNFESGDY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            ID K  RR+D  + Y +VAGKKALE + L  + I K++KER G+++G+GMGG+ V+  GV
Sbjct  63   IDKKQARRIDKNIAYAMVAGKKALEASQLSPEIIAKLNKERCGVVIGSGMGGMDVYCQGV  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            Q LI+KG R ++PFF+PY +TNMG A+LA+D+GFMG
Sbjct  123  QTLIQKGQRWVSPFFVPYILTNMGGAMLAMDIGFMG  158



>ref|XP_005642959.1| 3-ketoacyl-ACP-synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE18415.1| 3-ketoacyl-ACP-synthase [Coccomyxa subellipsoidea C-169]
Length=464

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = +1

Query  193  SATAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRF  372
            +A+ +      P++RVV+TGMG+VS  G+D D +Y+ LL G+SG+S ID F    + TRF
Sbjct  37   AASCSQNGNGKPERRVVVTGMGVVSCLGHDPDEFYNNLLEGKSGVSQIDSFSVEGYSTRF  96

Query  373  GGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGAD--GIGKIDKERAGILV  546
             G+I+GF+  GY+  KN+RR+D+C++Y +VAGKKAL++A    +      +D  + GIL+
Sbjct  97   AGEIKGFQCNGYVTKKNERRMDNCIKYTMVAGKKALQSAGFSLEPGSFDGLDLSKCGILI  156

Query  547  GTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GT MGG+  FS+ V+ L +KG+R++ PF IP+AITNM  ALLA+D+GFMG
Sbjct  157  GTAMGGMATFSNAVEDLTQKGFRRMNPFCIPFAITNMSGALLAMDVGFMG  206



>ref|WP_013944050.1| 3-oxoacyl-ACP synthase [Simkania negevensis]
 emb|CCB89584.1| 3-oxoacyl-[acyl-carrier-protein] synthase I,chloroplastic [Simkania 
negevensis Z]
Length=418

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 115/156 (74%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            K+R+V+TGM +VS FG DVD +YD LL G+SG+  I  F   ++PTRF   ++ F    Y
Sbjct  3    KRRIVVTGMSVVSCFGQDVDHFYDCLLRGKSGVRPITAFPCEEYPTRFAASVQDFDPGDY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            ID K  RR+D  +RY +V+GKKALE+A+L  + + ++DK R G+L+G+GMGG++VF +G 
Sbjct  63   IDKKQARRVDPFIRYTMVSGKKALESANLKQEDLEQLDKGRCGVLIGSGMGGMSVFFEGN  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + L +KG+ +ITPFF+PY ITNMG ALLAIDLGF G
Sbjct  123  KTLFDKGFSRITPFFVPYIITNMGGALLAIDLGFTG  158



>ref|XP_001773138.1| predicted protein [Physcomitrella patens]
 gb|EDQ61991.1| predicted protein [Physcomitrella patens]
Length=556

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 118/162 (73%), Gaps = 1/162 (1%)
 Frame = +1

Query  211  KREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRG  390
            K+    ++RVV+TGMGLVS  G+D D +Y+ LL G+SGI+ I+RFD   FPTRF G+I+ 
Sbjct  132  KKTATKQRRVVVTGMGLVSCHGHDPDTFYENLLTGKSGITEIERFDCRDFPTRFAGEIKS  191

Query  391  FKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLT  570
            F  EG++ GK  RR+D  + Y + AGKKA+ +AD+  + +  +DK + G+L+G+ MGG+ 
Sbjct  192  FSTEGWVAGKFARRMDRFMLYLLTAGKKAVMDADISEEVMKDLDKSKCGVLIGSAMGGMQ  251

Query  571  VFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            VF+D ++AL    YRK+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  252  VFNDAIEAL-RVSYRKMNPFCVPFATTNMGSAMLAMDLGWMG  292



>gb|EMS63377.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Triticum 
urartu]
Length=532

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 2/108 (2%)
 Frame = +1

Query  379  QIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADL--GADGIGKIDKERAGILVGT  552
            +IRGF +EGYIDGKNDRRLDDC+RYCI++GKKALE+A L  G+D  GK+D  RAGILVG+
Sbjct  50   EIRGFSSEGYIDGKNDRRLDDCIRYCILSGKKALESAGLSAGSDAHGKLDVGRAGILVGS  109

Query  553  GMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            GMGGL+VFSDGVQ LIEKGYRKI+PFFIPYAITNMGSALLA+D+GFMG
Sbjct  110  GMGGLSVFSDGVQNLIEKGYRKISPFFIPYAITNMGSALLAMDVGFMG  157



>ref|WP_041017043.1| 3-oxoacyl-ACP synthase [Criblamydia sequanensis]
 emb|CDR33578.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Criblamydia sequanensis 
CRIB-18]
Length=414

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +1

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            KRVV+TG+G+VS FGN+   +++ LL G+SG+S I  FDAS FPT+   +I+ F A  Y+
Sbjct  4    KRVVVTGLGVVSCFGNETTPFFESLLEGKSGVSKITSFDASSFPTQIAAEIKDFDAGDYL  63

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
            D K  RR+D  + Y +V GKKALE+A L       ++K+R+G+++G+GMGG+  + +GV 
Sbjct  64   DKKQARRVDKFIAYTVVGGKKALESAGLSRSQFDSLNKQRSGVIIGSGMGGMERYVEGVT  123

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +L EKG+R+++PFFIPY ITNMGS +LA++LGFMG
Sbjct  124  SLNEKGWRRVSPFFIPYVITNMGSGMLAMELGFMG  158



>ref|XP_002989269.1| hypothetical protein SELMODRAFT_129433, partial [Selaginella 
moellendorffii]
 gb|EFJ09707.1| hypothetical protein SELMODRAFT_129433, partial [Selaginella 
moellendorffii]
Length=420

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = +1

Query  232  KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYI  411
            +RVVITGMGLVS  GND D +YD LL G SGIS I  FD  +FPTR  G+I+ F A+G++
Sbjct  3    RRVVITGMGLVSSLGNDPDTFYDNLLEGNSGISEIQNFDCQEFPTRIAGEIKDFSADGWV  62

Query  412  DGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQ  591
              K  RR+D  + Y + AGKKA+ NA +  DG  ++DK + G+L+G+ MGG+ VF+D ++
Sbjct  63   APKFSRRMDKFMLYLLTAGKKAVANAGIAGDGSVELDKSKCGVLMGSAMGGMQVFNDAIE  122

Query  592  ALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            AL    YRK+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  123  AL-RVSYRKMNPFCVPFATTNMGSAMLAMDLGWMG  156



>gb|KDD75769.1| beta-ketoacyl synthase [Helicosporidium sp. ATCC 50920]
Length=464

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI-RGFKAEG  405
             +RVVITGMG+VS FGND DA+YD LL G SG+  I+ FDASKF TRF  +I  GFK   
Sbjct  44   HRRVVITGMGVVSAFGNDADAFYDALLEGTSGVRTIESFDASKFSTRFAAEIGNGFKPGD  103

Query  406  YIDGKNDRRLDDCLRYCIVAGKKALENADLGA----DGIGKIDKERAGILVGTGMGGLTV  573
             +D K  RRLD  L Y +VA K+AL  A L      +G  K+D  RAG+LV +GMGGLTV
Sbjct  104  CLDPKLARRLDRELSYAVVASKQALRMAGLDKQIQPEGHAKLDLGRAGVLVSSGMGGLTV  163

Query  574  FSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
              D V+ L E+GY++++PFFIPYAITNM +AL++ID GFMG
Sbjct  164  LQDNVRKLFEEGYQRMSPFFIPYAITNMAAALVSIDQGFMG  204



>ref|XP_001763306.1| predicted protein [Physcomitrella patens]
 gb|EDQ71836.1| predicted protein [Physcomitrella patens]
Length=481

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 124/177 (70%), Gaps = 10/177 (6%)
 Frame = +1

Query  193  SATAAPKREKDPK---------KRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRF  345
            + TA P +E + K         +RVV+TGMGLVS  G++   +Y+ LLAG+SGI+ I+RF
Sbjct  43   AVTAQPAKESEQKKNKKTATKKRRVVVTGMGLVSCHGHEPTQFYENLLAGKSGITEIERF  102

Query  346  DASKFPTRFGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDK  525
            D  +FPTRF G+I+ F  EG++ GK  RR+D  + Y + AGKKA+++A +  D +  +DK
Sbjct  103  DCKEFPTRFAGEIKSFSTEGWVAGKFARRMDRFMLYLLTAGKKAVKDAGITEDVMKDLDK  162

Query  526  ERAGILVGTGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             + G+L+G+ MGG+ VF+D ++AL    YRK+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  163  SKCGVLIGSAMGGMQVFNDAIEAL-RVSYRKMNPFCVPFATTNMGSAMLAMDLGWMG  218



>ref|XP_001700152.1| 3-ketoacyl-ACP-synthase [Chlamydomonas reinhardtii]
 gb|EDO98446.1| 3-ketoacyl-ACP-synthase [Chlamydomonas reinhardtii]
Length=459

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +1

Query  211  KREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRG  390
            K EK P+ RVV+TGMGLVS  G+D D +Y+ LLAG+SGI+ I+ F  + + TRF G+I+ 
Sbjct  39   KTEKAPR-RVVVTGMGLVSCLGHDHDEFYNNLLAGKSGITNIEGFPCADYTTRFAGEIKS  97

Query  391  FKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADG--IGKIDKERAGILVGTGMGG  564
                GY+  K ++R+D  ++Y +VAGKKAL +A L  DG  I  +D+ R G LVGT MGG
Sbjct  98   LDCTGYVTKKFEKRVDAVIKYILVAGKKALGDAGLAWDGQEIKDLDRMRCGTLVGTAMGG  157

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +T F++ V+AL   GYRK+ PF IP+AITNMG A+LA+D+GFMG
Sbjct  158  MTSFANAVEALETSGYRKMNPFCIPFAITNMGGAMLAMDIGFMG  201



>ref|XP_006852602.1| hypothetical protein AMTR_s00021p00221210 [Amborella trichopoda]
 gb|ERN14069.1| hypothetical protein AMTR_s00021p00221210 [Amborella trichopoda]
Length=112

 Score =   165 bits (418),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            +APKREKDPKKRVVITGMGLVSVFG+D+D +Y++LL GESGI+ ID FDAS FP RF GQ
Sbjct  7    SAPKREKDPKKRVVITGMGLVSVFGSDIDKFYERLLQGESGITTIDGFDASSFPVRFAGQ  66

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGAD  504
            IR F A GYIDGKNDRRLDDCLRYCIV+GK+AL++A+LG +
Sbjct  67   IRDFSAIGYIDGKNDRRLDDCLRYCIVSGKRALQDANLGPE  107



>ref|XP_002950994.1| hypothetical protein VOLCADRAFT_104947 [Volvox carteri f. nagariensis]
 gb|EFJ47888.1| hypothetical protein VOLCADRAFT_104947 [Volvox carteri f. nagariensis]
Length=462

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  211  KREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRG  390
            K E  P+ RVV+TGMG+VS  G++ + +Y+ LLAG+SGIS I+ F+AS + TRF G+I+ 
Sbjct  42   KTETTPR-RVVVTGMGVVSCLGHEHEEFYNNLLAGKSGISYIEGFNASDYTTRFAGEIKS  100

Query  391  FKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADG--IGKIDKERAGILVGTGMGG  564
                GYI  K ++R+D  ++Y IVAGKKAL +A L  DG  +  +++ R G L+GT MGG
Sbjct  101  LDCTGYISKKFEKRVDAVIKYIIVAGKKALGDAGLAWDGPALKDLNRMRCGTLIGTAMGG  160

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            +T F++ V+AL   GYRK+ PF IP+AITNMG A+LA+DLGFMG
Sbjct  161  MTSFANAVEALETAGYRKMNPFCIPFAITNMGGAMLAMDLGFMG  204



>ref|XP_005537149.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, precursor [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81113.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, precursor [Cyanidioschyzon 
merolae strain 10D]
Length=490

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 115/160 (72%), Gaps = 4/160 (3%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI--RGFKAE  402
            +KRVV+TG+G+VS FG+DVD +Y KLL GESG+  ID+F+ S + TR    I    F+ E
Sbjct  74   RKRVVVTGVGIVSCFGSDVDLFYQKLLKGESGVRPIDKFECSNWETRIAAWIAPEQFQTE  133

Query  403  GYIDGKNDRRLDDCLRYCIVAGKKALENADLG--ADGIGKIDKERAGILVGTGMGGLTVF  576
            GYI  K  RRLD  L+Y IVAGK+ALE+A LG  +D    + K+R G++VG+GMGGL  F
Sbjct  134  GYIAPKLARRLDSVLKYTIVAGKRALEHAGLGIGSDPYNALRKDRVGVIVGSGMGGLETF  193

Query  577  SDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            ++G + L   G R+++PFFIPY+ITNMGSALLAI+  F G
Sbjct  194  AEGCEKLSTGGVRRMSPFFIPYSITNMGSALLAIETDFHG  233



>ref|WP_042103505.1| 3-oxoacyl-ACP synthase [Parachlamydiaceae bacterium HS-T3]
Length=416

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKR+V+TGMGLVS  G+DVD +Y +LLAGESG+S I  F   ++PTRF G I+ F  E Y
Sbjct  4    KKRIVVTGMGLVSCLGHDVDLFYQRLLAGESGVSTITEFPVDEYPTRFAGIIKEFNPEEY  63

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            I+ K  RR+D  + Y IVAGKKALE   +  + +  +DK R G+++G+GMGG+ VF DG 
Sbjct  64   IEKKQARRVDRFIAYTIVAGKKALEYGGISKETLDHMDKSRCGVIIGSGMGGMGVFVDGT  123

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + L EKG+RK+TPFF+PY ITNMG ALLA+D G MG
Sbjct  124  KNLYEKGHRKVTPFFVPYIITNMGGALLAMDYGLMG  159



>ref|XP_002516228.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|EEF46230.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
Length=554

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 131/205 (64%), Gaps = 2/205 (1%)
 Frame = +1

Query  85   NSTALRP-SPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITGMGL  261
            +S  L P +PL P R    H     +   +   ++     A  K+    ++RVV+TGMG+
Sbjct  93   SSNGLFPNTPLLPKRHPRLHHRLPRSGEAMAVAVQPEKEVATNKKPLMKQRRVVVTGMGV  152

Query  262  VSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRLDD  441
            VS  G+D+D YY+ LL G SGIS ID FD ++FPTR  G+I+ F  +G++  K  +R+D 
Sbjct  153  VSPLGHDIDVYYNNLLDGSSGISQIDSFDCAQFPTRIAGEIKSFSTDGWVAPKLSKRMDK  212

Query  442  CLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGYRKI  621
             + Y + AGKKAL +  +  D + ++DK R G+L+G+ MGG+ VF+D ++AL    YRK+
Sbjct  213  FMLYMLTAGKKALADGGITEDMMDELDKARCGVLIGSAMGGMKVFNDAIEAL-RISYRKM  271

Query  622  TPFFIPYAITNMGSALLAIDLGFMG  696
             PF +P+A TNMGSA+LA+DLG+MG
Sbjct  272  NPFCVPFATTNMGSAMLAMDLGWMG  296



>gb|AAA33872.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR01158.1| plastid 3-keto-acyl-ACP synthase II [Ricinus communis]
Length=535

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 131/205 (64%), Gaps = 2/205 (1%)
 Frame = +1

Query  85   NSTALRP-SPLDPLRKTTSHFPSGvavrplprrlrvvSATAAPKREKDPKKRVVITGMGL  261
            +S  L P +PL P R    H     +   +   ++     A  K+    ++RVV+TGMG+
Sbjct  74   SSNGLFPNTPLLPKRHPRLHHRLPRSGEAMAVAVQPEKEVATNKKPLMKQRRVVVTGMGV  133

Query  262  VSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRLDD  441
            VS  G+D+D YY+ LL G SGIS ID FD ++FPTR  G+I+ F  +G++  K  +R+D 
Sbjct  134  VSPLGHDIDVYYNNLLDGSSGISQIDSFDCAQFPTRIAGEIKSFSTDGWVAPKLSKRMDK  193

Query  442  CLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGVQALIEKGYRKI  621
             + Y + AGKKAL +  +  D + ++DK R G+L+G+ MGG+ VF+D ++AL    YRK+
Sbjct  194  FMLYMLTAGKKALADGGITEDMMDELDKARCGVLIGSAMGGMKVFNDAIEAL-RISYRKM  252

Query  622  TPFFIPYAITNMGSALLAIDLGFMG  696
             PF +P+A TNMGSA+LA+DLG+MG
Sbjct  253  NPFCVPFATTNMGSAMLAMDLGWMG  277



>gb|EKE22156.1| hypothetical protein ACD_7C00036G0001, partial [uncultured bacterium]
Length=354

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 107/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKR+V+TGMG+VS FGND+D +Y KLL G S ++ I  F+   +PT+  G IR F    Y
Sbjct  3    KKRIVVTGMGIVSAFGNDIDLFYKKLLDGNSCVTTITEFNVDDYPTKIAGTIRNFDVGDY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            +  K  RR D  +RY +VAGKKALE+  L    +  IDK R G ++G+GMGG++ F DGV
Sbjct  63   MPKKQARRADLFIRYAMVAGKKALESTQLTGADLDSIDKTRCGCIIGSGMGGMSSFYDGV  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
              ++  GY+++TPFF+P  IT+MG ALLAIDLGF G
Sbjct  123  MTVVNGGYKRLTPFFVPMIITDMGGALLAIDLGFQG  158



>ref|XP_010937287.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X4 [Elaeis guineensis]
Length=499

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            A  KR +  ++RV +TGMG+V+   +D D +Y+KLL G SGIS I+ FD S +PTR  G+
Sbjct  138  AQKKRMQTKQRRVAVTGMGVVTPLSHDPDIFYEKLLEGVSGISEIETFDCSSYPTRIAGE  197

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            I+ F ++G++  K  +R+D  + Y + AGKKALEN  +  D + ++DK R G+L+G+ MG
Sbjct  198  IKSFSSDGWVAPKFSKRIDKFMLYMLTAGKKALENGGVTEDVMSQLDKARCGVLIGSAMG  257

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T+F+D V+AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  258  GMTIFNDAVEAL-RISYKKMNPFCVPFAATNMGSAMLAMDLGWMG  301



>ref|XP_001768994.1| predicted protein [Physcomitrella patens]
 gb|EDQ66192.1| predicted protein [Physcomitrella patens]
Length=546

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 115/163 (71%), Gaps = 1/163 (1%)
 Frame = +1

Query  208  PKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIR  387
            PK+     +RVV+TGMG+VS  G+D D++Y  LL G+SG+S I+ FD  +F TR  G+I+
Sbjct  122  PKKTSTKPRRVVVTGMGVVSCLGHDADSFYANLLEGKSGVSEIENFDCKQFSTRIAGEIK  181

Query  388  GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGL  567
             F A+G++ GK  +R+D  + Y + AGKKA+ +A L  D I  IDK R G+L+G+ MGG+
Sbjct  182  SFSADGWVAGKFIKRMDKFMLYLLTAGKKAVFDAGLTEDVIKSIDKSRCGVLIGSAMGGM  241

Query  568  TVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
             +F+D ++AL    YRK+ PF +P A TNMGSA+LA+DLG+MG
Sbjct  242  QIFNDAIEAL-RLSYRKMNPFCVPLASTNMGSAMLAMDLGWMG  283



>ref|XP_010937286.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=557

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            A  KR +  ++RV +TGMG+V+   +D D +Y+KLL G SGIS I+ FD S +PTR  G+
Sbjct  136  AQKKRMQTKQRRVAVTGMGVVTPLSHDPDIFYEKLLEGVSGISEIETFDCSSYPTRIAGE  195

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            I+ F ++G++  K  +R+D  + Y + AGKKALEN  +  D + ++DK R G+L+G+ MG
Sbjct  196  IKSFSSDGWVAPKFSKRIDKFMLYMLTAGKKALENGGVTEDVMSQLDKARCGVLIGSAMG  255

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T+F+D V+AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  256  GMTIFNDAVEAL-RISYKKMNPFCVPFAATNMGSAMLAMDLGWMG  299



>ref|XP_010937284.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=559

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            A  KR +  ++RV +TGMG+V+   +D D +Y+KLL G SGIS I+ FD S +PTR  G+
Sbjct  138  AQKKRMQTKQRRVAVTGMGVVTPLSHDPDIFYEKLLEGVSGISEIETFDCSSYPTRIAGE  197

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            I+ F ++G++  K  +R+D  + Y + AGKKALEN  +  D + ++DK R G+L+G+ MG
Sbjct  198  IKSFSSDGWVAPKFSKRIDKFMLYMLTAGKKALENGGVTEDVMSQLDKARCGVLIGSAMG  257

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T+F+D V+AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  258  GMTIFNDAVEAL-RISYKKMNPFCVPFAATNMGSAMLAMDLGWMG  301



>ref|XP_010937285.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=559

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            A  KR +  ++RV +TGMG+V+   +D D +Y+KLL G SGIS I+ FD S +PTR  G+
Sbjct  138  AQKKRMQTKQRRVAVTGMGVVTPLSHDPDIFYEKLLEGVSGISEIETFDCSSYPTRIAGE  197

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            I+ F ++G++  K  +R+D  + Y + AGKKALEN  +  D + ++DK R G+L+G+ MG
Sbjct  198  IKSFSSDGWVAPKFSKRIDKFMLYMLTAGKKALENGGVTEDVMSQLDKARCGVLIGSAMG  257

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+T+F+D V+AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  258  GMTIFNDAVEAL-RISYKKMNPFCVPFAATNMGSAMLAMDLGWMG  301



>gb|EAZ42784.1| hypothetical protein OsJ_27364 [Oryza sativa Japonica Group]
Length=434

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 119/169 (70%), Gaps = 7/169 (4%)
 Frame = +1

Query  208  PKR---EKDP---KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTR  369
            P+R   EK P   ++RVVITGMG+V+  G+D D +Y+ LL G SGIS I+RFD S FPTR
Sbjct  9    PERRTVEKKPDVKQRRVVITGMGVVTPLGHDPDVFYNNLLDGVSGISEIERFDCSTFPTR  68

Query  370  FGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVG  549
              G+I+ F  +G++  K  RR+D  + Y I AGKKALE+  L  +   ++DK R G+L+G
Sbjct  69   IAGEIKSFSTDGWVAPKLARRMDKFMLYLITAGKKALEHGGLTEELRNELDKTRCGVLIG  128

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + MGG+ VF+D ++AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  129  SAMGGMKVFNDAIEAL-RVSYKKMNPFCVPFATTNMGSAILAMDLGWMG  176



>ref|NP_001060274.1| Os07g0616200 [Oryza sativa Japonica Group]
 dbj|BAC79989.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase [Oryza sativa 
Japonica Group]
 dbj|BAF22188.1| Os07g0616200 [Oryza sativa Japonica Group]
 dbj|BAG90343.1| unnamed protein product [Oryza sativa Japonica Group]
Length=507

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 119/169 (70%), Gaps = 7/169 (4%)
 Frame = +1

Query  208  PKR---EKDP---KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTR  369
            P+R   EK P   ++RVVITGMG+V+  G+D D +Y+ LL G SGIS I+RFD S FPTR
Sbjct  82   PERRTVEKKPDVKQRRVVITGMGVVTPLGHDPDVFYNNLLDGVSGISEIERFDCSTFPTR  141

Query  370  FGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVG  549
              G+I+ F  +G++  K  RR+D  + Y I AGKKALE+  L  +   ++DK R G+L+G
Sbjct  142  IAGEIKSFSTDGWVAPKLARRMDKFMLYLITAGKKALEHGGLTEELRNELDKTRCGVLIG  201

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + MGG+ VF+D ++AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  202  SAMGGMKVFNDAIEAL-RVSYKKMNPFCVPFATTNMGSAILAMDLGWMG  249



>gb|EAZ04708.1| hypothetical protein OsI_26869 [Oryza sativa Indica Group]
Length=507

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 119/169 (70%), Gaps = 7/169 (4%)
 Frame = +1

Query  208  PKR---EKDP---KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTR  369
            P+R   EK P   ++RVVITGMG+V+  G+D D +Y+ LL G SGIS I+RFD S FPTR
Sbjct  82   PERRTVEKKPDVKQRRVVITGMGVVTPLGHDPDVFYNNLLDGVSGISEIERFDCSTFPTR  141

Query  370  FGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVG  549
              G+I+ F  +G++  K  RR+D  + Y I AGKKALE+  L  +   ++DK R G+L+G
Sbjct  142  IAGEIKSFSTDGWVAPKLARRMDKFMLYLITAGKKALEHGGLTEELRNELDKTRCGVLIG  201

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + MGG+ VF+D ++AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  202  SAMGGMKVFNDAIEAL-RVSYKKMNPFCVPFATTNMGSAILAMDLGWMG  249



>gb|EPS61225.1| hypothetical protein M569_13573, partial [Genlisea aurea]
Length=314

 Score =   166 bits (419),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 116/165 (70%), Gaps = 1/165 (1%)
 Frame = +1

Query  202  AAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQ  381
            ++ K+    K+RVV+TGMG+ +  G D D +YD LL G SGIS I+ FD S FPTR  G+
Sbjct  124  SSKKQRPTEKRRVVVTGMGVETPLGGDPDVFYDSLLEGVSGISQIEGFDCSSFPTRIAGE  183

Query  382  IRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMG  561
            I+ F  +G++  K  +RLD  + Y + AGKKAL +A +  D + +IDK R G+L+G+ MG
Sbjct  184  IKSFSTDGWVAPKLLKRLDKFMLYILTAGKKALADAGIDEDVMKEIDKTRCGVLIGSAMG  243

Query  562  GLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            G+ VF+DG++AL    ++K+ PF +P++ TNMGSA+LA+DLG+MG
Sbjct  244  GMKVFNDGIEAL-RISHKKMNPFSVPFSTTNMGSAILAMDLGWMG  287



>ref|WP_006340838.1| 3-oxoacyl-ACP synthase [Parachlamydia acanthamoebae]
 gb|EFB41814.1| hypothetical protein pah_c022o107 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86299.1| 3-oxoacyl-[acyl-carrier-protein] synthase I,chloroplastic [Parachlamydia 
acanthamoebae UV-7]
 gb|KIA77957.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Parachlamydia acanthamoebae]
Length=419

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 115/156 (74%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQIRGFKAEGY  408
            KKR+V+TGMGLVS  G++VD +Y  LL G+SGI+ I  F   ++PTRF G+I+ F    Y
Sbjct  3    KKRIVVTGMGLVSCLGHEVDLFYQNLLQGKSGITPITGFPCEEYPTRFAGEIKDFDPGEY  62

Query  409  IDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGGLTVFSDGV  588
            ID K  RR+D  + Y IVAGKKALE A L A    ++DKER GI++G+GMGG+  F DGV
Sbjct  63   IDKKQARRIDKFIAYTIVAGKKALELAGLNAQKQEELDKERCGIIIGSGMGGMKTFVDGV  122

Query  589  QALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            Q LIEKGY+K++PFF+PY ITNMG  LLA +LGFMG
Sbjct  123  QNLIEKGYKKVSPFFVPYIITNMGGGLLAKELGFMG  158



>ref|XP_011078137.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=499

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +1

Query  208  PKREK-DPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTRFGGQI  384
            PK++   P++RVV+TGMG+ +  G+D D +Y+ LL G SGIS I+ FD S++PTR  G+I
Sbjct  126  PKQKPPTPQRRVVVTGMGVETPLGHDPDVFYNNLLQGVSGISEIEAFDCSQYPTRIAGEI  185

Query  385  RGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVGTGMGG  564
            + F A+G++  K  +R+D  + Y + AGKKAL +  +  D + +++K R G+L+G+ MGG
Sbjct  186  KSFSADGWVAPKFSKRMDRFMLYMLTAGKKALADGGITEDVMEELNKARCGVLIGSAMGG  245

Query  565  LTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + VF+D ++AL    YRK+ PF +P+A+TNMGSA+LA+DLG+MG
Sbjct  246  MQVFNDAIEAL-RISYRKMNPFCVPFAVTNMGSAMLAMDLGWMG  288



>ref|XP_008242279.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Prunus mume]
Length=563

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  199  TAAPKREKDP---KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTR  369
            T    ++K P   ++RVV+TGM +VS  G+D D +Y+ LL G SGIS I+ FD ++FPTR
Sbjct  138  TEERTKQKKPTTRQRRVVVTGMSVVSPLGHDSDVFYNNLLEGVSGISEIEAFDCTQFPTR  197

Query  370  FGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVG  549
             GG+I+ F  +G++  K  RR+D  + Y + AGKKAL +  +  D + +IDK + G+L+G
Sbjct  198  IGGEIKSFSTDGWVAPKFSRRMDKFMLYMLTAGKKALADGGITEDVMKQIDKAKCGVLIG  257

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + MGG+ VF+D ++AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  258  SAMGGMKVFNDAIEAL-RVSYKKMNPFCVPFATTNMGSAMLAMDLGWMG  305



>ref|XP_007204195.1| hypothetical protein PRUPE_ppa003597mg [Prunus persica]
 gb|EMJ05394.1| hypothetical protein PRUPE_ppa003597mg [Prunus persica]
Length=563

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  199  TAAPKREKDP---KKRVVITGMGLVSVFGNDVDAYYDKLLAGESGISAIDRFDASKFPTR  369
            T    ++K P   ++RVV+TGM +VS  G+D D +Y+ LL G SGIS I+ FD ++FPTR
Sbjct  138  TEERTKQKKPTTRQRRVVVTGMSVVSPLGHDSDVFYNNLLEGVSGISEIEAFDCTQFPTR  197

Query  370  FGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGADGIGKIDKERAGILVG  549
             GG+I+ F  +G++  K  RR+D  + Y + AGKKAL +  +  D + +IDK + G+L+G
Sbjct  198  IGGEIKSFSTDGWVAPKFSRRMDKFMLYMLTAGKKALADGGITEDVMDQIDKAKCGVLIG  257

Query  550  TGMGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMG  696
            + MGG+ VF+D ++AL    Y+K+ PF +P+A TNMGSA+LA+DLG+MG
Sbjct  258  SAMGGMKVFNDAIEAL-RVSYKKMNPFCVPFATTNMGSAMLAMDLGWMG  305



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160