BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039P01

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243220.1|  PREDICTED: uncharacterized protein LOC101252503    125   3e-30   Solanum lycopersicum
ref|XP_006366758.1|  PREDICTED: uncharacterized protein LOC102601...    121   9e-29   Solanum tuberosum [potatoes]
ref|XP_009801592.1|  PREDICTED: uncharacterized protein LOC104247...    118   6e-28   Nicotiana sylvestris
ref|XP_009801590.1|  PREDICTED: uncharacterized protein LOC104247...    118   1e-27   Nicotiana sylvestris
ref|XP_009597431.1|  PREDICTED: uncharacterized protein LOC104093402    116   4e-27   Nicotiana tomentosiformis
ref|XP_011082888.1|  PREDICTED: telomeric repeat-binding factor 1...    112   1e-25   
gb|EYU34385.1|  hypothetical protein MIMGU_mgv1a008782mg                109   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_010657505.1|  PREDICTED: uncharacterized protein LOC104880931    103   4e-22   Vitis vinifera
emb|CBI28490.3|  unnamed protein product                                103   6e-22   Vitis vinifera
ref|XP_010252969.1|  PREDICTED: uncharacterized protein LOC104594...  96.3    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010252970.1|  PREDICTED: uncharacterized protein LOC104594...  96.3    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010252973.1|  PREDICTED: uncharacterized protein LOC104594...  96.3    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010252972.1|  PREDICTED: uncharacterized protein LOC104594...  96.3    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010653800.1|  PREDICTED: uncharacterized protein LOC100852566  96.3    4e-19   Vitis vinifera
emb|CAN80644.1|  hypothetical protein VITISV_016915                   96.3    4e-19   Vitis vinifera
ref|XP_010252971.1|  PREDICTED: uncharacterized protein LOC104594...  96.3    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_007028830.1|  RING/FYVE/PHD zinc finger superfamily protei...  95.5    6e-19   
ref|XP_007028829.1|  RING/FYVE/PHD zinc finger superfamily protei...  95.5    7e-19   
gb|KCW47629.1|  hypothetical protein EUGRSUZ_K01371                   94.4    8e-19   Eucalyptus grandis [rose gum]
ref|XP_010036112.1|  PREDICTED: uncharacterized protein LOC104425191  94.0    9e-19   Eucalyptus grandis [rose gum]
ref|XP_003601481.1|  hypothetical protein MTR_3g082160                90.9    3e-18   
gb|AES71732.2|  myb-like DNA-binding domain protein                   90.9    4e-18   Medicago truncatula
gb|KDO45394.1|  hypothetical protein CISIN_1g0037502mg                92.4    8e-18   Citrus sinensis [apfelsine]
gb|KDO45393.1|  hypothetical protein CISIN_1g0037502mg                92.0    9e-18   Citrus sinensis [apfelsine]
ref|XP_006421445.1|  hypothetical protein CICLE_v10004349mg           92.0    1e-17   Citrus clementina [clementine]
ref|XP_006493907.1|  PREDICTED: uncharacterized protein LOC102627...  91.7    1e-17   Citrus sinensis [apfelsine]
ref|XP_006493906.1|  PREDICTED: uncharacterized protein LOC102627...  91.7    1e-17   Citrus sinensis [apfelsine]
ref|XP_004144625.1|  PREDICTED: uncharacterized protein LOC101213119  90.5    2e-17   Cucumis sativus [cucumbers]
ref|XP_008462017.1|  PREDICTED: uncharacterized protein LOC103500...  89.0    6e-17   Cucumis melo [Oriental melon]
ref|XP_008462016.1|  PREDICTED: uncharacterized protein LOC103500...  89.0    6e-17   Cucumis melo [Oriental melon]
ref|XP_007017102.1|  RING/FYVE/PHD zinc finger superfamily protei...  88.6    1e-16   
ref|XP_009623203.1|  PREDICTED: uncharacterized protein LOC104114...  88.6    2e-16   Nicotiana tomentosiformis
ref|XP_002526722.1|  conserved hypothetical protein                   88.6    2e-16   Ricinus communis
ref|XP_009623199.1|  PREDICTED: uncharacterized protein LOC104114...  88.2    2e-16   Nicotiana tomentosiformis
ref|XP_009785578.1|  PREDICTED: uncharacterized protein LOC104233...  87.8    3e-16   Nicotiana sylvestris
ref|XP_009785577.1|  PREDICTED: uncharacterized protein LOC104233...  87.4    3e-16   Nicotiana sylvestris
ref|XP_009785576.1|  PREDICTED: uncharacterized protein LOC104233...  87.4    4e-16   Nicotiana sylvestris
ref|XP_004502096.1|  PREDICTED: uncharacterized protein LOC101494...  84.3    7e-16   
ref|XP_004502097.1|  PREDICTED: uncharacterized protein LOC101494...  84.3    7e-16   Cicer arietinum [garbanzo]
ref|XP_008775217.1|  PREDICTED: uncharacterized protein LOC103695626  86.7    7e-16   Phoenix dactylifera
gb|KDO51066.1|  hypothetical protein CISIN_1g037252mg                 80.9    1e-15   Citrus sinensis [apfelsine]
ref|XP_006493556.1|  PREDICTED: uncharacterized protein LOC102610863  85.9    1e-15   Citrus sinensis [apfelsine]
ref|XP_009401240.1|  PREDICTED: uncharacterized protein LOC103985...  85.9    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401239.1|  PREDICTED: uncharacterized protein LOC103985...  85.9    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006349555.1|  PREDICTED: uncharacterized protein LOC102593...  85.5    2e-15   Solanum tuberosum [potatoes]
ref|XP_006349554.1|  PREDICTED: uncharacterized protein LOC102593...  85.5    2e-15   Solanum tuberosum [potatoes]
ref|XP_006349552.1|  PREDICTED: uncharacterized protein LOC102593...  85.5    2e-15   Solanum tuberosum [potatoes]
ref|XP_006349553.1|  PREDICTED: uncharacterized protein LOC102593...  85.1    2e-15   Solanum tuberosum [potatoes]
ref|XP_007049458.1|  Uncharacterized protein isoform 2                84.3    2e-15   
ref|XP_007049457.1|  Uncharacterized protein isoform 1                84.3    2e-15   
gb|KDP30809.1|  hypothetical protein JCGZ_13752                       84.7    2e-15   Jatropha curcas
ref|XP_007145628.1|  hypothetical protein PHAVU_007G255000g           84.7    3e-15   Phaseolus vulgaris [French bean]
gb|KDP26014.1|  hypothetical protein JCGZ_21047                       84.7    4e-15   Jatropha curcas
ref|XP_010920082.1|  PREDICTED: uncharacterized protein LOC105044...  83.6    7e-15   Elaeis guineensis
ref|XP_010920081.1|  PREDICTED: uncharacterized protein LOC105044...  83.6    7e-15   Elaeis guineensis
ref|XP_011087314.1|  PREDICTED: uncharacterized protein LOC105168...  83.6    8e-15   
ref|XP_010091860.1|  hypothetical protein L484_002387                 83.6    8e-15   
ref|XP_011087312.1|  PREDICTED: uncharacterized protein LOC105168...  83.6    8e-15   Sesamum indicum [beniseed]
ref|XP_009613453.1|  PREDICTED: uncharacterized protein LOC104106...  83.2    9e-15   Nicotiana tomentosiformis
ref|XP_009613450.1|  PREDICTED: uncharacterized protein LOC104106...  83.2    9e-15   Nicotiana tomentosiformis
ref|XP_009613452.1|  PREDICTED: uncharacterized protein LOC104106...  83.2    1e-14   Nicotiana tomentosiformis
ref|XP_007210101.1|  hypothetical protein PRUPE_ppa021429mg           82.4    1e-14   
ref|XP_010050113.1|  PREDICTED: uncharacterized protein LOC104438...  82.0    2e-14   
ref|XP_010050114.1|  PREDICTED: uncharacterized protein LOC104438...  82.0    2e-14   
ref|XP_009804769.1|  PREDICTED: uncharacterized protein LOC104249...  82.0    2e-14   Nicotiana sylvestris
ref|XP_009804765.1|  PREDICTED: uncharacterized protein LOC104249...  82.0    2e-14   Nicotiana sylvestris
ref|XP_010050112.1|  PREDICTED: uncharacterized protein LOC104438...  82.0    2e-14   
ref|XP_009804770.1|  PREDICTED: uncharacterized protein LOC104249...  81.6    2e-14   Nicotiana sylvestris
ref|XP_006577901.1|  PREDICTED: uncharacterized protein LOC102661...  81.6    3e-14   Glycine max [soybeans]
ref|XP_006577902.1|  PREDICTED: uncharacterized protein LOC102661...  81.6    3e-14   Glycine max [soybeans]
ref|XP_010317920.1|  PREDICTED: uncharacterized protein LOC104646...  81.3    3e-14   Solanum lycopersicum
ref|XP_010689350.1|  PREDICTED: uncharacterized protein LOC104903...  80.9    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010317919.1|  PREDICTED: uncharacterized protein LOC104646...  81.3    4e-14   Solanum lycopersicum
ref|XP_010689348.1|  PREDICTED: uncharacterized protein LOC104903...  80.9    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689347.1|  PREDICTED: uncharacterized protein LOC104903...  80.9    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689351.1|  PREDICTED: uncharacterized protein LOC104903...  80.5    5e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB08733.1|  hypothetical protein B456_001G100000                  79.7    7e-14   Gossypium raimondii
ref|XP_002510568.1|  hypothetical protein RCOM_1598630                79.3    8e-14   
gb|KJB08735.1|  hypothetical protein B456_001G100000                  79.7    9e-14   Gossypium raimondii
gb|KJB08734.1|  hypothetical protein B456_001G100000                  79.7    1e-13   Gossypium raimondii
ref|XP_006594392.1|  PREDICTED: histone-lysine N-methyltransferas...  78.2    2e-13   Glycine max [soybeans]
gb|KDO44064.1|  hypothetical protein CISIN_1g044718mg                 75.5    3e-13   Citrus sinensis [apfelsine]
gb|EPS72218.1|  hypothetical protein M569_02550                       76.3    3e-13   Genlisea aurea
ref|XP_008229759.1|  PREDICTED: uncharacterized protein LOC103329108  76.6    4e-13   Prunus mume [ume]
ref|XP_006364332.1|  PREDICTED: uncharacterized protein LOC102590076  78.2    4e-13   Solanum tuberosum [potatoes]
ref|XP_008240243.1|  PREDICTED: uncharacterized protein LOC103338770  77.4    5e-13   Prunus mume [ume]
gb|KJB42679.1|  hypothetical protein B456_007G163500                  75.9    5e-13   Gossypium raimondii
ref|XP_007216759.1|  hypothetical protein PRUPE_ppa024791mg           76.6    5e-13   Prunus persica
gb|KJB36050.1|  hypothetical protein B456_006G138200                  77.4    5e-13   Gossypium raimondii
gb|KHG06835.1|  PHD finger 21B                                        77.8    6e-13   Gossypium arboreum [tree cotton]
ref|XP_006351323.1|  PREDICTED: uncharacterized protein LOC102589...  77.8    6e-13   Solanum tuberosum [potatoes]
gb|KJB36049.1|  hypothetical protein B456_006G138200                  77.4    6e-13   Gossypium raimondii
gb|KJB36048.1|  hypothetical protein B456_006G138200                  77.4    7e-13   Gossypium raimondii
ref|XP_010266411.1|  PREDICTED: uncharacterized protein LOC104603935  77.0    1e-12   Nelumbo nucifera [Indian lotus]
gb|KDO47726.1|  hypothetical protein CISIN_1g041295mg                 72.4    3e-12   Citrus sinensis [apfelsine]
ref|XP_011033306.1|  PREDICTED: uncharacterized protein LOC105131...  75.1    4e-12   Populus euphratica
ref|XP_011033308.1|  PREDICTED: uncharacterized protein LOC105131...  75.1    4e-12   Populus euphratica
ref|XP_006598111.1|  PREDICTED: neurofilament medium polypeptide-...  73.9    6e-12   Glycine max [soybeans]
ref|XP_002323310.1|  hypothetical protein POPTR_0016s05370g           74.7    6e-12   
ref|XP_004249272.1|  PREDICTED: uncharacterized protein LOC101258507  73.2    2e-11   Solanum lycopersicum
ref|XP_004516069.1|  PREDICTED: uncharacterized protein LOC101508...  72.4    3e-11   
emb|CDP10065.1|  unnamed protein product                              72.4    3e-11   Coffea canephora [robusta coffee]
gb|KJB49283.1|  hypothetical protein B456_008G110900                  70.1    4e-11   Gossypium raimondii
ref|XP_004516068.1|  PREDICTED: uncharacterized protein LOC101508...  72.4    4e-11   
ref|XP_004516066.1|  PREDICTED: uncharacterized protein LOC101508...  72.4    4e-11   
ref|XP_010542060.1|  PREDICTED: uncharacterized protein LOC104815384  72.0    4e-11   Tarenaya hassleriana [spider flower]
ref|XP_010556238.1|  PREDICTED: uncharacterized protein LOC104825577  70.9    7e-11   Tarenaya hassleriana [spider flower]
ref|XP_010527811.1|  PREDICTED: uncharacterized protein LOC104805090  70.5    7e-11   Tarenaya hassleriana [spider flower]
gb|KHN27333.1|  hypothetical protein glysoja_031941                   70.5    9e-11   Glycine soja [wild soybean]
gb|KGN59346.1|  hypothetical protein Csa_3G812180                     70.5    1e-10   Cucumis sativus [cucumbers]
ref|XP_008443120.1|  PREDICTED: uncharacterized protein LOC103486...  70.1    2e-10   Cucumis melo [Oriental melon]
ref|XP_008443123.1|  PREDICTED: uncharacterized protein LOC103486...  70.1    2e-10   
ref|XP_002887160.1|  hypothetical protein ARALYDRAFT_339050           68.6    2e-10   
ref|XP_008357975.1|  PREDICTED: trichohyalin-like                     68.9    3e-10   
ref|XP_006392600.1|  hypothetical protein EUTSA_v10011681mg           67.4    4e-10   
ref|XP_006663448.1|  PREDICTED: uncharacterized protein LOC102714137  68.9    4e-10   Oryza brachyantha
gb|EMS65740.1|  hypothetical protein TRIUR3_19894                     68.6    5e-10   Triticum urartu
dbj|BAJ53106.1|  JHL20J20.13                                          67.4    1e-09   Jatropha curcas
ref|NP_001176540.1|  Os11g0482500                                     67.4    1e-09   
gb|EAZ18368.1|  hypothetical protein OsJ_33899                        67.4    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93678.2|  expressed protein                                     67.4    1e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CDY41105.1|  BnaC05g10960D                                        66.6    1e-09   Brassica napus [oilseed rape]
ref|XP_011469852.1|  PREDICTED: uncharacterized protein LOC105353056  67.4    1e-09   Fragaria vesca subsp. vesca
ref|XP_009105352.1|  PREDICTED: uncharacterized protein LOC103831221  65.9    2e-09   Brassica rapa
gb|EMT27515.1|  Casein kinase I isoform delta-like protein            67.4    2e-09   
ref|XP_010511786.1|  PREDICTED: uncharacterized protein LOC104787835  65.9    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011034807.1|  PREDICTED: protein CHROMATIN REMODELING 4-li...  66.6    2e-09   Populus euphratica
ref|XP_011034806.1|  PREDICTED: protein CHROMATIN REMODELING 4-li...  66.6    2e-09   Populus euphratica
ref|XP_006857950.1|  hypothetical protein AMTR_s00069p00165540        67.0    2e-09   
ref|XP_011034809.1|  PREDICTED: protein CHROMATIN REMODELING 4-li...  66.2    2e-09   Populus euphratica
ref|XP_011034808.1|  PREDICTED: protein CHROMATIN REMODELING 4-li...  66.2    2e-09   Populus euphratica
ref|XP_011034802.1|  PREDICTED: protein CHROMATIN REMODELING 4-li...  66.2    2e-09   Populus euphratica
emb|CDM85276.1|  unnamed protein product                              66.6    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011034810.1|  PREDICTED: protein CHROMATIN REMODELING 4-li...  66.2    2e-09   Populus euphratica
ref|XP_004952567.1|  PREDICTED: uncharacterized protein LOC101781636  66.6    3e-09   
ref|XP_011467630.1|  PREDICTED: uncharacterized protein LOC101295...  65.9    3e-09   Fragaria vesca subsp. vesca
ref|XP_002301900.2|  hypothetical protein POPTR_0002s00710g           65.9    3e-09   
ref|XP_011467625.1|  PREDICTED: uncharacterized protein LOC101295...  65.5    4e-09   Fragaria vesca subsp. vesca
ref|XP_010531647.1|  PREDICTED: uncharacterized protein LOC104807903  65.5    4e-09   Tarenaya hassleriana [spider flower]
gb|EMS53431.1|  DNA (cytosine-5)-methyltransferase 1                  65.9    4e-09   Triticum urartu
dbj|BAK00800.1|  predicted protein                                    65.9    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010112893.1|  hypothetical protein L484_017729                 65.5    4e-09   Morus notabilis
ref|XP_010532943.1|  PREDICTED: uncharacterized protein LOC104808...  65.1    5e-09   Tarenaya hassleriana [spider flower]
ref|XP_009148864.1|  PREDICTED: uncharacterized protein LOC103872...  64.7    6e-09   Brassica rapa
ref|XP_010532944.1|  PREDICTED: uncharacterized protein LOC104808...  65.1    6e-09   Tarenaya hassleriana [spider flower]
ref|XP_009148863.1|  PREDICTED: uncharacterized protein LOC103872...  64.3    7e-09   Brassica rapa
ref|XP_009148860.1|  PREDICTED: uncharacterized protein LOC103872...  64.7    7e-09   Brassica rapa
emb|CDY45288.1|  BnaA06g09580D                                        64.3    7e-09   Brassica napus [oilseed rape]
ref|XP_006301220.1|  hypothetical protein CARUB_v10021620mg           63.9    8e-09   Capsella rubella
emb|CDX96053.1|  BnaA07g26780D                                        63.9    8e-09   
ref|XP_006416972.1|  hypothetical protein EUTSA_v10009755mg           64.3    8e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010672772.1|  PREDICTED: uncharacterized protein LOC104889...  64.7    8e-09   
ref|XP_010672769.1|  PREDICTED: uncharacterized protein LOC104889...  64.7    9e-09   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX86692.1|  BnaC08g00110D                                        64.7    1e-08   
ref|XP_010415413.1|  PREDICTED: uncharacterized protein LOC104701424  63.5    1e-08   Camelina sativa [gold-of-pleasure]
gb|KEH36418.1|  PHD-finger protein                                    63.2    2e-08   Medicago truncatula
gb|KEH36417.1|  PHD-finger protein                                    63.2    3e-08   Medicago truncatula
ref|XP_004304663.2|  PREDICTED: uncharacterized protein LOC101308008  61.2    3e-08   Fragaria vesca subsp. vesca
gb|AES63190.2|  PHD-finger protein                                    63.2    3e-08   Medicago truncatula
ref|XP_011072836.1|  PREDICTED: uncharacterized protein LOC105157...  63.2    3e-08   
ref|XP_011072839.1|  PREDICTED: uncharacterized protein LOC105157...  63.2    3e-08   Sesamum indicum [beniseed]
ref|XP_002892829.1|  hypothetical protein ARALYDRAFT_471666           62.4    4e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_008240866.1|  PREDICTED: uncharacterized protein LOC103339362  62.0    4e-08   
ref|XP_008356655.1|  PREDICTED: uncharacterized protein LOC103420370  62.4    5e-08   Malus domestica [apple tree]
ref|NP_172930.1|  uncharacterized protein                             62.0    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65632.1|  PhD-finger protein, putative                          62.0    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009347334.1|  PREDICTED: uncharacterized protein LOC103939004  62.0    5e-08   Pyrus x bretschneideri [bai li]
ref|XP_004136747.1|  PREDICTED: uncharacterized protein LOC101206592  62.0    6e-08   
emb|CDY01877.1|  BnaC06g29170D                                        61.2    6e-08   
emb|CDY15447.1|  BnaA08g27310D                                        62.0    7e-08   Brassica napus [oilseed rape]
ref|XP_004300509.1|  PREDICTED: uncharacterized protein LOC101292125  61.6    7e-08   Fragaria vesca subsp. vesca
ref|XP_010235463.1|  PREDICTED: uncharacterized protein LOC100830...  61.6    9e-08   Brachypodium distachyon [annual false brome]
ref|XP_003572559.1|  PREDICTED: uncharacterized protein LOC100830...  61.6    1e-07   Brachypodium distachyon [annual false brome]
ref|XP_004955692.1|  PREDICTED: uncharacterized protein LOC101784911  61.2    1e-07   Setaria italica
ref|XP_003592939.1|  PHD finger protein 21A                           60.8    1e-07   
gb|KHG04639.1|  snRNA-activating complex subunit 4                    60.5    2e-07   Gossypium arboreum [tree cotton]
ref|XP_007202189.1|  hypothetical protein PRUPE_ppa026014mg           60.1    3e-07   
ref|XP_006391192.1|  hypothetical protein EUTSA_v10019541mg           59.3    3e-07   
ref|XP_009111172.1|  PREDICTED: uncharacterized protein LOC103836634  59.3    4e-07   Brassica rapa
ref|NP_001065819.1|  Os11g0160700                                     59.7    4e-07   
ref|XP_002452154.1|  hypothetical protein SORBIDRAFT_04g020760        59.7    4e-07   Sorghum bicolor [broomcorn]
gb|EEC67726.1|  hypothetical protein OsI_35213                        59.7    4e-07   Oryza sativa Indica Group [Indian rice]
gb|AAX95463.1|  hypothetical protein                                  59.3    5e-07   Oryza sativa Japonica Group [Japonica rice]
dbj|BAH30361.1|  hypothetical protein                                 58.2    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176970.1|  RING/FYVE/PHD zinc finger protein                   58.5    7e-07   
ref|XP_006307652.1|  hypothetical protein CARUB_v10009280mg           58.5    7e-07   Capsella rubella
gb|AFW66932.1|  hypothetical protein ZEAMMB73_241747                  58.9    8e-07   
ref|XP_008644322.1|  PREDICTED: uncharacterized protein LOC103625...  58.9    8e-07   Zea mays [maize]
ref|XP_008644326.1|  PREDICTED: uncharacterized protein LOC103625...  58.9    8e-07   Zea mays [maize]
ref|XP_008644324.1|  PREDICTED: uncharacterized protein LOC103625...  58.5    9e-07   Zea mays [maize]
ref|XP_008644320.1|  PREDICTED: uncharacterized protein LOC103625...  58.5    9e-07   Zea mays [maize]
gb|AFW66933.1|  hypothetical protein ZEAMMB73_241747                  58.5    9e-07   
gb|KFK24460.1|  hypothetical protein AALP_AAs46367U000300             58.5    1e-06   Arabis alpina [alpine rockcress]
ref|XP_002454834.1|  hypothetical protein SORBIDRAFT_04g038230        58.2    1e-06   Sorghum bicolor [broomcorn]
ref|XP_008645114.1|  PREDICTED: uncharacterized protein LOC103626...  58.2    1e-06   
ref|XP_010474585.1|  PREDICTED: hsp70-Hsp90 organizing protein 2-...  56.6    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008645115.1|  PREDICTED: uncharacterized protein LOC103626...  58.2    1e-06   
ref|XP_008645113.1|  PREDICTED: uncharacterized protein LOC103626...  57.8    2e-06   
gb|AFW69604.1|  putative homeodomain-like transcription factor su...  57.8    2e-06   
ref|XP_010496532.1|  PREDICTED: uncharacterized protein LOC104773...  57.4    2e-06   Camelina sativa [gold-of-pleasure]
gb|AFW69603.1|  putative homeodomain-like transcription factor su...  57.8    2e-06   
ref|XP_010496518.1|  PREDICTED: uncharacterized protein LOC104773...  57.0    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010458992.1|  PREDICTED: uncharacterized protein LOC104740...  57.0    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010458995.1|  PREDICTED: uncharacterized protein LOC104740...  56.6    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006283306.1|  hypothetical protein CARUB_v10004342mg           56.6    3e-06   Capsella rubella
ref|XP_006283305.1|  hypothetical protein CARUB_v10004342mg           56.6    3e-06   
ref|XP_006395961.1|  hypothetical protein EUTSA_v10003829mg           56.6    3e-06   Eutrema salsugineum [saltwater cress]
gb|EYU23569.1|  hypothetical protein MIMGU_mgv1a003817mg              56.6    4e-06   Erythranthe guttata [common monkey flower]
ref|XP_010476548.1|  PREDICTED: uncharacterized protein LOC104755783  56.2    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009340161.1|  PREDICTED: uncharacterized protein LOC103932322  55.8    7e-06   
emb|CDY33345.1|  BnaC05g12380D                                        55.1    8e-06   Brassica napus [oilseed rape]
ref|XP_009334961.1|  PREDICTED: uncharacterized protein LOC103927742  55.8    8e-06   Pyrus x bretschneideri [bai li]
ref|XP_002451340.1|  hypothetical protein SORBIDRAFT_04g000347        54.7    2e-05   
emb|CDY35078.1|  BnaA06g10880D                                        54.3    2e-05   Brassica napus [oilseed rape]
ref|XP_009149315.1|  PREDICTED: uncharacterized protein LOC103872635  53.9    2e-05   Brassica rapa
dbj|BAJ93867.1|  predicted protein                                    54.3    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008644308.1|  PREDICTED: uncharacterized protein LOC103625...  53.5    4e-05   Zea mays [maize]
ref|XP_008644307.1|  PREDICTED: uncharacterized protein LOC103625...  53.5    5e-05   Zea mays [maize]
ref|XP_010930008.1|  PREDICTED: uncharacterized protein LOC105051332  52.0    1e-04   
ref|XP_003561334.1|  PREDICTED: uncharacterized protein LOC100826621  51.2    3e-04   Brachypodium distachyon [annual false brome]
ref|XP_007049460.1|  Uncharacterized protein isoform 4                50.1    6e-04   
gb|EMT02974.1|  hypothetical protein F775_18538                       49.7    0.001   



>ref|XP_004243220.1| PREDICTED: uncharacterized protein LOC101252503 [Solanum lycopersicum]
Length=402

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E    CIKCD+GG+VLVC+DS CPI VH  CMGCP +FDD G FYCPYCLYRQ+ A  
Sbjct  21   WKE---ICIKCDKGGEVLVCADSCCPIAVHISCMGCPARFDDLGKFYCPYCLYRQSIARF  77

Query  437  LKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEERAGFLQSKCNK  613
             +A+   + KKQAL  F+D E+    + V   + KS  +R+D+  PE+++  L+S C++
Sbjct  78   HQAKGYVLSKKQALDDFIDKEIIDKVREVPSILSKSTRERSDEPLPEKKSDVLESNCDQ  136



>ref|XP_006366758.1| PREDICTED: uncharacterized protein LOC102601593 isoform X1 [Solanum 
tuberosum]
 ref|XP_006366759.1| PREDICTED: uncharacterized protein LOC102601593 isoform X2 [Solanum 
tuberosum]
 ref|XP_006366760.1| PREDICTED: uncharacterized protein LOC102601593 isoform X3 [Solanum 
tuberosum]
 ref|XP_006366761.1| PREDICTED: uncharacterized protein LOC102601593 isoform X4 [Solanum 
tuberosum]
Length=386

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = +2

Query  260  PEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESL  439
            P    FCIKCD+GG+VLVC+DS CPI VH  CMGCP +FDD G FYCPYCLY+Q+ A   
Sbjct  3    PSGKEFCIKCDKGGEVLVCADSCCPIAVHVRCMGCPARFDDLGKFYCPYCLYKQSIARFH  62

Query  440  KAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEERAGFLQSKCNK  613
            +A+   + KKQAL  F+D E+    + V   + KS  +R+D+  PE+++   +S C++
Sbjct  63   QAKVYVLSKKQALDDFIDQEMIGKVREVPLMVSKSTRERSDEPLPEKKSDVPESNCDQ  120



>ref|XP_009801592.1| PREDICTED: uncharacterized protein LOC104247318 isoform X2 [Nicotiana 
sylvestris]
Length=352

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            MG P +   CIKC++GG+VL C+D  CPI VH  CMGCP +FDD G FYCPYCLY++  A
Sbjct  1    MG-PSEKEICIKCEKGGEVLACADIYCPIAVHVRCMGCPARFDDLGKFYCPYCLYKKTIA  59

Query  431  ESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEERAGFLQSKCN  610
            +  +A+E  + KKQAL  F+D E+    + V   + KS  +RA +  PE ++   QS C+
Sbjct  60   KIYQAKEHVLSKKQALHAFIDKEMIDSVRHVPSIVSKSTCERAVEPLPENKSEVPQSNCD  119

Query  611  K  613
            +
Sbjct  120  Q  120



>ref|XP_009801590.1| PREDICTED: uncharacterized protein LOC104247318 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009801591.1| PREDICTED: uncharacterized protein LOC104247318 isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            MG P +   CIKC++GG+VL C+D  CPI VH  CMGCP +FDD G FYCPYCLY++  A
Sbjct  1    MG-PSEKEICIKCEKGGEVLACADIYCPIAVHVRCMGCPARFDDLGKFYCPYCLYKKTIA  59

Query  431  ESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEERAGFLQSKCN  610
            +  +A+E  + KKQAL  F+D E+    + V   + KS  +RA +  PE ++   QS C+
Sbjct  60   KIYQAKEHVLSKKQALHAFIDKEMIDSVRHVPSIVSKSTCERAVEPLPENKSEVPQSNCD  119

Query  611  K  613
            +
Sbjct  120  Q  120



>ref|XP_009597431.1| PREDICTED: uncharacterized protein LOC104093402 [Nicotiana tomentosiformis]
Length=384

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            MG P +   CIKC++GG+VL C+D  CPI VH  CMGCP +FDD G FYCPYCLYR++ A
Sbjct  1    MG-PSEKEICIKCEKGGEVLACADIYCPIAVHVRCMGCPARFDDLGKFYCPYCLYRKSVA  59

Query  431  ESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEERAGFLQSKCN  610
            +  +A+E  + KKQAL  F+D E+    + V   + KS  +RA +  PE ++   QS C+
Sbjct  60   KFNQAKEHVLSKKQALHAFIDKEMIDNVREVPSIVCKSTCERAVEPLPENKSEVPQSNCD  119

Query  611  K  613
            +
Sbjct  120  Q  120



>ref|XP_011082888.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082889.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082890.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082891.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082892.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082893.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
Length=385

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC+ GG +LVCS++ CP+ +HE CMGCP +FDD G FYCPYCLY+QA AES +ARE 
Sbjct  8    LCIKCNEGGNLLVCSENGCPLAIHEGCMGCPARFDDAGRFYCPYCLYKQAVAESRQAREY  67

Query  455  AMLKKQALSRFLDNEV  502
            A+ +K+AL  F+D E+
Sbjct  68   ALARKKALLIFMDEEM  83



>gb|EYU34385.1| hypothetical protein MIMGU_mgv1a008782mg [Erythranthe guttata]
Length=362

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            M W EK   CIKC++   +L+CS++ CP+ +HE CMGC  +FDD G+FYCPYCLY++A A
Sbjct  1    MDWSEKN-LCIKCNKADNLLICSENGCPLAMHEACMGCRARFDDAGDFYCPYCLYKKAVA  59

Query  431  ESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMG  538
            E  +ARE A+ +K+ALS F+D  V   ++ +Q + G
Sbjct  60   ELRQAREYALERKKALSLFMDINVGANERRLQENKG  95



>ref|XP_010657505.1| PREDICTED: uncharacterized protein LOC104880931 [Vitis vinifera]
 ref|XP_010657506.1| PREDICTED: uncharacterized protein LOC104880931 [Vitis vinifera]
Length=546

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (65%), Gaps = 4/110 (4%)
 Frame = +2

Query  248  EMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQAN  427
            E+ W ++   CIKC  GG+VLVCSD  C + VHE+CM C   FDD G+FYCPYC YR A 
Sbjct  103  EIEWTQQSK-CIKCGEGGEVLVCSDRVCRLAVHEKCMNCSAAFDDMGDFYCPYCWYRCAI  161

Query  428  AESLKAREDAMLKKQALSRFLDNEVTIGDKL---VQPSMGKSPSKRADKS  568
            A+S +AR+ AM  K+ALS FLD +   G++     + S GK P   +++S
Sbjct  162  AKSNEARKRAMSSKKALSTFLDTKALCGNQQKEKTKSSNGKKPPSTSERS  211



>emb|CBI28490.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (65%), Gaps = 4/110 (4%)
 Frame = +2

Query  248  EMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQAN  427
            E+ W ++   CIKC  GG+VLVCSD  C + VHE+CM C   FDD G+FYCPYC YR A 
Sbjct  123  EIEWTQQSK-CIKCGEGGEVLVCSDRVCRLAVHEKCMNCSAAFDDMGDFYCPYCWYRCAI  181

Query  428  AESLKAREDAMLKKQALSRFLDNEVTIGDKL---VQPSMGKSPSKRADKS  568
            A+S +AR+ AM  K+ALS FLD +   G++     + S GK P   +++S
Sbjct  182  AKSNEARKRAMSSKKALSTFLDTKALCGNQQKEKTKSSNGKKPPSTSERS  231



>ref|XP_010252969.1| PREDICTED: uncharacterized protein LOC104594379 isoform X1 [Nelumbo 
nucifera]
Length=846

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            G C+KC  GG+VL+CS ++CP+VVHE C+G P  FD+ GNFYCP+CLY+    E  + ++
Sbjct  292  GVCLKCAEGGQVLMCSSNDCPVVVHENCLGYPANFDNIGNFYCPFCLYKHVTVEFNEIKK  351

Query  452  DAMLKKQALSRFLDNEVTI  508
               L K+AL RFL   +++
Sbjct  352  KVYLAKKALCRFLGTNLSV  370



>ref|XP_010252970.1| PREDICTED: uncharacterized protein LOC104594379 isoform X2 [Nelumbo 
nucifera]
Length=843

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            G C+KC  GG+VL+CS ++CP+VVHE C+G P  FD+ GNFYCP+CLY+    E  + ++
Sbjct  292  GVCLKCAEGGQVLMCSSNDCPVVVHENCLGYPANFDNIGNFYCPFCLYKHVTVEFNEIKK  351

Query  452  DAMLKKQALSRFLDNEVTI  508
               L K+AL RFL   +++
Sbjct  352  KVYLAKKALCRFLGTNLSV  370



>ref|XP_010252973.1| PREDICTED: uncharacterized protein LOC104594379 isoform X5 [Nelumbo 
nucifera]
Length=751

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            G C+KC  GG+VL+CS ++CP+VVHE C+G P  FD+ GNFYCP+CLY+    E  + ++
Sbjct  292  GVCLKCAEGGQVLMCSSNDCPVVVHENCLGYPANFDNIGNFYCPFCLYKHVTVEFNEIKK  351

Query  452  DAMLKKQALSRFLDNEVTI  508
               L K+AL RFL   +++
Sbjct  352  KVYLAKKALCRFLGTNLSV  370



>ref|XP_010252972.1| PREDICTED: uncharacterized protein LOC104594379 isoform X4 [Nelumbo 
nucifera]
Length=813

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            G C+KC  GG+VL+CS ++CP+VVHE C+G P  FD+ GNFYCP+CLY+    E  + ++
Sbjct  292  GVCLKCAEGGQVLMCSSNDCPVVVHENCLGYPANFDNIGNFYCPFCLYKHVTVEFNEIKK  351

Query  452  DAMLKKQALSRFLDNEVTI  508
               L K+AL RFL   +++
Sbjct  352  KVYLAKKALCRFLGTNLSV  370



>ref|XP_010653800.1| PREDICTED: uncharacterized protein LOC100852566 [Vitis vinifera]
 emb|CBI29873.3| unnamed protein product [Vitis vinifera]
Length=774

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+   C+KC + G++LVCS S CP+VVHE C+GCP  FD+ GNFYCP+C Y +A +E
Sbjct  501  GWTEQN-LCMKCTKDGQLLVCSSSGCPLVVHENCLGCPPSFDNMGNFYCPFCAYSRAVSE  559

Query  434  SLKAREDAMLKKQALSRFLD  493
             L++++   L K+ L+ F++
Sbjct  560  YLESKKKVSLAKKELASFIN  579



>emb|CAN80644.1| hypothetical protein VITISV_016915 [Vitis vinifera]
Length=774

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+   C+KC + G++LVCS S CP+VVHE C+GCP  FD+ GNFYCP+C Y +A +E
Sbjct  501  GWTEQN-LCMKCTKDGQLLVCSSSGCPLVVHENCLGCPPSFDNMGNFYCPFCAYSRAVSE  559

Query  434  SLKAREDAMLKKQALSRFLD  493
             L++++   L K+ L+ F++
Sbjct  560  YLESKKKVSLAKKELASFIN  579



>ref|XP_010252971.1| PREDICTED: uncharacterized protein LOC104594379 isoform X3 [Nelumbo 
nucifera]
Length=815

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            G C+KC  GG+VL+CS ++CP+VVHE C+G P  FD+ GNFYCP+CLY+    E  + ++
Sbjct  292  GVCLKCAEGGQVLMCSSNDCPVVVHENCLGYPANFDNIGNFYCPFCLYKHVTVEFNEIKK  351

Query  452  DAMLKKQALSRFLDNEVTI  508
               L K+AL RFL   +++
Sbjct  352  KVYLAKKALCRFLGTNLSV  370



>ref|XP_007028830.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY09332.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=763

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+  FC+KC++ G+VLVCS S CP+VVHE C+G P +FDD+GNFYCP+C+   +  +
Sbjct  428  GWTEQK-FCVKCNKNGQVLVCSSSGCPLVVHESCLGSPARFDDKGNFYCPFCVCSVSITK  486

Query  434  SLKAREDAMLKKQALSRFLDN  496
             L+A++   L ++ L  FL++
Sbjct  487  YLEAKDKTSLARKELDAFLEH  507



>ref|XP_007028829.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY09331.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=841

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+  FC+KC++ G+VLVCS S CP+VVHE C+G P +FDD+GNFYCP+C+   +  +
Sbjct  506  GWTEQK-FCVKCNKNGQVLVCSSSGCPLVVHESCLGSPARFDDKGNFYCPFCVCSVSITK  564

Query  434  SLKAREDAMLKKQALSRFLDN  496
             L+A++   L ++ L  FL++
Sbjct  565  YLEAKDKTSLARKELDAFLEH  585



>gb|KCW47629.1| hypothetical protein EUGRSUZ_K01371 [Eucalyptus grandis]
Length=485

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C+ C+  G++LVCS+ +CPI +HE+C+ C  +FD  GNFYCPYC Y++  A+  + R  A
Sbjct  96   CLTCNGHGQLLVCSEPSCPIAIHEKCLSCKPQFDHLGNFYCPYCSYKRVVAKVHELRRKA  155

Query  458  MLKKQALSRFLDNEVT  505
            ML+K+ALS FLDN V 
Sbjct  156  MLRKEALSNFLDNGVV  171



>ref|XP_010036112.1| PREDICTED: uncharacterized protein LOC104425191 [Eucalyptus grandis]
 gb|KCW47628.1| hypothetical protein EUGRSUZ_K01371 [Eucalyptus grandis]
Length=492

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C+ C+  G++LVCS+ +CPI +HE+C+ C  +FD  GNFYCPYC Y++  A+  + R  A
Sbjct  103  CLTCNGHGQLLVCSEPSCPIAIHEKCLSCKPQFDHLGNFYCPYCSYKRVVAKVHELRRKA  162

Query  458  MLKKQALSRFLDNEVT  505
            ML+K+ALS FLDN V 
Sbjct  163  MLRKEALSNFLDNGVV  178



>ref|XP_003601481.1| hypothetical protein MTR_3g082160 [Medicago truncatula]
Length=351

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +2

Query  272  GFCIKCDR-GGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAR  448
              CI C++ GG++LVCS ++CP+ VH  C+G   KFDD GNF+CPYC Y++A  ++ + R
Sbjct  71   NICITCNKLGGELLVCSQTDCPVSVHVTCIGSEPKFDDSGNFFCPYCAYKRALKKTRELR  130

Query  449  EDAMLKKQALSRFLDNEVTI  508
            E A+L K+ALS FL+   T+
Sbjct  131  EKAVLAKKALSSFLEKHQTV  150



>gb|AES71732.2| myb-like DNA-binding domain protein [Medicago truncatula]
Length=353

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +2

Query  272  GFCIKCDR-GGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAR  448
              CI C++ GG++LVCS ++CP+ VH  C+G   KFDD GNF+CPYC Y++A  ++ + R
Sbjct  71   NICITCNKLGGELLVCSQTDCPVSVHVTCIGSEPKFDDSGNFFCPYCAYKRALKKTRELR  130

Query  449  EDAMLKKQALSRFLDNEVTI  508
            E A+L K+ALS FL+   T+
Sbjct  131  EKAVLAKKALSSFLEKHQTV  150



>gb|KDO45394.1| hypothetical protein CISIN_1g0037502mg [Citrus sinensis]
Length=707

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+   C+KC++ G++L CS S CP+ VHE C+G PVKFD++GNF+CP+C Y  + +E
Sbjct  329  GWTEQN-LCVKCNKDGQLLSCSSSTCPLAVHENCLGFPVKFDEKGNFHCPFCAYTLSISE  387

Query  434  SLKAREDAMLKKQALSRFLD-----NEVTIGDKLVQPSMGKSPS  550
             L+A++ A + ++ L+ F+      +++ + +KL     G S S
Sbjct  388  YLEAKKRASVARKELAAFMQMGSVCHQMDLANKLHSKDPGHSGS  431



>gb|KDO45393.1| hypothetical protein CISIN_1g0037502mg [Citrus sinensis]
Length=798

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+   C+KC++ G++L CS S CP+ VHE C+G PVKFD++GNF+CP+C Y  + +E
Sbjct  420  GWTEQN-LCVKCNKDGQLLSCSSSTCPLAVHENCLGFPVKFDEKGNFHCPFCAYTLSISE  478

Query  434  SLKAREDAMLKKQALSRFLD-----NEVTIGDKLVQPSMGKSPS  550
             L+A++ A + ++ L+ F+      +++ + +KL     G S S
Sbjct  479  YLEAKKRASVARKELAAFMQMGSVCHQMDLANKLHSKDPGHSGS  522



>ref|XP_006421445.1| hypothetical protein CICLE_v10004349mg [Citrus clementina]
 gb|ESR34685.1| hypothetical protein CICLE_v10004349mg [Citrus clementina]
Length=798

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+   C+KC++ G++L CS S CP+ VHE C+G PVKFD++GNF+CP+C Y  + +E
Sbjct  420  GWTEQN-LCVKCNKDGQLLSCSSSTCPLAVHENCLGFPVKFDEKGNFHCPFCAYTLSISE  478

Query  434  SLKAREDAMLKKQALSRFLD-----NEVTIGDKLVQPSMGKSPS  550
             L+A++ A + ++ L+ F+      +++ + +KL     G S S
Sbjct  479  YLEAKKRASVARKELAAFMQMGSVCHQMDLANKLHSKDPGHSGS  522



>ref|XP_006493907.1| PREDICTED: uncharacterized protein LOC102627827 isoform X2 [Citrus 
sinensis]
Length=772

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+   C+KC++ G++L CS S CP+ VHE C+G PVKFD++GNF+CP+C Y  + +E
Sbjct  420  GWTEQN-LCVKCNKDGQLLSCSSSTCPLAVHENCLGFPVKFDEKGNFHCPFCAYTLSISE  478

Query  434  SLKAREDAMLKKQALSRFL  490
             L+A++ A + ++ L+ F+
Sbjct  479  YLEAKKRASVARKELAAFM  497



>ref|XP_006493906.1| PREDICTED: uncharacterized protein LOC102627827 isoform X1 [Citrus 
sinensis]
Length=798

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +2

Query  254  GWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
            GW E+   C+KC++ G++L CS S CP+ VHE C+G PVKFD++GNF+CP+C Y  + +E
Sbjct  420  GWTEQN-LCVKCNKDGQLLSCSSSTCPLAVHENCLGFPVKFDEKGNFHCPFCAYTLSISE  478

Query  434  SLKAREDAMLKKQALSRFL  490
             L+A++ A + ++ L+ F+
Sbjct  479  YLEAKKRASVARKELAAFM  497



>ref|XP_004144625.1| PREDICTED: uncharacterized protein LOC101213119 [Cucumis sativus]
 ref|XP_004167056.1| PREDICTED: uncharacterized LOC101213119 [Cucumis sativus]
 gb|KGN43387.1| hypothetical protein Csa_7G030500 [Cucumis sativus]
Length=510

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C +CD  G +LVC++  CPI +HE CM C   FD+ G FYCPYC Y++A     + R   
Sbjct  66   CTRCDESGDLLVCTEPGCPIALHELCMSCEPSFDEDGRFYCPYCSYKRALIRVNELRRKT  125

Query  458  MLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSS  571
            M+ K+ALS F+D  +  GD    P MG++  K++D  S
Sbjct  126  MVAKRALSDFIDTRMVGGDN--SPRMGEAGKKKSDDVS  161



>ref|XP_008462017.1| PREDICTED: uncharacterized protein LOC103500488 isoform X2 [Cucumis 
melo]
Length=488

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 4/119 (3%)
 Frame = +2

Query  221  EISNRENNKEMGWPE--KGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNF  394
            E SN+E N  +   +  +   C +CD+ G +LVC++  CPI +HE CM C   FD+ G F
Sbjct  35   EASNKETNDVLDKIDCFQKDSCTRCDQSGDLLVCTEPGCPIALHELCMSCEPSFDEDGRF  94

Query  395  YCPYCLYRQANAESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSS  571
            YCPYC Y++A     + R   M+ K+ALS F+D  +  G     P MG++  K++D  S
Sbjct  95   YCPYCSYKRALIRVNELRRKTMVAKRALSDFIDTRMVGGGN--SPRMGEAGKKKSDDIS  151



>ref|XP_008462016.1| PREDICTED: uncharacterized protein LOC103500488 isoform X1 [Cucumis 
melo]
Length=499

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 4/119 (3%)
 Frame = +2

Query  221  EISNRENNKEMGWPE--KGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNF  394
            E SN+E N  +   +  +   C +CD+ G +LVC++  CPI +HE CM C   FD+ G F
Sbjct  46   EASNKETNDVLDKIDCFQKDSCTRCDQSGDLLVCTEPGCPIALHELCMSCEPSFDEDGRF  105

Query  395  YCPYCLYRQANAESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSS  571
            YCPYC Y++A     + R   M+ K+ALS F+D  +  G     P MG++  K++D  S
Sbjct  106  YCPYCSYKRALIRVNELRRKTMVAKRALSDFIDTRMVGGGN--SPRMGEAGKKKSDDIS  162



>ref|XP_007017102.1| RING/FYVE/PHD zinc finger superfamily protein, putative [Theobroma 
cacao]
 gb|EOY34721.1| RING/FYVE/PHD zinc finger superfamily protein, putative [Theobroma 
cacao]
Length=565

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+   C KC + G+VLVCS ++CPIVVHE C G P +FDD+GNF CPYC Y  + ++ 
Sbjct  405  WIEQN-LCFKCTKSGRVLVCSSNDCPIVVHESCFGTPARFDDKGNFRCPYCAYSVSISQY  463

Query  437  LKAREDAMLKKQALSRFLD  493
            L+A+    L ++ L  F++
Sbjct  464  LEAKGKVTLAREELCAFME  482



>ref|XP_009623203.1| PREDICTED: uncharacterized protein LOC104114449 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009623204.1| PREDICTED: uncharacterized protein LOC104114449 isoform X3 [Nicotiana 
tomentosiformis]
Length=707

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++LVCS  +CP+VVH  C+G    FD+ GNFYCP+C Y QA +E L+ ++ 
Sbjct  454  LCVKCNEGGQLLVCSSGSCPLVVHHSCLGSVPSFDNEGNFYCPFCAYSQAISEYLEGKKM  513

Query  455  AMLKKQALSRFL  490
            A L ++ L+ FL
Sbjct  514  ASLARKDLASFL  525



>ref|XP_002526722.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35636.1| conserved hypothetical protein [Ricinus communis]
Length=814

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E    C++C + G++LVC+   CP VVHE+C+GC  KFD++GNFYCP+C Y  A ++ 
Sbjct  463  WTELN-LCVQCSKDGQLLVCNAVGCPFVVHEKCLGCSPKFDEKGNFYCPFCAYSYAISKY  521

Query  437  LKAREDAMLKKQALSRFL  490
            L+A++ A L ++ LS F+
Sbjct  522  LEAKKTATLARKELSAFI  539



>ref|XP_009623199.1| PREDICTED: uncharacterized protein LOC104114449 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009623200.1| PREDICTED: uncharacterized protein LOC104114449 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009623201.1| PREDICTED: uncharacterized protein LOC104114449 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009623202.1| PREDICTED: uncharacterized protein LOC104114449 isoform X1 [Nicotiana 
tomentosiformis]
Length=721

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++LVCS  +CP+VVH  C+G    FD+ GNFYCP+C Y QA +E L+ ++ 
Sbjct  454  LCVKCNEGGQLLVCSSGSCPLVVHHSCLGSVPSFDNEGNFYCPFCAYSQAISEYLEGKKM  513

Query  455  AMLKKQALSRFL  490
            A L ++ L+ FL
Sbjct  514  ASLARKDLASFL  525



>ref|XP_009785578.1| PREDICTED: uncharacterized protein LOC104233822 isoform X3 [Nicotiana 
sylvestris]
Length=707

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++LVCS  +CP+VVH+ C+G    FD+ GNFYCP+C Y QA +E L+ ++ 
Sbjct  454  LCVKCNEGGQLLVCSSGSCPLVVHQSCLGSVPSFDNEGNFYCPFCAYSQAISEYLEGQKM  513

Query  455  AMLKKQALSRFL  490
            A L ++ L+ F+
Sbjct  514  ASLARKDLASFV  525



>ref|XP_009785577.1| PREDICTED: uncharacterized protein LOC104233822 isoform X2 [Nicotiana 
sylvestris]
Length=721

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++LVCS  +CP+VVH+ C+G    FD+ GNFYCP+C Y QA +E L+ ++ 
Sbjct  454  LCVKCNEGGQLLVCSSGSCPLVVHQSCLGSVPSFDNEGNFYCPFCAYSQAISEYLEGQKM  513

Query  455  AMLKKQALSRFL  490
            A L ++ L+ F+
Sbjct  514  ASLARKDLASFV  525



>ref|XP_009785576.1| PREDICTED: uncharacterized protein LOC104233822 isoform X1 [Nicotiana 
sylvestris]
Length=792

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++LVCS  +CP+VVH+ C+G    FD+ GNFYCP+C Y QA +E L+ ++ 
Sbjct  454  LCVKCNEGGQLLVCSSGSCPLVVHQSCLGSVPSFDNEGNFYCPFCAYSQAISEYLEGQKM  513

Query  455  AMLKKQALSRFL  490
            A L ++ L+ F+
Sbjct  514  ASLARKDLASFV  525



>ref|XP_004502096.1| PREDICTED: uncharacterized protein LOC101494287 isoform X1 [Cicer 
arietinum]
Length=347

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +2

Query  278  CIKCDR-GGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
            CI C++ GG +LVC+ ++CP+ VH  C+G   KFD  G FYCPYC Y++A  +S + RE 
Sbjct  71   CITCNQSGGPLLVCAQTDCPVTVHVTCIGSEPKFDYSGKFYCPYCSYKRALNKSRELREK  130

Query  455  AMLKKQALSRFLDNEVTI-GDKLVQP  529
             +L K+ALS FL+ + T+  DK  QP
Sbjct  131  VILAKKALSSFLEKDQTLRKDKDHQP  156



>ref|XP_004502097.1| PREDICTED: uncharacterized protein LOC101494287 isoform X2 [Cicer 
arietinum]
Length=343

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +2

Query  278  CIKCDR-GGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
            CI C++ GG +LVC+ ++CP+ VH  C+G   KFD  G FYCPYC Y++A  +S + RE 
Sbjct  71   CITCNQSGGPLLVCAQTDCPVTVHVTCIGSEPKFDYSGKFYCPYCSYKRALNKSRELREK  130

Query  455  AMLKKQALSRFLDNEVTI-GDKLVQP  529
             +L K+ALS FL+ + T+  DK  QP
Sbjct  131  VILAKKALSSFLEKDQTLRKDKDHQP  156



>ref|XP_008775217.1| PREDICTED: uncharacterized protein LOC103695626, partial [Phoenix 
dactylifera]
Length=715

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +2

Query  266  KGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            K G CIKCD GG++L CS S C I VHE C+G  VKF+  G FYCP+C YR+A     KA
Sbjct  312  KQGLCIKCDNGGQLLSCSASGCSIGVHESCLGPFVKFEKTGLFYCPFCSYRRATLAYWKA  371

Query  446  REDAMLKKQALSRFLDNEVTIGDKLVQPS  532
            R++    K+ LS FL  +   G +  Q S
Sbjct  372  RKNLSWAKKGLSVFLGEDPIPGHRKEQSS  400



>gb|KDO51066.1| hypothetical protein CISIN_1g037252mg, partial [Citrus sinensis]
Length=138

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 2/82 (2%)
 Frame = +2

Query  278  CIKCDR--GGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            CIKC+R     +LVCS S CPI VHE C+ C VKFDD GNFYCPYC Y+     + + R+
Sbjct  43   CIKCNRQRDENLLVCSQSGCPISVHENCLSCGVKFDDVGNFYCPYCWYKCELMRTKELRK  102

Query  452  DAMLKKQALSRFLDNEVTIGDK  517
             A   K+ L+ F+D++   GDK
Sbjct  103  KAKETKKQLACFIDSKSFSGDK  124



>ref|XP_006493556.1| PREDICTED: uncharacterized protein LOC102610863 [Citrus sinensis]
Length=1085

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query  278  CIKCDRGGK-VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
            CIKC+R G+ +LVCS S CPI VHE C+ C VKFDD GNFYCPYC Y++    + +  + 
Sbjct  61   CIKCNRRGENLLVCSQSGCPISVHENCLSCGVKFDDVGNFYCPYCWYKRELTRTKELWKK  120

Query  455  AMLKKQALSRFLDNEVTIGDK  517
            AM  K+ L+ F+D++   GDK
Sbjct  121  AMETKKQLACFIDSKSFSGDK  141



>ref|XP_009401240.1| PREDICTED: uncharacterized protein LOC103985310 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 78/148 (53%), Gaps = 4/148 (3%)
 Frame = +2

Query  188  FCVQVVREMCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCP  367
            F  +  R + +++   +++   G  E+G  CIKCD+GG++L C  + C I VHE C+G  
Sbjct  435  FAAEKHRLLSSQVHINDDSAIGGCTEQG-LCIKCDKGGELLTCGGNGCLISVHESCLGSS  493

Query  368  VKFDDRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPS---MG  538
              FD  G FYCP+C Y +A     K +++ +  ++ LS F+      G + V PS     
Sbjct  494  PIFDTSGLFYCPFCSYTRAAISYRKVKKNFIQARRVLSEFIGGNFVRGHRKVSPSGVHKE  553

Query  539  KSPSKRADKSSPEERAGFLQSKCNKVSE  622
             + ++  D S  E  AG  Q K NK++E
Sbjct  554  TNQTRVVDNSCSEHSAGSSQCKGNKLNE  581



>ref|XP_009401239.1| PREDICTED: uncharacterized protein LOC103985310 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 78/148 (53%), Gaps = 4/148 (3%)
 Frame = +2

Query  188  FCVQVVREMCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCP  367
            F  +  R + +++   +++   G  E+G  CIKCD+GG++L C  + C I VHE C+G  
Sbjct  438  FAAEKHRLLSSQVHINDDSAIGGCTEQG-LCIKCDKGGELLTCGGNGCLISVHESCLGSS  496

Query  368  VKFDDRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPS---MG  538
              FD  G FYCP+C Y +A     K +++ +  ++ LS F+      G + V PS     
Sbjct  497  PIFDTSGLFYCPFCSYTRAAISYRKVKKNFIQARRVLSEFIGGNFVRGHRKVSPSGVHKE  556

Query  539  KSPSKRADKSSPEERAGFLQSKCNKVSE  622
             + ++  D S  E  AG  Q K NK++E
Sbjct  557  TNQTRVVDNSCSEHSAGSSQCKGNKLNE  584



>ref|XP_006349555.1| PREDICTED: uncharacterized protein LOC102593143 isoform X4 [Solanum 
tuberosum]
Length=695

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++L+CS + CP+VVH+ C+G    FD+ GNFYCP+C Y +A +E L+ ++ 
Sbjct  442  LCVKCNEGGQLLICSSNTCPLVVHQSCLGSVPSFDNGGNFYCPFCAYSRAISEYLEGKKM  501

Query  455  AMLKKQALSRFL  490
            ++L ++ L+ F+
Sbjct  502  SLLARKDLASFV  513



>ref|XP_006349554.1| PREDICTED: uncharacterized protein LOC102593143 isoform X3 [Solanum 
tuberosum]
Length=709

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++L+CS + CP+VVH+ C+G    FD+ GNFYCP+C Y +A +E L+ ++ 
Sbjct  442  LCVKCNEGGQLLICSSNTCPLVVHQSCLGSVPSFDNGGNFYCPFCAYSRAISEYLEGKKM  501

Query  455  AMLKKQALSRFL  490
            ++L ++ L+ F+
Sbjct  502  SLLARKDLASFV  513



>ref|XP_006349552.1| PREDICTED: uncharacterized protein LOC102593143 isoform X1 [Solanum 
tuberosum]
Length=748

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++L+CS + CP+VVH+ C+G    FD+ GNFYCP+C Y +A +E L+ ++ 
Sbjct  442  LCVKCNEGGQLLICSSNTCPLVVHQSCLGSVPSFDNGGNFYCPFCAYSRAISEYLEGKKM  501

Query  455  AMLKKQALSRFL  490
            ++L ++ L+ F+
Sbjct  502  SLLARKDLASFV  513



>ref|XP_006349553.1| PREDICTED: uncharacterized protein LOC102593143 isoform X2 [Solanum 
tuberosum]
Length=739

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++L+CS + CP+VVH+ C+G    FD+ GNFYCP+C Y +A +E L+ ++ 
Sbjct  442  LCVKCNEGGQLLICSSNTCPLVVHQSCLGSVPSFDNGGNFYCPFCAYSRAISEYLEGKKM  501

Query  455  AMLKKQALSRFL  490
            ++L ++ L+ F+
Sbjct  502  SLLARKDLASFV  513



>ref|XP_007049458.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007049459.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX93615.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX93616.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=487

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  278  CIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
            CI+C+ R G+VLVCS++ CP+ +HE CM C  KFD+ G FYCPYC Y++    + + R  
Sbjct  100  CIRCNSRTGQVLVCSENGCPVTIHEVCMNCNPKFDNMGKFYCPYCWYKRELVRTKELRRK  159

Query  455  AMLKKQALSRFL  490
            AML ++ LS F+
Sbjct  160  AMLARKELSNFI  171



>ref|XP_007049457.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX93614.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=502

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +2

Query  251  MGWPEKGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQAN  427
            + W E+   CI+C+ R G+VLVCS++ CP+ +HE CM C  KFD+ G FYCPYC Y++  
Sbjct  92   VDWLEQES-CIRCNSRTGQVLVCSENGCPVTIHEVCMNCNPKFDNMGKFYCPYCWYKREL  150

Query  428  AESLKAREDAMLKKQALSRFL  490
              + + R  AML ++ LS F+
Sbjct  151  VRTKELRRKAMLARKELSNFI  171



>gb|KDP30809.1| hypothetical protein JCGZ_13752 [Jatropha curcas]
Length=583

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC  GG++LVC+   CP+VVHE+C+G   +FD++G+FYCP+C Y  A +E L+A++ 
Sbjct  246  LCVKCSEGGQLLVCNAVGCPLVVHEKCLGSSPRFDEKGDFYCPFCAYSLAISEYLQAKKK  305

Query  455  AMLKKQALSRFL  490
            A L ++ L  F+
Sbjct  306  ASLARKELGAFI  317



>ref|XP_007145628.1| hypothetical protein PHAVU_007G255000g [Phaseolus vulgaris]
 gb|ESW17622.1| hypothetical protein PHAVU_007G255000g [Phaseolus vulgaris]
Length=918

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            M    K   C+KC++GG++L C  + CP++VHE+C+G  V+ D  GNF+CP+C Y +  +
Sbjct  559  MNELNKQNLCMKCNQGGQLLACKTTTCPLMVHEDCLGSSVQLDAEGNFFCPFCAYSRTIS  618

Query  431  ESLKAREDAMLKKQALSRFL  490
            E ++A+E A L ++ L+ F+
Sbjct  619  EYVEAKEKASLARKDLTIFI  638



>gb|KDP26014.1| hypothetical protein JCGZ_21047 [Jatropha curcas]
Length=931

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+   C+KC  GG++LVC+   CP+VVHE+C+G   +FD+ G FYCP+C Y  A ++ 
Sbjct  463  WTEQN-LCVKCSEGGQLLVCNAVGCPLVVHEKCLGSSPRFDENGEFYCPFCAYSLAISKY  521

Query  437  LKAREDAMLKKQALSRFL  490
            L+A+++A L ++ L  F+
Sbjct  522  LQAKKNASLARKELGAFI  539



>ref|XP_010920082.1| PREDICTED: uncharacterized protein LOC105044011 isoform X2 [Elaeis 
guineensis]
Length=798

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+G  CIKCD GG++L CS S C I VHE C+G  VK +  G FYCP+C +R+A    
Sbjct  393  WTEQG-LCIKCDNGGQLLSCSASGCSIGVHESCLGPFVKVEKTGLFYCPFCSFRRAAIAY  451

Query  437  LKAREDAMLKKQALSRFLDNEVTIGDKLVQPS  532
             KARE     K ALS FL  +   G +  Q S
Sbjct  452  CKAREKLSSAKNALSAFLGKDPIPGHRKEQSS  483



>ref|XP_010920081.1| PREDICTED: uncharacterized protein LOC105044011 isoform X1 [Elaeis 
guineensis]
Length=799

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+G  CIKCD GG++L CS S C I VHE C+G  VK +  G FYCP+C +R+A    
Sbjct  394  WTEQG-LCIKCDNGGQLLSCSASGCSIGVHESCLGPFVKVEKTGLFYCPFCSFRRAAIAY  452

Query  437  LKAREDAMLKKQALSRFLDNEVTIGDKLVQPS  532
             KARE     K ALS FL  +   G +  Q S
Sbjct  453  CKAREKLSSAKNALSAFLGKDPIPGHRKEQSS  484



>ref|XP_011087314.1| PREDICTED: uncharacterized protein LOC105168847 isoform X2 [Sesamum 
indicum]
Length=929

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC++GGK+LVCS ++CP+V+HE C G    FD +G FYCP+C Y QA ++ ++ ++ 
Sbjct  585  LCMKCNKGGKLLVCSSNSCPLVIHESCFGSDATFDTKGKFYCPFCAYSQAISKYMEVKKK  644

Query  455  AMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRA  559
              L ++  + F+         L  P   K PS+R+
Sbjct  645  VSLARKDFATFI--------CLGSPKEKKEPSQRS  671



>ref|XP_010091860.1| hypothetical protein L484_002387 [Morus notabilis]
 gb|EXB46301.1| hypothetical protein L484_002387 [Morus notabilis]
Length=922

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            + W E+   C+K +  G +LVC+ +NC +VVHE+C+G P   DD+GNFYCP+C Y  A  
Sbjct  574  VDWTEQN-LCMKFNEDGHLLVCNTNNCQLVVHEKCVGSPATLDDKGNFYCPFCAYSIAIN  632

Query  431  ESLKAREDAMLKKQALSRFL  490
            E L+A++ + L ++ L+ F+
Sbjct  633  EYLEAKKSSSLARKELAAFI  652



>ref|XP_011087312.1| PREDICTED: uncharacterized protein LOC105168847 isoform X1 [Sesamum 
indicum]
Length=943

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC++GGK+LVCS ++CP+V+HE C G    FD +G FYCP+C Y QA ++ ++ ++ 
Sbjct  599  LCMKCNKGGKLLVCSSNSCPLVIHESCFGSDATFDTKGKFYCPFCAYSQAISKYMEVKKK  658

Query  455  AMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRA  559
              L ++  + F+         L  P   K PS+R+
Sbjct  659  VSLARKDFATFI--------CLGSPKEKKEPSQRS  685



>ref|XP_009613453.1| PREDICTED: uncharacterized protein LOC104106584 isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GGK+ VCS   CP++VHE C+G    FD +GNFYCP+C Y +A +E L  ++ 
Sbjct  377  LCVKCNVGGKLFVCSSDTCPLMVHESCLGSVPNFDYKGNFYCPFCAYSRAISEYLDGKKK  436

Query  455  AMLKKQALSRFL  490
              L ++ L+ F+
Sbjct  437  VSLARKHLAAFI  448



>ref|XP_009613450.1| PREDICTED: uncharacterized protein LOC104106584 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613451.1| PREDICTED: uncharacterized protein LOC104106584 isoform X1 [Nicotiana 
tomentosiformis]
Length=822

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GGK+ VCS   CP++VHE C+G    FD +GNFYCP+C Y +A +E L  ++ 
Sbjct  497  LCVKCNVGGKLFVCSSDTCPLMVHESCLGSVPNFDYKGNFYCPFCAYSRAISEYLDGKKK  556

Query  455  AMLKKQALSRFL  490
              L ++ L+ F+
Sbjct  557  VSLARKHLAAFI  568



>ref|XP_009613452.1| PREDICTED: uncharacterized protein LOC104106584 isoform X2 [Nicotiana 
tomentosiformis]
Length=812

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GGK+ VCS   CP++VHE C+G    FD +GNFYCP+C Y +A +E L  ++ 
Sbjct  487  LCVKCNVGGKLFVCSSDTCPLMVHESCLGSVPNFDYKGNFYCPFCAYSRAISEYLDGKKK  546

Query  455  AMLKKQALSRFL  490
              L ++ L+ F+
Sbjct  547  VSLARKHLAAFI  558



>ref|XP_007210101.1| hypothetical protein PRUPE_ppa021429mg, partial [Prunus persica]
 gb|EMJ11300.1| hypothetical protein PRUPE_ppa021429mg, partial [Prunus persica]
Length=535

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +2

Query  230  NRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYC  409
            NR  +  + W E+  FC+KC+ GG++L+CS S+CP+V HE+C+G       +GNFYCP+C
Sbjct  418  NRAYSDTIDWTEEN-FCMKCNEGGQLLICSTSDCPLVYHEKCLGSEFICYKKGNFYCPFC  476

Query  410  LYRQANAESLKAREDAMLKKQALSRFL  490
             +  A  E L+A++ A L ++ L  F+
Sbjct  477  SHSLALKEYLEAKKKAFLLRKDLDAFM  503



>ref|XP_010050113.1| PREDICTED: uncharacterized protein LOC104438615 isoform X2 [Eucalyptus 
grandis]
Length=749

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            + W E+   C+KC+ GG++LVC+ S+CP++VHE C+G    FD+ G FYCP+C Y  A +
Sbjct  361  VDWSEQN-VCMKCNEGGQLLVCNTSSCPLMVHENCVGLSAMFDNNGLFYCPFCAYSIAIS  419

Query  431  ESLKAREDAMLKKQALSRFL  490
            E   A+++A   +++LS F+
Sbjct  420  EYHDAKKEASSTRKSLSAFI  439



>ref|XP_010050114.1| PREDICTED: uncharacterized protein LOC104438615 isoform X3 [Eucalyptus 
grandis]
Length=677

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            + W E+   C+KC+ GG++LVC+ S+CP++VHE C+G    FD+ G FYCP+C Y  A +
Sbjct  289  VDWSEQN-VCMKCNEGGQLLVCNTSSCPLMVHENCVGLSAMFDNNGLFYCPFCAYSIAIS  347

Query  431  ESLKAREDAMLKKQALSRFL  490
            E   A+++A   +++LS F+
Sbjct  348  EYHDAKKEASSTRKSLSAFI  367



>ref|XP_009804769.1| PREDICTED: uncharacterized protein LOC104249935 isoform X2 [Nicotiana 
sylvestris]
Length=794

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GGK+ VCS   CP+++HE C+G    FD +GNFYCP+C Y +A +E L  ++ 
Sbjct  489  LCVKCNVGGKLFVCSSDTCPLMLHESCLGSVPNFDYKGNFYCPFCAYSRAISEYLDGKKK  548

Query  455  AMLKKQALSRFL  490
              L ++ L+ F+
Sbjct  549  VSLARKHLAAFI  560



>ref|XP_009804765.1| PREDICTED: uncharacterized protein LOC104249935 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009804766.1| PREDICTED: uncharacterized protein LOC104249935 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009804767.1| PREDICTED: uncharacterized protein LOC104249935 isoform X1 [Nicotiana 
sylvestris]
Length=814

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GGK+ VCS   CP+++HE C+G    FD +GNFYCP+C Y +A +E L  ++ 
Sbjct  489  LCVKCNVGGKLFVCSSDTCPLMLHESCLGSVPNFDYKGNFYCPFCAYSRAISEYLDGKKK  548

Query  455  AMLKKQALSRFL  490
              L ++ L+ F+
Sbjct  549  VSLARKHLAAFI  560



>ref|XP_010050112.1| PREDICTED: uncharacterized protein LOC104438615 isoform X1 [Eucalyptus 
grandis]
 gb|KCW82995.1| hypothetical protein EUGRSUZ_C04382 [Eucalyptus grandis]
 gb|KCW82996.1| hypothetical protein EUGRSUZ_C04382 [Eucalyptus grandis]
Length=797

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            + W E+   C+KC+ GG++LVC+ S+CP++VHE C+G    FD+ G FYCP+C Y  A +
Sbjct  409  VDWSEQN-VCMKCNEGGQLLVCNTSSCPLMVHENCVGLSAMFDNNGLFYCPFCAYSIAIS  467

Query  431  ESLKAREDAMLKKQALSRFL  490
            E   A+++A   +++LS F+
Sbjct  468  EYHDAKKEASSTRKSLSAFI  487



>ref|XP_009804770.1| PREDICTED: uncharacterized protein LOC104249935 isoform X3 [Nicotiana 
sylvestris]
Length=695

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GGK+ VCS   CP+++HE C+G    FD +GNFYCP+C Y +A +E L  ++ 
Sbjct  370  LCVKCNVGGKLFVCSSDTCPLMLHESCLGSVPNFDYKGNFYCPFCAYSRAISEYLDGKKK  429

Query  455  AMLKKQALSRFL  490
              L ++ L+ F+
Sbjct  430  VSLARKHLAAFI  441



>ref|XP_006577901.1| PREDICTED: uncharacterized protein LOC102661885 isoform X1 [Glycine 
max]
 gb|KHN33682.1| hypothetical protein glysoja_013688 [Glycine soja]
Length=717

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
              C+KC  GG++L C  + CP++VH+ C+G   + D +GNF+CP+C Y  A +E L+++E
Sbjct  394  NLCMKCHEGGQLLACKTTTCPLMVHKNCLGASAQLDAKGNFFCPFCAYSHAISEYLESKE  453

Query  452  DAMLKKQALSRFL  490
            +A L ++ L+ F+
Sbjct  454  NASLARKELAIFI  466



>ref|XP_006577902.1| PREDICTED: uncharacterized protein LOC102661885 isoform X2 [Glycine 
max]
Length=700

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
              C+KC  GG++L C  + CP++VH+ C+G   + D +GNF+CP+C Y  A +E L+++E
Sbjct  394  NLCMKCHEGGQLLACKTTTCPLMVHKNCLGASAQLDAKGNFFCPFCAYSHAISEYLESKE  453

Query  452  DAMLKKQALSRFL  490
            +A L ++ L+ F+
Sbjct  454  NASLARKELAIFI  466



>ref|XP_010317920.1| PREDICTED: uncharacterized protein LOC104646307 isoform X2 [Solanum 
lycopersicum]
Length=689

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+  G++L+CS + CP+VVH+ C+G    +D+ GNFYCP+C Y +A +E L+ +  
Sbjct  441  LCVKCNEAGQLLICSSNTCPLVVHQSCLGSVPSYDNEGNFYCPFCAYSRAISECLEFKNM  500

Query  455  AMLKKQALSRFL  490
            ++L ++ L+ F+
Sbjct  501  SLLARKDLASFV  512



>ref|XP_010689350.1| PREDICTED: uncharacterized protein LOC104903070 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=522

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C+ C + G VLVCS+ +CPIV HE CM     FDD G F+CPYCLY+Q   E  +A+E A
Sbjct  30   CLICHKRGDVLVCSNWDCPIVAHESCMPVAAHFDDAGCFHCPYCLYKQFLVECHQAKEKA  89

Query  458  MLKKQALSRFL  490
             L  + L  FL
Sbjct  90   TLANRVLVSFL  100



>ref|XP_010317919.1| PREDICTED: uncharacterized protein LOC104646307 isoform X1 [Solanum 
lycopersicum]
Length=705

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+  G++L+CS + CP+VVH+ C+G    +D+ GNFYCP+C Y +A +E L+ +  
Sbjct  457  LCVKCNEAGQLLICSSNTCPLVVHQSCLGSVPSYDNEGNFYCPFCAYSRAISECLEFKNM  516

Query  455  AMLKKQALSRFL  490
            ++L ++ L+ F+
Sbjct  517  SLLARKDLASFV  528



>ref|XP_010689348.1| PREDICTED: uncharacterized protein LOC104903070 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=554

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C+ C + G VLVCS+ +CPIV HE CM     FDD G F+CPYCLY+Q   E  +A+E A
Sbjct  30   CLICHKRGDVLVCSNWDCPIVAHESCMPVAAHFDDAGCFHCPYCLYKQFLVECHQAKEKA  89

Query  458  MLKKQALSRFL  490
             L  + L  FL
Sbjct  90   TLANRVLVSFL  100



>ref|XP_010689347.1| PREDICTED: uncharacterized protein LOC104903070 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=555

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C+ C + G VLVCS+ +CPIV HE CM     FDD G F+CPYCLY+Q   E  +A+E A
Sbjct  30   CLICHKRGDVLVCSNWDCPIVAHESCMPVAAHFDDAGCFHCPYCLYKQFLVECHQAKEKA  89

Query  458  MLKKQALSRFL  490
             L  + L  FL
Sbjct  90   TLANRVLVSFL  100



>ref|XP_010689351.1| PREDICTED: uncharacterized protein LOC104903070 isoform X4 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010689352.1| PREDICTED: uncharacterized protein LOC104903070 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C+ C + G VLVCS+ +CPIV HE CM     FDD G F+CPYCLY+Q   E  +A+E A
Sbjct  30   CLICHKRGDVLVCSNWDCPIVAHESCMPVAAHFDDAGCFHCPYCLYKQFLVECHQAKEKA  89

Query  458  MLKKQALSRFL  490
             L  + L  FL
Sbjct  90   TLANRVLVSFL  100



>gb|KJB08733.1| hypothetical protein B456_001G100000 [Gossypium raimondii]
Length=457

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  269  GGFCIKCDRG-GKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            G +C +C+ G G+VLVCS++ CP+ +HE CM     FDD G FYCPYCLY++  A     
Sbjct  49   GEYCFECNSGSGQVLVCSENGCPVALHEACMTWRPIFDDMGKFYCPYCLYKKEVARFKDL  108

Query  446  REDAMLKKQALSRFL  490
              +AML ++ LS F+
Sbjct  109  TTEAMLARKELSNFI  123



>ref|XP_002510568.1| hypothetical protein RCOM_1598630 [Ricinus communis]
 gb|EEF52755.1| hypothetical protein RCOM_1598630 [Ricinus communis]
Length=422

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C+KC++GGK+L+C  + C I +H EC+    K+D+ GNF+CPYC Y+   A + + ++ A
Sbjct  24   CLKCNKGGKLLICCGAGCAICLHVECIPRKPKYDEEGNFHCPYCWYKLQQARAQEWKKMA  83

Query  458  MLKKQALSRFLDN-EVTIGD  514
            +L K+ALS F+D+ +V +G+
Sbjct  84   LLAKKALSDFMDSRQVEVGN  103



>gb|KJB08735.1| hypothetical protein B456_001G100000 [Gossypium raimondii]
Length=517

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  269  GGFCIKCDRG-GKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            G +C +C+ G G+VLVCS++ CP+ +HE CM     FDD G FYCPYCLY++  A     
Sbjct  109  GEYCFECNSGSGQVLVCSENGCPVALHEACMTWRPIFDDMGKFYCPYCLYKKEVARFKDL  168

Query  446  REDAMLKKQALSRFL  490
              +AML ++ LS F+
Sbjct  169  TTEAMLARKELSNFI  183



>gb|KJB08734.1| hypothetical protein B456_001G100000 [Gossypium raimondii]
Length=530

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  269  GGFCIKCDRG-GKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            G +C +C+ G G+VLVCS++ CP+ +HE CM     FDD G FYCPYCLY++  A     
Sbjct  122  GEYCFECNSGSGQVLVCSENGCPVALHEACMTWRPIFDDMGKFYCPYCLYKKEVARFKDL  181

Query  446  REDAMLKKQALSRFL  490
              +AML ++ LS F+
Sbjct  182  TTEAMLARKELSNFI  196



>ref|XP_006594392.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-79 specific-like 
isoform X1 [Glycine max]
 ref|XP_006594393.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-79 specific-like 
isoform X2 [Glycine max]
Length=451

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 72/144 (50%), Gaps = 17/144 (12%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGK------VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYR  418
            W      CI C+  G+      +L+CS   CP+ VH  C+    KFD  GNF CPYC Y+
Sbjct  30   WDAYDTICIHCNNKGEEAKEDGLLICSGRGCPVAVHATCLATGPKFDGSGNFCCPYCWYK  89

Query  419  QANAESLKAREDAMLKKQALSRFLDNE-----VTIGDKLVQPS---MGKSPSKRADKSSP  574
            +A     + RE A+  K  LSRFLDN          D +VQ S   M ++ ++   K + 
Sbjct  90   RAVDTCRRLREKALEAKGDLSRFLDNHDHARAAAHVDLVVQDSEELMEETGTQAQSKDNK  149

Query  575  EERAGFLQSKCNKVSEGMQTEREP  646
            +E     +++ N+V +  +TE EP
Sbjct  150  DEEG---EARVNQVHDREETETEP  170



>gb|KDO44064.1| hypothetical protein CISIN_1g044718mg [Citrus sinensis]
Length=236

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = +2

Query  278  CIKCDRGGK-VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
            CIKC+R  + +LVCS S C I VHE C+ C V+FDD GNFY PYC Y+     + + R+ 
Sbjct  37   CIKCNRRDENLLVCSQSGCLISVHENCLSCGVEFDDVGNFYRPYCWYKCELMRTKELRKK  96

Query  455  AMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEER  583
            AM  K+ L+ F+D++   GDK  +       ++ +  S  EER
Sbjct  97   AMETKKKLACFIDSKSFSGDKKKENCRTDKANELSISSLHEER  139



>gb|EPS72218.1| hypothetical protein M569_02550 [Genlisea aurea]
Length=326

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            CIKC++GG++L C   +CP+ +HE C+G P ++D  G FYCPYC Y+   AE  +A   A
Sbjct  9    CIKCNKGGRLLSCFTESCPLFIHEGCLGFPARYDGNGRFYCPYCAYKNTVAELRQAERFA  68

Query  458  MLKKQALSRFL  490
            +  K+ L  F+
Sbjct  69   VSCKKNLMMFM  79



>ref|XP_008229759.1| PREDICTED: uncharacterized protein LOC103329108 [Prunus mume]
Length=358

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +2

Query  278  CIKCDRGG---KVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAR  448
            C++C+ G    K+LVC++  CPI +H ECM     FD+ GNFYCPYC Y+     + K R
Sbjct  11   CVRCNGGSGNRKLLVCTEMGCPIALHAECMCAKPVFDEMGNFYCPYCAYKLKFVRTQKLR  70

Query  449  EDAMLKKQALSRFLD  493
              AM  K+ LS+F+D
Sbjct  71   RKAMASKRVLSKFID  85



>ref|XP_006364332.1| PREDICTED: uncharacterized protein LOC102590076 [Solanum tuberosum]
Length=707

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC  GG +LVCS   C +VVHE C+G    F  +G+FYCP+C Y +  +E+L+ ++ 
Sbjct  453  ICVKCHEGGNLLVCSSETCSLVVHESCLGSVFNFYYKGSFYCPFCTYSRVISENLEGKKK  512

Query  455  AMLKKQALSRFL  490
            A L K  L+ F+
Sbjct  513  ASLAKNDLTAFI  524



>ref|XP_008240243.1| PREDICTED: uncharacterized protein LOC103338770 [Prunus mume]
Length=515

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +2

Query  230  NRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYC  409
            NR  +  + W E+   C+KC+ GG++L+C  S+CP+V HE+C+G       +GNFYCP+C
Sbjct  418  NRAYSDTIDWTEEN-LCMKCNEGGQLLICGTSDCPLVYHEKCLGSEFICYKKGNFYCPFC  476

Query  410  LYRQANAESLKAREDAMLKKQALSRFL  490
             +  A  E L+A++ A L ++ L  F+
Sbjct  477  SHSLALKEYLEAKKKASLLRKDLDAFM  503



>gb|KJB42679.1| hypothetical protein B456_007G163500 [Gossypium raimondii]
Length=317

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  269  GGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            G F   C+ R G+VLVCS++ C I +H+ CM    +FDD G FYCPYC Y++  A + + 
Sbjct  204  GEFGYSCNGRSGQVLVCSENGCSISIHKMCMNIEPQFDDTGKFYCPYCWYKREVARTEEL  263

Query  446  REDAMLKKQALSRFL  490
            R+ AML K+ LS+F+
Sbjct  264  RKRAMLAKRELSKFM  278



>ref|XP_007216759.1| hypothetical protein PRUPE_ppa024791mg [Prunus persica]
 gb|EMJ17958.1| hypothetical protein PRUPE_ppa024791mg [Prunus persica]
Length=358

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +2

Query  278  CIKCDRGG---KVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAR  448
            C++C+ G    K+LVC++  CPI +H ECM     FD+ GNFYCPYC Y+     + K R
Sbjct  11   CVRCNGGSGNMKLLVCTEMGCPIALHVECMCAKPVFDEMGNFYCPYCAYKLKFVRTQKLR  70

Query  449  EDAMLKKQALSRFLD  493
              AM  K+ LS+F+D
Sbjct  71   RKAMTSKRVLSKFID  85



>gb|KJB36050.1| hypothetical protein B456_006G138200 [Gossypium raimondii]
Length=590

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+   C+KC++ G++LVC+ S C + VHE C+ CP +FDD+G+F CP+C    + +  
Sbjct  316  WTEQNS-CVKCNQNGQLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNY  374

Query  437  LKAREDAMLKKQALSRFL  490
            L+A+   +L ++ L  F+
Sbjct  375  LEAKNKIILARKKLVAFM  392



>gb|KHG06835.1| PHD finger 21B [Gossypium arboreum]
Length=685

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+   C+KC++ G++LVC+ S C + VHE C+ CP +FDD+G+F CP+C    + +  
Sbjct  428  WTEQNS-CVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNY  486

Query  437  LKAREDAMLKKQALSRFL  490
            L+A+   +L ++ L  F+
Sbjct  487  LEAKNKIILARKKLVAFM  504



>ref|XP_006351323.1| PREDICTED: uncharacterized protein LOC102589560 isoform X1 [Solanum 
tuberosum]
 ref|XP_006351324.1| PREDICTED: uncharacterized protein LOC102589560 isoform X2 [Solanum 
tuberosum]
 ref|XP_006351325.1| PREDICTED: uncharacterized protein LOC102589560 isoform X3 [Solanum 
tuberosum]
Length=869

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ G  +LVCS   C +VVHE C+G    FD +G+FYCP+C Y +A +E L+ ++ 
Sbjct  460  LCVKCNEGENLLVCSSDTCSLVVHESCLGSVPNFDYKGSFYCPFCAYSRAISEYLEGKKK  519

Query  455  AMLKKQALSRFL  490
            A L +  L+ F+
Sbjct  520  ASLARNDLAAFI  531



>gb|KJB36049.1| hypothetical protein B456_006G138200 [Gossypium raimondii]
Length=634

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+   C+KC++ G++LVC+ S C + VHE C+ CP +FDD+G+F CP+C    + +  
Sbjct  402  WTEQNS-CVKCNQNGQLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNY  460

Query  437  LKAREDAMLKKQALSRFL  490
            L+A+   +L ++ L  F+
Sbjct  461  LEAKNKIILARKKLVAFM  478



>gb|KJB36048.1| hypothetical protein B456_006G138200 [Gossypium raimondii]
Length=676

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+   C+KC++ G++LVC+ S C + VHE C+ CP +FDD+G+F CP+C    + +  
Sbjct  402  WTEQNS-CVKCNQNGQLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNY  460

Query  437  LKAREDAMLKKQALSRFL  490
            L+A+   +L ++ L  F+
Sbjct  461  LEAKNKIILARKKLVAFM  478



>ref|XP_010266411.1| PREDICTED: uncharacterized protein LOC104603935 [Nelumbo nucifera]
 ref|XP_010266413.1| PREDICTED: uncharacterized protein LOC104603935 [Nelumbo nucifera]
 ref|XP_010266414.1| PREDICTED: uncharacterized protein LOC104603935 [Nelumbo nucifera]
Length=936

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C KC+RGG++L+C  +NC + VHE C+G P  FD+ GNFYCP+C Y +A      A++  
Sbjct  557  CNKCNRGGQLLICCATNCQLAVHECCLGSPASFDNNGNFYCPFCFYAEAIVAYHDAKKKI  616

Query  458  MLKKQALSRF  487
             L +++ + F
Sbjct  617  SLARKSFAAF  626



>gb|KDO47726.1| hypothetical protein CISIN_1g041295mg [Citrus sinensis]
Length=209

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +2

Query  278  CIKCDRGGK-VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
            CIKC+R  + +LVC  S CPI VHE C+ C VK DD GN YCPY  Y+     + + R+ 
Sbjct  43   CIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKK  102

Query  455  AMLKKQALSRFLDNEVTIGDK  517
            AM  K+ L+ F+D +   GDK
Sbjct  103  AMETKKQLACFIDPKSFTGDK  123



>ref|XP_011033306.1| PREDICTED: uncharacterized protein LOC105131833 isoform X1 [Populus 
euphratica]
Length=804

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  248  EMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQAN  427
            E  W ++   CIKC + G++LVC   +C +V+HE C+     FD+RG+FYCP+C Y  A 
Sbjct  459  EGNWTDQN-LCIKCRKDGQLLVCGAGSCSLVIHENCLVFSPHFDERGDFYCPFCAYSLAI  517

Query  428  AESLKAREDAMLKKQALSRFLD  493
            +E L+A++ A   ++ L  F++
Sbjct  518  SEYLEAKKKAYSARKELKLFIE  539



>ref|XP_011033308.1| PREDICTED: uncharacterized protein LOC105131833 isoform X2 [Populus 
euphratica]
Length=736

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  248  EMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQAN  427
            E  W ++   CIKC + G++LVC   +C +V+HE C+     FD+RG+FYCP+C Y  A 
Sbjct  459  EGNWTDQN-LCIKCRKDGQLLVCGAGSCSLVIHENCLVFSPHFDERGDFYCPFCAYSLAI  517

Query  428  AESLKAREDAMLKKQALSRFLD  493
            +E L+A++ A   ++ L  F++
Sbjct  518  SEYLEAKKKAYSARKELKLFIE  539



>ref|XP_006598111.1| PREDICTED: neurofilament medium polypeptide-like [Glycine max]
Length=501

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 43/76 (57%), Gaps = 4/76 (5%)
 Frame = +2

Query  275  FCIKCDRGGK----VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
             CI CD  G+    VL+C    CP+ VH  C+G   +FDD GNF CPYC Y++A     +
Sbjct  75   ICIHCDNKGEEAEGVLICGGRGCPVAVHATCLGFEPEFDDSGNFCCPYCWYKRAVDTCRR  134

Query  443  AREDAMLKKQALSRFL  490
             RE AM  K  LSRF 
Sbjct  135  LREKAMKAKGELSRFF  150



>ref|XP_002323310.1| hypothetical protein POPTR_0016s05370g [Populus trichocarpa]
 gb|EEF05071.1| hypothetical protein POPTR_0016s05370g [Populus trichocarpa]
Length=827

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  248  EMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQAN  427
            E  W ++   CIKC + G++LVC   +C +V+HE C+     FD+RG+FYCP+C Y  A 
Sbjct  482  EANWTDQN-LCIKCCKDGQLLVCGAGSCSLVIHENCLVFSPHFDERGDFYCPFCAYSLAI  540

Query  428  AESLKAREDAMLKKQALSRFLD  493
            +E L+A++ A   ++ L  F++
Sbjct  541  SEYLEAKKKAYSARKELKLFIE  562



>ref|XP_004249272.1| PREDICTED: uncharacterized protein LOC101258507 [Solanum lycopersicum]
 ref|XP_010312131.1| PREDICTED: uncharacterized protein LOC101258507 [Solanum lycopersicum]
 ref|XP_010312132.1| PREDICTED: uncharacterized protein LOC101258507 [Solanum lycopersicum]
 ref|XP_010312133.1| PREDICTED: uncharacterized protein LOC101258507 [Solanum lycopersicum]
Length=886

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC++G  +LVCS   C +VVHE C+     FD +G+FYCP+C Y +A +E L+ ++ 
Sbjct  450  LCVKCNKGENLLVCSSDTCSLVVHESCLVSAPNFDYKGSFYCPFCAYSRAISEYLECKKK  509

Query  455  AMLKKQALSRFL  490
              L +  L+ F+
Sbjct  510  VSLARNDLAAFI  521



>ref|XP_004516069.1| PREDICTED: uncharacterized protein LOC101508857 isoform X4 [Cicer 
arietinum]
Length=832

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            M   ++   C+KC+  G++LVC  + C ++VH+ C+    + D +GNF CP+C Y    +
Sbjct  568  MAELDEQNLCMKCNEAGQLLVCKTTTCSLMVHKNCLSASAQLDAKGNFVCPFCAYSHTIS  627

Query  431  ESLKAREDAMLKKQALSRFL  490
            E L+A++ A L ++ L+ F+
Sbjct  628  EYLEAKKIASLARKELAIFI  647



>emb|CDP10065.1| unnamed protein product [Coffea canephora]
Length=897

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 4/122 (3%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            +  +  +C+KC++ G++LVCS   C + VH  C+     FD  G FYCP+C Y +A +E 
Sbjct  571  FATQAKYCVKCNKEGQLLVCSSDTCQLAVHSSCLPSAAHFDGNGKFYCPFCAYSRAISEY  630

Query  437  LKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEERAGFLQSKCNKV  616
            ++ +  A   ++ L+ F+  +     K     +G+       K+       F+    NKV
Sbjct  631  MQVKRKASFARKDLASFIGVQTVCQQKKATMKLGRESRNELQKNEGNNSEDFV----NKV  686

Query  617  SE  622
            S+
Sbjct  687  SD  688



>gb|KJB49283.1| hypothetical protein B456_008G110900 [Gossypium raimondii]
Length=280

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  260  PEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESL  439
            P K   C+KC+  GKVL+C  S+  + VH  C+G   ++DD+GNF CP+C    +N++ L
Sbjct  201  PTKQNLCVKCNLSGKVLICGSSDSAVAVHRSCLGSSARYDDKGNFLCPFCACSLSNSKYL  260

Query  440  KAREDAMLKKQALSRFLD  493
            + ++  +L ++ +   ++
Sbjct  261  EGKDRIILARKNVVALVE  278



>ref|XP_004516068.1| PREDICTED: uncharacterized protein LOC101508857 isoform X3 [Cicer 
arietinum]
Length=910

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            M   ++   C+KC+  G++LVC  + C ++VH+ C+    + D +GNF CP+C Y    +
Sbjct  563  MAELDEQNLCMKCNEAGQLLVCKTTTCSLMVHKNCLSASAQLDAKGNFVCPFCAYSHTIS  622

Query  431  ESLKAREDAMLKKQALSRFL  490
            E L+A++ A L ++ L+ F+
Sbjct  623  EYLEAKKIASLARKELAIFI  642



>ref|XP_004516066.1| PREDICTED: uncharacterized protein LOC101508857 isoform X1 [Cicer 
arietinum]
 ref|XP_004516067.1| PREDICTED: uncharacterized protein LOC101508857 isoform X2 [Cicer 
arietinum]
Length=915

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            M   ++   C+KC+  G++LVC  + C ++VH+ C+    + D +GNF CP+C Y    +
Sbjct  568  MAELDEQNLCMKCNEAGQLLVCKTTTCSLMVHKNCLSASAQLDAKGNFVCPFCAYSHTIS  627

Query  431  ESLKAREDAMLKKQALSRFL  490
            E L+A++ A L ++ L+ F+
Sbjct  628  EYLEAKKIASLARKELAIFI  647



>ref|XP_010542060.1| PREDICTED: uncharacterized protein LOC104815384 [Tarenaya hassleriana]
Length=616

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 7/89 (8%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   CI CD +  ++LVC+++ CP+ +H  CM     FD+ GNFYCPYC Y+Q   +SLK
Sbjct  77   KSDACIVCDGKDNQLLVCNETGCPVSIHHRCMPEEPDFDELGNFYCPYCWYKQLVVKSLK  136

Query  443  AREDAML------KKQALSRFLDNEVTIG  511
             +E  M+      K + +S  +D  VT+G
Sbjct  137  FQEKIMMAAEECGKARDISVGVDMAVTVG  165


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   CI CD +  ++LVC+++ CPI +H  CM     FD+ GNFYCPYC Y+Q   +SLK
Sbjct  407  KSDACIVCDGKDNQLLVCNETGCPISIHHRCMPEEPDFDELGNFYCPYCWYKQLVVKSLK  466

Query  443  AREDAML  463
             +E  M+
Sbjct  467  LQEKIMM  473



>ref|XP_010556238.1| PREDICTED: uncharacterized protein LOC104825577 [Tarenaya hassleriana]
Length=511

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C +C+ GGK+L CS+  CP+++HE+C+      DD GNFYCP C Y     E LK++   
Sbjct  423  CKQCNEGGKLLFCSNEGCPVMIHEKCLASLPAHDDDGNFYCPLCAYALVYLEYLKSKAQV  482

Query  458  MLKKQALSRFLD  493
               K  L  FL+
Sbjct  483  AEAKTKLVSFLN  494



>ref|XP_010527811.1| PREDICTED: uncharacterized protein LOC104805090 [Tarenaya hassleriana]
Length=453

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC + G +LVCS  +C + VH+EC+  PV  +++ NF+CP C Y +  +E L+++  
Sbjct  370  LCVKCGKDGTLLVCSSPDCSVKVHQECLNGPVWLNEKDNFHCPQCHYDRVTSEYLQSKNS  429

Query  455  AMLKKQALSRFLDNEVTIGDKLV  523
                K+ L  F     TI  +LV
Sbjct  430  LQAAKKNLVMFHRKVSTINKRLV  452



>gb|KHN27333.1| hypothetical protein glysoja_031941 [Glycine soja]
Length=515

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 41/76 (54%), Gaps = 4/76 (5%)
 Frame = +2

Query  275  FCIKCD----RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
             CI CD        VL+C    CP+ VH  C+G   +FDD GNF CPYC Y++A     +
Sbjct  75   ICIHCDNKREEAEGVLICGGRGCPVAVHATCLGFEPEFDDSGNFCCPYCWYKRAVDTCRR  134

Query  443  AREDAMLKKQALSRFL  490
             RE AM  K  LSRF 
Sbjct  135  LREKAMKAKGELSRFF  150



>gb|KGN59346.1| hypothetical protein Csa_3G812180 [Cucumis sativus]
Length=808

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 62/98 (63%), Gaps = 3/98 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++L C+  +CP+VVH +C+G     +D G+F CP+CLY  A +E L+A++ 
Sbjct  509  VCVKCNEGGQLLSCNIGDCPLVVHAKCLGSLAAMNDEGDFRCPFCLYSFAISEYLEAKKH  568

Query  455  AMLKKQALSRFLDNEV---TIGDKLVQPSMGKSPSKRA  559
            A L K+ ++ F  +++   +IG K V       PS+RA
Sbjct  569  AALAKKNVTSFFRSDLVHHSIGFKEVLQPKNLDPSQRA  606



>ref|XP_008443120.1| PREDICTED: uncharacterized protein LOC103486808 isoform X1 [Cucumis 
melo]
 ref|XP_008443121.1| PREDICTED: uncharacterized protein LOC103486808 isoform X1 [Cucumis 
melo]
 ref|XP_008443122.1| PREDICTED: uncharacterized protein LOC103486808 isoform X1 [Cucumis 
melo]
Length=836

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++L C+  +CP+VVH +C+G     +D  +F CP+CLY  A +E L+A++ 
Sbjct  516  VCVKCNEGGQLLSCNSGDCPLVVHAKCLGSLAAMNDESDFRCPFCLYSFAISEYLEAKKH  575

Query  455  AMLKKQALSRFLDNEV---TIGDKLVQPSMGKSPSKRA  559
            A L K+ ++ F  + +   +IG K+V       PS+RA
Sbjct  576  AALAKKNVTSFFRSALEHHSIGFKVVLQPKDLDPSRRA  613



>ref|XP_008443123.1| PREDICTED: uncharacterized protein LOC103486808 isoform X2 [Cucumis 
melo]
Length=820

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC+ GG++L C+  +CP+VVH +C+G     +D  +F CP+CLY  A +E L+A++ 
Sbjct  516  VCVKCNEGGQLLSCNSGDCPLVVHAKCLGSLAAMNDESDFRCPFCLYSFAISEYLEAKKH  575

Query  455  AMLKKQALSRFLDNEV---TIGDKLVQPSMGKSPSKRA  559
            A L K+ ++ F  + +   +IG K+V       PS+RA
Sbjct  576  AALAKKNVTSFFRSALEHHSIGFKVVLQPKDLDPSRRA  613



>ref|XP_002887160.1| hypothetical protein ARALYDRAFT_339050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63419.1| hypothetical protein ARALYDRAFT_339050 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  263  EKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            EK   C+KC   GK+L CS   C ++VH++C+  P  +DD GNFYC  C    A+AE ++
Sbjct  212  EKIYTCVKCKESGKLLFCSSDGCQVLVHQKCLDSPPAYDDAGNFYCSLCAITCASAEYVQ  271

Query  443  AREDAMLKKQALSRFL  490
            ++++    K+ L  FL
Sbjct  272  SQDEVAKAKKKLVSFL  287



>ref|XP_008357975.1| PREDICTED: trichohyalin-like [Malus domestica]
 ref|XP_008357976.1| PREDICTED: trichohyalin-like [Malus domestica]
Length=579

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 10/79 (13%)
 Frame = +2

Query  278  CIKCDRGG----KVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            C++C+ GG    K++VCS+  CPI +HEECM     FD  G FYCPYC Y++   E  + 
Sbjct  18   CVRCNDGGSGSRKLMVCSEKGCPIALHEECMCARPVFDQLGKFYCPYCAYKR---EFFRC  74

Query  446  RE---DAMLKKQALSRFLD  493
            RE     M  K  LS+F+D
Sbjct  75   RELGRKVMGSKSVLSKFID  93



>ref|XP_006392600.1| hypothetical protein EUTSA_v10011681mg [Eutrema salsugineum]
 gb|ESQ29886.1| hypothetical protein EUTSA_v10011681mg [Eutrema salsugineum]
Length=311

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = +2

Query  224  ISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCP  403
            IS  +   +M        C KC++ G +L+C  S C   VH EC+  PV  D+ GNF+CP
Sbjct  211  ISGSDEESDMVRGRAENVCWKCEKEGTLLICCRSECAARVHRECLNSPVNLDEDGNFHCP  270

Query  404  YCLYRQANAESLKAREDAMLKKQALSRFL  490
             C Y +   E L+ +E     K+ L++FL
Sbjct  271  LCWYNRVTMEYLECQELMSCAKRRLAKFL  299



>ref|XP_006663448.1| PREDICTED: uncharacterized protein LOC102714137 [Oryza brachyantha]
Length=914

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS  +C +  H+ C G  V FDD G FYCP C Y +A A   KA++ 
Sbjct  552  LCIKCAKDGQLLKCS--SCLLAAHDTCFGSSVTFDDSGQFYCPVCFYTKATAAYQKAKKT  609

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  610  YSEARKNLSSFL  621



>gb|EMS65740.1| hypothetical protein TRIUR3_19894 [Triticum urartu]
Length=1138

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = +2

Query  239  NNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYR  418
            N    G+ E+   CIKC + G++L CS  +C +V HE C G  V FD  G FYCP C Y 
Sbjct  562  NGSTQGFTEQD-LCIKCGKDGQLLKCS--SCSLVSHESCFGSSVTFDVSGQFYCPLCFYT  618

Query  419  QANAESLKAREDAMLKKQALSRFL  490
            +A+    KA++  +  ++ LS FL
Sbjct  619  KASEAYQKAKKTYLEARKNLSAFL  642



>dbj|BAJ53106.1| JHL20J20.13 [Jatropha curcas]
 gb|KDP36896.1| hypothetical protein JCGZ_08187 [Jatropha curcas]
Length=531

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  236  ENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLY  415
            E++ +  W E+   C+ C+ GG++L+CS+  CPI +H+EC+    ++D+ GNFYCPYC +
Sbjct  65   EDSSDNDWLEEKS-CLMCNMGGQLLLCSEIGCPIALHKECIVSKPRYDEEGNFYCPYCWF  123

Query  416  R  418
            +
Sbjct  124  K  124



>ref|NP_001176540.1| Os11g0482500 [Oryza sativa Japonica Group]
 dbj|BAH95268.1| Os11g0482500, partial [Oryza sativa Japonica Group]
Length=748

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS   C + VH+ C G  V FDD G FYCP C Y +A     KA++ 
Sbjct  592  LCIKCGKDGQLLKCS--GCFLAVHDTCFGSSVTFDDSGQFYCPVCFYTKATEAYQKAKKT  649

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  650  YSEARKNLSAFL  661



>gb|EAZ18368.1| hypothetical protein OsJ_33899 [Oryza sativa Japonica Group]
Length=887

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS   C + VH+ C G  V FDD G FYCP C Y +A     KA++ 
Sbjct  592  LCIKCGKDGQLLKCS--GCFLAVHDTCFGSSVTFDDSGQFYCPVCFYTKATEAYQKAKKT  649

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  650  YSEARKNLSAFL  661



>gb|ABA93678.2| expressed protein [Oryza sativa Japonica Group]
Length=756

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS   C + VH+ C G  V FDD G FYCP C Y +A     KA++ 
Sbjct  592  LCIKCGKDGQLLKCS--GCFLAVHDTCFGSSVTFDDSGQFYCPVCFYTKATEAYQKAKKT  649

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  650  YSEARKNLSAFL  661



>emb|CDY41105.1| BnaC05g10960D [Brassica napus]
Length=375

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = +2

Query  224  ISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCP  403
            ++ +  N     P     C KC + G +L+CS S C   VH+EC  C V FD+ GNF+CP
Sbjct  276  LAKKNKNIYTNLPRAENVCWKCGKEGTLLICSRSECASKVHKECSNCVVNFDEDGNFHCP  335

Query  404  YCLYRQANAESLKAREDAMLKKQALSRFL  490
             C Y    AE L++++     K+ + +F+
Sbjct  336  VCWYDGVVAEYLESQKLMSSAKRRMMKFM  364



>ref|XP_011469852.1| PREDICTED: uncharacterized protein LOC105353056 [Fragaria vesca 
subsp. vesca]
Length=939

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 3/92 (3%)
 Frame = +2

Query  281  IKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDAM  460
            + C+ GG+ L C  SNCP+VVHE  +        +GNFYCP+C Y +A    L A++   
Sbjct  698  LDCNEGGQFLTCKTSNCPVVVHENWLRSSAISYQKGNFYCPFCSYSRALTAYLDAKKKTS  757

Query  461  LKKQALSRFLDNEVTIGDKLVQPSMGKSPSKR  556
                 L+ F+     + D+L++P +GK+ SK+
Sbjct  758  QLDTGLNAFV--HAHLEDQLMEP-VGKTHSKK  786



>ref|XP_009105352.1| PREDICTED: uncharacterized protein LOC103831221 [Brassica rapa]
Length=325

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 6/100 (6%)
 Frame = +2

Query  209  EMCTEISNRENNKEMGW---PEKGGF--CIKCDRGGKVLVCSDSNCPIVVHEEC-MGCPV  370
            E+C   ++ ENN   G+   P +     CI+C++ GK+L CS   C ++VHE+C +  P 
Sbjct  214  EICRSQASLENNGSDGYVSSPLENNVYRCIQCNQSGKLLFCSRDGCTVMVHEKCVVDSPP  273

Query  371  KFDDRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
             +DD GNFYC  C     +AE L+++E+    K+ L  FL
Sbjct  274  VYDDAGNFYCSLCALGCVSAEYLQSQEEVAKAKKKLLSFL  313



>gb|EMT27515.1| Casein kinase I isoform delta-like protein [Aegilops tauschii]
Length=1300

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS  +C +V HE C G  V FD  G FYCP C Y +A+    KA++ 
Sbjct  576  LCIKCGKDGQLLKCS--SCSLVSHESCFGSSVTFDVSGQFYCPVCFYTKASEAYQKAKKT  633

Query  455  AMLKKQALSRFL  490
             +  ++ LS FL
Sbjct  634  YLEARKNLSAFL  645



>ref|XP_010511786.1| PREDICTED: uncharacterized protein LOC104787835 [Camelina sativa]
Length=321

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  263  EKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            EK   CI+C   G +L CS   C ++VHE+C+  P  +DD GNFYC  C   + +AE L+
Sbjct  227  EKIYRCIQCKESGMLLFCSKDGCEVMVHEKCLKTPPAYDDAGNFYCSLCAVTRPSAEYLQ  286

Query  443  AREDAMLKKQALSRFL  490
            ++++    ++ L  FL
Sbjct  287  SQDEVAKARKKLVSFL  302



>ref|XP_011034807.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X3 [Populus 
euphratica]
Length=476

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +2

Query  278  CIKCDRGGK--VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C+ C++ GK  +LVC    CP+ +HE+C    + FDD G F CPYC Y++    + +   
Sbjct  68   CLSCNKRGKSKLLVCCVIGCPVSIHEKCANFKLAFDDSGRFCCPYCSYKREVGRAKELFR  127

Query  452  DAMLKKQALSRFLDNEVTIGDKL  520
             AML K+AL  F+D E+  G+ +
Sbjct  128  KAMLAKKALLGFIDPEMVGGEAM  150



>ref|XP_011034806.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X2 [Populus 
euphratica]
Length=478

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +2

Query  278  CIKCDRGGK--VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C+ C++ GK  +LVC    CP+ +HE+C    + FDD G F CPYC Y++    + +   
Sbjct  68   CLSCNKRGKSKLLVCCVIGCPVSIHEKCANFKLAFDDSGRFCCPYCSYKREVGRAKELFR  127

Query  452  DAMLKKQALSRFLDNEVTIGDKL  520
             AML K+AL  F+D E+  G+ +
Sbjct  128  KAMLAKKALLGFIDPEMVGGEAM  150



>ref|XP_006857950.1| hypothetical protein AMTR_s00069p00165540 [Amborella trichopoda]
 gb|ERN19417.1| hypothetical protein AMTR_s00069p00165540 [Amborella trichopoda]
Length=840

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 19/112 (17%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C+KC  GG +LVC D  C + VHE+C+G  V  +  G FYCP+C YR+A +   +ARE+A
Sbjct  323  CLKCSEGGDMLVCGD--CSVPVHEKCLGTSVDINCEGIFYCPHCSYRRATSAYKEARENA  380

Query  458  MLKKQ-------ALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEERAGF  592
               K+       AL+ ++ N+        +P +G   S +  ++S E R G+
Sbjct  381  KKAKEKVTHARSALAAYMGNQ--------KPPVGL--SMKETQASVEARIGY  422



>ref|XP_011034809.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X5 [Populus 
euphratica]
Length=449

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +2

Query  278  CIKCDRGGK--VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C+ C++ GK  +LVC    CP+ +HE+C    + FDD G F CPYC Y++    + +   
Sbjct  68   CLSCNKRGKSKLLVCCVIGCPVSIHEKCANFKLAFDDSGRFCCPYCSYKREVGRAKELFR  127

Query  452  DAMLKKQALSRFLDNEVTIGDKL  520
             AML K+AL  F+D E+  G+ +
Sbjct  128  KAMLAKKALLGFIDPEMVGGEAM  150



>ref|XP_011034808.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X4 [Populus 
euphratica]
Length=449

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +2

Query  278  CIKCDRGGK--VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C+ C++ GK  +LVC    CP+ +HE+C    + FDD G F CPYC Y++    + +   
Sbjct  68   CLSCNKRGKSKLLVCCVIGCPVSIHEKCANFKLAFDDSGRFCCPYCSYKREVGRAKELFR  127

Query  452  DAMLKKQALSRFLDNEVTIGDKL  520
             AML K+AL  F+D E+  G+ +
Sbjct  128  KAMLAKKALLGFIDPEMVGGEAM  150



>ref|XP_011034802.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011034803.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011034805.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X1 [Populus 
euphratica]
Length=480

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +2

Query  278  CIKCDRGGK--VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C+ C++ GK  +LVC    CP+ +HE+C    + FDD G F CPYC Y++    + +   
Sbjct  68   CLSCNKRGKSKLLVCCVIGCPVSIHEKCANFKLAFDDSGRFCCPYCSYKREVGRAKELFR  127

Query  452  DAMLKKQALSRFLDNEVTIGDKL  520
             AML K+AL  F+D E+  G+ +
Sbjct  128  KAMLAKKALLGFIDPEMVGGEAM  150



>emb|CDM85276.1| unnamed protein product [Triticum aestivum]
Length=992

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS  +C +V HE C G  V FD  G FYCP C Y +A+    KA++ 
Sbjct  587  LCIKCGKDGQLLKCS--SCSLVSHESCFGSSVTFDVSGQFYCPVCFYTKASEAYQKAKKT  644

Query  455  AMLKKQALSRFL  490
             +  +++L  FL
Sbjct  645  YLEARKSLPAFL  656



>ref|XP_011034810.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X6 [Populus 
euphratica]
Length=439

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +2

Query  278  CIKCDRGGK--VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C+ C++ GK  +LVC    CP+ +HE+C    + FDD G F CPYC Y++    + +   
Sbjct  68   CLSCNKRGKSKLLVCCVIGCPVSIHEKCANFKLAFDDSGRFCCPYCSYKREVGRAKELFR  127

Query  452  DAMLKKQALSRFLDNEVTIGDKL  520
             AML K+AL  F+D E+  G+ +
Sbjct  128  KAMLAKKALLGFIDPEMVGGEAM  150



>ref|XP_004952567.1| PREDICTED: uncharacterized protein LOC101781636 [Setaria italica]
Length=931

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = +2

Query  230  NRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYC  409
            ++E N  +G  ++   CIKC + G++L CS  +C +  H+ C G  V F+D G FYCP C
Sbjct  545  DQEANDSLGVSQEQDLCIKCGKDGQLLQCS--SCLLSAHDSCFGSSVTFEDSGKFYCPVC  602

Query  410  LYRQANAESLKAREDAMLKKQALSRFLDNE  499
            +  +A     KA++  +  ++ L+ FL  E
Sbjct  603  ICTKATEAYQKAKKTYIEARKKLAAFLGTE  632



>ref|XP_011467630.1| PREDICTED: uncharacterized protein LOC101295436 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=440

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +2

Query  278  CIKCDRGG---KVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAR  448
            C++C   G   K+LVCS   C I +HEEC     + D+ G FYCPYC +++A   + K R
Sbjct  18   CLRCGGDGASMKLLVCSVIGCLIAIHEECTSSQPEIDETGKFYCPYCAHKRALVRTEKLR  77

Query  449  EDAMLKKQALSRFL-DNEVTI  508
              A+  K+ LS F+   EV+I
Sbjct  78   RKALRAKEVLSMFIMSREVSI  98



>ref|XP_002301900.2| hypothetical protein POPTR_0002s00710g [Populus trichocarpa]
 gb|EEE81173.2| hypothetical protein POPTR_0002s00710g [Populus trichocarpa]
Length=472

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +2

Query  278  CIKCDRGGK--VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C+ C++ GK  +LVC    CP+ +HE+C    + FDD G F CPYC Y++    + +   
Sbjct  68   CLSCNKRGKSKLLVCCVIGCPVSIHEKCANFKLAFDDSGRFCCPYCSYKREVGRAKELFR  127

Query  452  DAMLKKQALSRFLDNEVTIGD  514
             AML K+AL  F+D E+  G+
Sbjct  128  KAMLAKKALLGFIDPEMVGGE  148



>ref|XP_011467625.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467626.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467627.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467628.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467629.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=449

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +2

Query  278  CIKCDRGG---KVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAR  448
            C++C   G   K+LVCS   C I +HEEC     + D+ G FYCPYC +++A   + K R
Sbjct  18   CLRCGGDGASMKLLVCSVIGCLIAIHEECTSSQPEIDETGKFYCPYCAHKRALVRTEKLR  77

Query  449  EDAMLKKQALSRFL-DNEVTI  508
              A+  K+ LS F+   EV+I
Sbjct  78   RKALRAKEVLSMFIMSREVSI  98



>ref|XP_010531647.1| PREDICTED: uncharacterized protein LOC104807903 [Tarenaya hassleriana]
 ref|XP_010531652.1| PREDICTED: uncharacterized protein LOC104807903 [Tarenaya hassleriana]
Length=534

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C +C+ GGK+L CS+  CP+++HE+C+     +DD GNFYCP C Y   +++ LK +   
Sbjct  441  CKQCNGGGKLLFCSNEGCPVMIHEKCLDSHPTYDD-GNFYCPLCAYALNSSKYLKFKGQV  499

Query  458  MLKKQALSRFL  490
               K+ L  FL
Sbjct  500  TEAKKKLVSFL  510



>gb|EMS53431.1| DNA (cytosine-5)-methyltransferase 1 [Triticum urartu]
Length=960

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS  +C +  H+ C G PV FD  G F+CP C Y +A     KA++ 
Sbjct  362  LCIKCGKDGQLLKCS--SCSLAAHDGCFGSPVTFDASGQFHCPVCFYTKATEAYQKAKKA  419

Query  455  AMLKKQALSRFL  490
             +  ++ LS FL
Sbjct  420  YLEARKNLSAFL  431



>dbj|BAK00800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=928

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 7/122 (6%)
 Frame = +2

Query  239  NNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYR  418
            N    G+ E+   CIKC + G++L CS  +C ++ H+ C G  V  D  G FYCP C Y 
Sbjct  505  NGSTEGFTEQD-LCIKCGKDGQLLKCS--SCSLIAHDRCFGSSVTLDVSGQFYCPVCFYT  561

Query  419  QANAESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRADKSSPEERAGFLQ  598
            +A     KA+   +  ++ LS FL  +    +   Q S GK   +R   +S +   GF+ 
Sbjct  562  KATEAYQKAKITYLEARKNLSAFLGTKQFPKEHHEQ-STGK---RRTATNSKDHSNGFIT  617

Query  599  SK  604
            SK
Sbjct  618  SK  619



>ref|XP_010112893.1| hypothetical protein L484_017729 [Morus notabilis]
 gb|EXC35028.1| hypothetical protein L484_017729 [Morus notabilis]
Length=497

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 52/99 (53%), Gaps = 9/99 (9%)
 Frame = +2

Query  272  GFCIKCDRG--GKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            G CI+C +G   +VLVCS   C I VHE+CMGC   FDD G FYCP+C  ++  A   + 
Sbjct  95   GNCIRC-KGIDEQVLVCSGIGCLIWVHEKCMGCNPWFDDLGKFYCPFCKQKRVLARVREM  153

Query  446  REDAMLKKQALSRFLDNEVTIGDKLVQPSMGKSPSKRAD  562
            R      K+AL  FL+     G+K      GK    R D
Sbjct  154  RRKVKDAKKALLTFLEGSKVGGNK------GKEKQSRGD  186



>ref|XP_010532943.1| PREDICTED: uncharacterized protein LOC104808828 isoform X1 [Tarenaya 
hassleriana]
Length=446

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   CI CD    KVL+C ++ CP+ +H  C+     FD+ GNFYCPYC Y++   +SL+
Sbjct  78   KSDACIVCDGEDNKVLLCHETVCPVSIHRRCLPDEPNFDELGNFYCPYCWYKRLVVKSLR  137

Query  443  AREDAM-----LKKQALSRFLDNEVTI  508
             +E  M     LK +  S  +D  VT+
Sbjct  138  LQEKVMEAEKCLKARENSVGVDMAVTM  164



>ref|XP_009148864.1| PREDICTED: uncharacterized protein LOC103872272 isoform X3 [Brassica 
rapa]
 ref|XP_009148865.1| PREDICTED: uncharacterized protein LOC103872272 isoform X3 [Brassica 
rapa]
Length=347

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C KC + G +L+CS S C   VH+EC+ C V FD+ GNF+CP C Y    A  L++++  
Sbjct  261  CWKCGKEGTLLICSRSECASKVHKECLNCAVNFDEDGNFHCPVCWYDGVVAYYLESQKLM  320

Query  458  MLKKQALSRFL  490
               K+ L +F+
Sbjct  321  SSAKRRLMKFM  331



>ref|XP_010532944.1| PREDICTED: uncharacterized protein LOC104808828 isoform X2 [Tarenaya 
hassleriana]
Length=441

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   CI CD    KVL+C ++ CP+ +H  C+     FD+ GNFYCPYC Y++   +SL+
Sbjct  78   KSDACIVCDGEDNKVLLCHETVCPVSIHRRCLPDEPNFDELGNFYCPYCWYKRLVVKSLR  137

Query  443  AREDAM-----LKKQALSRFLDNEVTI  508
             +E  M     LK +  S  +D  VT+
Sbjct  138  LQEKVMEAEKCLKARENSVGVDMAVTM  164



>ref|XP_009148863.1| PREDICTED: uncharacterized protein LOC103872272 isoform X2 [Brassica 
rapa]
Length=391

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C KC + G +L+CS S C   VH+EC+ C V FD+ GNF+CP C Y    A  L++++  
Sbjct  310  CWKCGKEGTLLICSRSECASKVHKECLNCAVNFDEDGNFHCPVCWYDGVVAYYLESQKLM  369

Query  458  MLKKQALSRFL  490
               K+ L +F+
Sbjct  370  SSAKRRLMKFM  380



>ref|XP_009148860.1| PREDICTED: uncharacterized protein LOC103872272 isoform X1 [Brassica 
rapa]
 ref|XP_009148862.1| PREDICTED: uncharacterized protein LOC103872272 isoform X1 [Brassica 
rapa]
Length=396

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            C KC + G +L+CS S C   VH+EC+ C V FD+ GNF+CP C Y    A  L++++  
Sbjct  310  CWKCGKEGTLLICSRSECASKVHKECLNCAVNFDEDGNFHCPVCWYDGVVAYYLESQKLM  369

Query  458  MLKKQALSRFL  490
               K+ L +F+
Sbjct  370  SSAKRRLMKFM  380



>emb|CDY45288.1| BnaA06g09580D [Brassica napus]
Length=388

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  233  RENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCL  412
            ++N      P     C KC + G +L CS S C   VH+EC+ C V FD+ GNF+CP C 
Sbjct  289  KKNKNYTSLPRAENVCWKCGKEGTLLKCSRSECASKVHKECLNCAVNFDEDGNFHCPVCW  348

Query  413  YRQANAESLKAREDAMLKKQALSRFL  490
            Y    A  L++++     K+ L +F+
Sbjct  349  YDGVVAYYLESQKLMSSAKRRLMKFM  374



>ref|XP_006301220.1| hypothetical protein CARUB_v10021620mg [Capsella rubella]
 gb|EOA34118.1| hypothetical protein CARUB_v10021620mg [Capsella rubella]
Length=320

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +2

Query  218  TEISNRENNKEMGWP-EKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNF  394
            TE    E++  +  P EK   CI+C   G +L CS   C ++VH++C+  P  +DD GNF
Sbjct  214  TEGIQNESDGRLSSPVEKVYRCIQCKESGMLLFCSKDGCEVMVHQKCLKMPPDYDDAGNF  273

Query  395  YCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            YC  C    A AE L+++++    ++ L  FL
Sbjct  274  YCSLCAVTCAPAEFLQSQDEVAKSRKKLVSFL  305



>emb|CDX96053.1| BnaA07g26780D [Brassica napus]
Length=324

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 6/100 (6%)
 Frame = +2

Query  209  EMCTEISNRENNKE---MGWPEKGGF--CIKCDRGGKVLVCSDSNCPIVVHEEC-MGCPV  370
            E+C   ++ ENN     +  P +     CI+C++ GK+L CS   C ++VHE+C +  P 
Sbjct  213  EICRSQASLENNGSDCYVSSPSENNVYRCIQCNQSGKLLFCSRDGCTVMVHEKCVVDSPP  272

Query  371  KFDDRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
             +DD GNFYC  C     +AE L+++E+    K+ L  FL
Sbjct  273  VYDDAGNFYCSLCALGCVSAEYLQSQEEVAKAKKKLLSFL  312



>ref|XP_006416972.1| hypothetical protein EUTSA_v10009755mg [Eutrema salsugineum]
 gb|ESQ35325.1| hypothetical protein EUTSA_v10009755mg [Eutrema salsugineum]
Length=402

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
              C KC + G +L+CS S C   VH+EC+ C V  D+ GNF+CP C Y +  AE L  ++
Sbjct  318  NVCWKCGKEGTLLICSRSECVSKVHKECLNCAVSVDEEGNFHCPVCWYDRVVAEYLDCQK  377

Query  452  DAMLKKQALSRFL  490
                 K+ L +F+
Sbjct  378  LMRSAKRKLMKFM  390



>ref|XP_010672772.1| PREDICTED: uncharacterized protein LOC104889276 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=668

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 60/97 (62%), Gaps = 10/97 (10%)
 Frame = +2

Query  266  KGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            +   C+KC++ G++L CS S+CP++ HE C+G    FD +GNFYCP+C+Y +A AE ++A
Sbjct  378  EANICMKCNKDGQLLSCSSSSCPLLFHESCLGSSAHFDGQGNFYCPFCVYSRAIAEYVRA  437

Query  446  REDAMLKKQALSRFL----------DNEVTIGDKLVQ  526
            +E     ++ LS F+          D++ + GD + Q
Sbjct  438  KEKVSSARKELSLFIGGRSDDQQEHDSDTSSGDNVSQ  474



>ref|XP_010672769.1| PREDICTED: uncharacterized protein LOC104889276 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010672770.1| PREDICTED: uncharacterized protein LOC104889276 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010672771.1| PREDICTED: uncharacterized protein LOC104889276 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=697

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 60/97 (62%), Gaps = 10/97 (10%)
 Frame = +2

Query  266  KGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
            +   C+KC++ G++L CS S+CP++ HE C+G    FD +GNFYCP+C+Y +A AE ++A
Sbjct  378  EANICMKCNKDGQLLSCSSSSCPLLFHESCLGSSAHFDGQGNFYCPFCVYSRAIAEYVRA  437

Query  446  REDAMLKKQALSRFL----------DNEVTIGDKLVQ  526
            +E     ++ LS F+          D++ + GD + Q
Sbjct  438  KEKVSSARKELSLFIGGRSDDQQEHDSDTSSGDNVSQ  474



>emb|CDX86692.1| BnaC08g00110D [Brassica napus]
Length=916

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = +2

Query  278  CIKCDR--GGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C KC+R  G  +L+CS S C   VH+EC+  P  FD+  NF+CP C Y +   E +++R+
Sbjct  833  CWKCERVGGASLLICSRSECAAKVHKECLNAPAHFDEDDNFHCPVCWYDRVTTEYIESRK  892

Query  452  DAMLKKQALSRFL  490
                 K+ L +FL
Sbjct  893  LMSCAKRRLVKFL  905



>ref|XP_010415413.1| PREDICTED: uncharacterized protein LOC104701424 [Camelina sativa]
Length=353

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (54%), Gaps = 1/91 (1%)
 Frame = +2

Query  221  EISNRENNKEMGWP-EKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFY  397
            E+   E++  +  P EK   CI+C   G +L CS   C ++VH+ C+  P  +DD GNFY
Sbjct  248  ELFQNESDGHLSSPAEKIYRCIRCKESGMLLFCSKDGCQVMVHQTCLNSPPAYDDAGNFY  307

Query  398  CPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            C  C     +AE L+ +++    ++ L  FL
Sbjct  308  CSLCAVTCPSAEYLQWQDEVAKARKKLVSFL  338



>gb|KEH36418.1| PHD-finger protein [Medicago truncatula]
Length=477

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
              C KC+  G++LVC+   CP+++H+ C+G   + + +GNF CP+C Y  A +E L+A++
Sbjct  400  NLCSKCNEAGQLLVCT--TCPLMLHKNCLGDSAQLEAKGNFLCPFCKYSHAISEYLEAKK  457

Query  452  DAMLKKQALSRF  487
             +   ++ L+ F
Sbjct  458  ISSSARKELAIF  469



>gb|KEH36417.1| PHD-finger protein [Medicago truncatula]
Length=475

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
              C KC+  G++LVC+   CP+++H+ C+G   + + +GNF CP+C Y  A +E L+A++
Sbjct  400  NLCSKCNEAGQLLVCT--TCPLMLHKNCLGDSAQLEAKGNFLCPFCKYSHAISEYLEAKK  457

Query  452  DAMLKKQALSRF  487
             +   ++ L+ F
Sbjct  458  ISSSARKELAIF  469



>ref|XP_004304663.2| PREDICTED: uncharacterized protein LOC101308008 [Fragaria vesca 
subsp. vesca]
Length=211

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 17/102 (17%)
 Frame = +2

Query  302  KVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDAMLKKQALS  481
            KV+ CS   CPI +HEECM    + DD+G FYCPYC Y++           A+L+K  L 
Sbjct  31   KVVACSVIGCPIGIHEECMSSNSEIDDKGRFYCPYCAYKR-----------ALLRKMKLR  79

Query  482  RFLDNEVTIGDKLVQPSMGK------SPSKRADKSSPEERAG  589
            +  D     G  + Q +         S +++   S+P E+AG
Sbjct  80   KKRDPHAKGGSDIPQLNQTDKVTEVLSETRKVPDSNPTEKAG  121



>gb|AES63190.2| PHD-finger protein [Medicago truncatula]
Length=499

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
              C KC+  G++LVC+   CP+++H+ C+G   + + +GNF CP+C Y  A +E L+A++
Sbjct  400  NLCSKCNEAGQLLVCT--TCPLMLHKNCLGDSAQLEAKGNFLCPFCKYSHAISEYLEAKK  457

Query  452  DAMLKKQALSRF  487
             +   ++ L+ F
Sbjct  458  ISSSARKELAIF  469



>ref|XP_011072836.1| PREDICTED: uncharacterized protein LOC105157969 isoform X1 [Sesamum 
indicum]
 ref|XP_011072837.1| PREDICTED: uncharacterized protein LOC105157969 isoform X1 [Sesamum 
indicum]
 ref|XP_011072838.1| PREDICTED: uncharacterized protein LOC105157969 isoform X1 [Sesamum 
indicum]
Length=935

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            + W E    C+KC + GK+LVC+  +C +V+HE C+    K   R  FYCP+C + +A +
Sbjct  574  IDWRELNA-CVKCHKAGKLLVCNTKSCQLVIHENCLSSDAKLYKRRKFYCPFCAHSRAIS  632

Query  431  ESLKAREDAMLKKQALSRFL  490
            +S+K ++   L ++A + F+
Sbjct  633  KSVKIKKKVSLTRKAYATFI  652



>ref|XP_011072839.1| PREDICTED: uncharacterized protein LOC105157969 isoform X2 [Sesamum 
indicum]
Length=920

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query  251  MGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANA  430
            + W E    C+KC + GK+LVC+  +C +V+HE C+    K   R  FYCP+C + +A +
Sbjct  574  IDWRELNA-CVKCHKAGKLLVCNTKSCQLVIHENCLSSDAKLYKRRKFYCPFCAHSRAIS  632

Query  431  ESLKAREDAMLKKQALSRFL  490
            +S+K ++   L ++A + F+
Sbjct  633  KSVKIKKKVSLTRKAYATFI  652



>ref|XP_002892829.1| hypothetical protein ARALYDRAFT_471666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69088.1| hypothetical protein ARALYDRAFT_471666 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC++ G +L+CS S C   VH+EC+ CPV  D+ GNF CP C Y +   E
Sbjct  329  NVCWKCEKEGTLLICSKSECAAKVHKECLNCPVNVDEGGNFLCPLCWYDRVAME  382



>ref|XP_008240866.1| PREDICTED: uncharacterized protein LOC103339362 [Prunus mume]
Length=339

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 45/78 (58%), Gaps = 1/78 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+     K +   ++L+C  S+CP+VVHE  +       ++GNFYCP+C+Y     E 
Sbjct  23   WTERN-LGKKSNESDQLLICKTSDCPVVVHENWLRSSAIHYEKGNFYCPFCIYSLDLTEY  81

Query  437  LKAREDAMLKKQALSRFL  490
            L+A+++  L K+ L  F+
Sbjct  82   LEAKKETSLLKKDLDAFI  99



>ref|XP_008356655.1| PREDICTED: uncharacterized protein LOC103420370 [Malus domestica]
Length=573

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  230  NRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYC  409
            NR  ++   W E+   C+KC+ G ++L+C+  +CP+  HE+C+G      ++GNF CP C
Sbjct  453  NRAYSETTDWMEQN-ICVKCNEGAQLLICTTIDCPLAYHEKCLGSEFICYEKGNFICPLC  511

Query  410  LYRQANAESLKAREDAMLKKQALSRFL  490
             +  A  + L+++++    ++ L  F+
Sbjct  512  SHSLALKKYLESKKETSRLRKNLDTFM  538



>ref|NP_172930.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_973829.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79242.1|AC006917_27 F10B6.17 [Arabidopsis thaliana]
 dbj|BAC43457.1| putative PhD-finger protein [Arabidopsis thaliana]
 gb|AAP40414.1| putative PhD-finger protein [Arabidopsis thaliana]
 gb|AEE29223.1| uncharacterized protein AT1G14770 [Arabidopsis thaliana]
 gb|AEE29224.1| uncharacterized protein AT1G14770 [Arabidopsis thaliana]
Length=429

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC++ G +L+CS S C   VH+EC+ CPV  D+ GNF CP C Y +   E
Sbjct  346  NVCWKCEKEGTLLICSRSECAAKVHKECLNCPVNVDEYGNFLCPLCWYDRLAME  399



>gb|AAM65632.1| PhD-finger protein, putative [Arabidopsis thaliana]
Length=429

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC++ G +L+CS S C   VH+EC+ CPV  D+ GNF CP C Y +   E
Sbjct  346  NVCWKCEKEGTLLICSRSECAAKVHKECLNCPVNVDEYGNFLCPLCWYDRLAME  399



>ref|XP_009347334.1| PREDICTED: uncharacterized protein LOC103939004 [Pyrus x bretschneideri]
Length=573

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  230  NRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYC  409
            NR  ++   W E+   C+KC+ G ++L+C+  +CP+  HE+C+G      ++GNF CP C
Sbjct  453  NRAYSETTDWMEEN-ICVKCNEGAQLLICTIIDCPLAYHEKCLGSEFICYEKGNFICPLC  511

Query  410  LYRQANAESLKAREDAMLKKQALSRFL  490
             +  A  + L+++++    K+ L  F+
Sbjct  512  SHSLALKKYLESKKETSRLKKNLDTFM  538



>ref|XP_004136747.1| PREDICTED: uncharacterized protein LOC101206592 [Cucumis sativus]
Length=562

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLY  415
             C+KC+ GG++L C+  +CP+VVH +C+G     +D G+F CP+CL+
Sbjct  516  VCVKCNEGGQLLSCNIGDCPLVVHAKCLGSLAAMNDEGDFRCPFCLF  562



>emb|CDY01877.1| BnaC06g29170D [Brassica napus]
Length=308

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECM--GCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            CI+C + GK+L CS   C ++VHE+C+    PV +DD GNFYC  C     +AE L+++E
Sbjct  225  CIQCKQSGKLLFCSRDGCTVMVHEKCVVDSQPV-YDDAGNFYCSLCALGCVSAEYLQSQE  283

Query  452  DAMLKKQALSRFL  490
            +    K+ L  FL
Sbjct  284  EVAKAKKKLVSFL  296



>emb|CDY15447.1| BnaA08g27310D [Brassica napus]
Length=919

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = +2

Query  278  CIKCDR--GGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
            C KC+R  G  +L+CS S C   VH+EC+  P  FD+ GNF+CP C Y +   E  ++++
Sbjct  836  CWKCEREGGASLLICSRSECAAKVHKECLNGPAHFDEDGNFHCPMCWYDRVTMEYRESQK  895

Query  452  DAMLKKQALSRFL  490
                 K+ L +FL
Sbjct  896  LMSCAKRRLVKFL  908



>ref|XP_004300509.1| PREDICTED: uncharacterized protein LOC101292125 [Fragaria vesca 
subsp. vesca]
Length=513

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+ C+ GG++L+CS S+CP+V HE CMG        G+ YCP+C Y     E L+  ++
Sbjct  436  HCLMCNGGGQLLICSTSDCPLVYHESCMGSEFISYVSGDIYCPFCAYCLHLMECLEVEKE  495

Query  455  AMLKKQALSRF  487
            A+  ++ L  F
Sbjct  496  ALRLRKDLYLF  506



>ref|XP_010235463.1| PREDICTED: uncharacterized protein LOC100830030 isoform X2 [Brachypodium 
distachyon]
Length=816

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC + G++L CS  +C +  H+ C G  V FDD G FYC  C Y +A     KA++ 
Sbjct  455  LCVKCGQDGQLLRCS--SCLLAAHDSCFGSSVTFDDSGQFYCAVCFYTKATEAYQKAKKI  512

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  513  YAEARKNLSAFL  524



>ref|XP_003572559.1| PREDICTED: uncharacterized protein LOC100830030 isoform X1 [Brachypodium 
distachyon]
Length=953

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC + G++L CS  +C +  H+ C G  V FDD G FYC  C Y +A     KA++ 
Sbjct  592  LCVKCGQDGQLLRCS--SCLLAAHDSCFGSSVTFDDSGQFYCAVCFYTKATEAYQKAKKI  649

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  650  YAEARKNLSAFL  661



>ref|XP_004955692.1| PREDICTED: uncharacterized protein LOC101784911 [Setaria italica]
Length=970

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +2

Query  242  NKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQ  421
            N  +G   +   C+KC + G++L CS  +C +  H+ C G    F++ G FYCP C Y +
Sbjct  590  NDSLGDLSQQDLCVKCGKDGQLLKCS--SCLLTAHDSCFGSSATFEETGLFYCPVCFYTK  647

Query  422  ANAESLKAREDAMLKKQALSRFLDNEVTIGDKLVQPSM  535
            A     KA++     ++ LS FL     +     QP++
Sbjct  648  ATEAYQKAKKTYCEARKNLSAFLGTTPLVKQHHEQPTV  685



>ref|XP_003592939.1| PHD finger protein 21A [Medicago truncatula]
Length=473

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARE  451
              C KC+  G++LVC+   CP+++H+ C+G   + + +GNF CP+C Y  A +E L+A++
Sbjct  381  NLCSKCNEAGQLLVCT--TCPLMLHKNCLGDSAQLEAKGNFLCPFCKYSHAISEYLEAKK  438



>gb|KHG04639.1| snRNA-activating complex subunit 4 [Gossypium arboreum]
Length=420

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  329  CPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            CP+ +HE CM     FDD G FYCPYCLY++  A       +AML +  LS F+
Sbjct  33   CPVALHEACMTWRPIFDDMGKFYCPYCLYKKEVARFKDLTTEAMLARNELSNFI  86



>ref|XP_007202189.1| hypothetical protein PRUPE_ppa026014mg [Prunus persica]
 gb|EMJ03388.1| hypothetical protein PRUPE_ppa026014mg [Prunus persica]
Length=1010

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (58%), Gaps = 1/78 (1%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAES  436
            W E+     K +  G++L+C  S+C +V+HE  +       ++GNFYCP+C+Y     E 
Sbjct  694  WTERN-LGKKSNESGQLLICKTSDCSVVLHENWLRSSAIHYEKGNFYCPFCVYSLDLTEY  752

Query  437  LKAREDAMLKKQALSRFL  490
            L+A+++  L K+ L  F+
Sbjct  753  LEAKKETSLLKKDLDAFI  770



>ref|XP_006391192.1| hypothetical protein EUTSA_v10019541mg, partial [Eutrema salsugineum]
 gb|ESQ28478.1| hypothetical protein EUTSA_v10019541mg, partial [Eutrema salsugineum]
Length=326

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECM-GCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
            CI+C    K+L CS   C ++VHE+C+   P  +DD GNFYC  C    A+AE +K++++
Sbjct  242  CIQCKESRKLLFCSGDGCEVMVHEKCVVESPPFYDDAGNFYCSLCALTCASAEYIKSQDE  301

Query  455  AMLKKQALSRFL  490
                K+ L  FL
Sbjct  302  VAKAKKRLISFL  313



>ref|XP_009111172.1| PREDICTED: uncharacterized protein LOC103836634 [Brassica rapa]
 ref|XP_009111173.1| PREDICTED: uncharacterized protein LOC103836634 [Brassica rapa]
 ref|XP_009111174.1| PREDICTED: uncharacterized protein LOC103836634 [Brassica rapa]
Length=461

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 2/75 (3%)
 Frame = +2

Query  272  GFCIKCDR--GGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKA  445
              C KC+R  G  +L+CS S C   VH+EC+  P  FD+  NF+CP C Y +   E  ++
Sbjct  376  NVCWKCERQGGASLLICSRSECAAKVHKECLNGPAHFDEDDNFHCPMCWYDRVTMEYRES  435

Query  446  REDAMLKKQALSRFL  490
            ++     K+ L +FL
Sbjct  436  QKLMSCAKRRLVKFL  450



>ref|NP_001065819.1| Os11g0160700 [Oryza sativa Japonica Group]
 gb|ABA91594.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27664.1| Os11g0160700 [Oryza sativa Japonica Group]
 gb|EEE51697.1| hypothetical protein OsJ_33066 [Oryza sativa Japonica Group]
Length=951

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS  +C +  H+ C G     DD G  YCP C Y +A     KA++ 
Sbjct  581  LCIKCGKDGQLLKCS--SCLLAAHDTCFGSLATLDDSGQLYCPVCFYTKATEAYQKAKKT  638

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  639  YSEARKNLSAFL  650



>ref|XP_002452154.1| hypothetical protein SORBIDRAFT_04g020760 [Sorghum bicolor]
 gb|EES05130.1| hypothetical protein SORBIDRAFT_04g020760 [Sorghum bicolor]
Length=961

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +2

Query  239  NNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYR  418
            N+     PE+   CIKC +GG +L CS  +C +  H+ C G  + F+D    +CP C+Y 
Sbjct  594  NDSHRVSPEQD-LCIKCGKGGHLLQCS--SCLLSAHDSCFGSSLTFEDPRQLHCPVCIYA  650

Query  419  QANAESLKAREDAMLKKQALSRFLDNE  499
            +A  E  K ++  +  +++L+ FL  E
Sbjct  651  KATEEYKKTKKTYIEARKSLAAFLGAE  677



>gb|EEC67726.1| hypothetical protein OsI_35213 [Oryza sativa Indica Group]
Length=951

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS  +C +  H+ C G     DD G  YCP C Y +A     KA++ 
Sbjct  581  LCIKCGKDGQLLKCS--SCLLAAHDTCFGSLATLDDSGQLYCPVCFYTKATEAYQKAKKT  638

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  639  YSEARKNLSAFL  650



>gb|AAX95463.1| hypothetical protein [Oryza sativa Japonica Group]
Length=932

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS  +C +  H+ C G     DD G  YCP C Y +A     KA++ 
Sbjct  581  LCIKCGKDGQLLKCS--SCLLAAHDTCFGSLATLDDSGQLYCPVCFYTKATEAYQKAKKT  638

Query  455  AMLKKQALSRFL  490
                ++ LS FL
Sbjct  639  YSEARKNLSAFL  650



>dbj|BAH30361.1| hypothetical protein [Arabidopsis thaliana]
Length=278

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +2

Query  263  EKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            EK   C+ C   GK+L CS   C ++VH++C+  P  + D G+FYC  C     +AE ++
Sbjct  188  EKIYRCVNCKESGKLLFCSSDGCEVMVHQKCLDSPPSYHDAGDFYCSLCALTCPSAEYVQ  247

Query  443  AREDAMLKKQALSRFL  490
             +++    K+ L  FL
Sbjct  248  FQDEVAKAKRKLVSFL  263



>ref|NP_176970.1| RING/FYVE/PHD zinc finger protein [Arabidopsis thaliana]
 gb|AAG52000.1|AC012563_10 hypothetical protein; 42846-44012 [Arabidopsis thaliana]
 gb|AEE34739.1| RING/FYVE/PHD zinc finger protein [Arabidopsis thaliana]
Length=314

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +2

Query  263  EKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            EK   C+ C   GK+L CS   C ++VH++C+  P  + D G+FYC  C     +AE ++
Sbjct  224  EKIYRCVNCKESGKLLFCSSDGCEVMVHQKCLDSPPSYHDAGDFYCSLCALTCPSAEYVQ  283

Query  443  AREDAMLKKQALSRFL  490
             +++    K+ L  FL
Sbjct  284  FQDEVAKAKRKLVSFL  299



>ref|XP_006307652.1| hypothetical protein CARUB_v10009280mg [Capsella rubella]
 ref|XP_006307653.1| hypothetical protein CARUB_v10009280mg [Capsella rubella]
 gb|EOA40550.1| hypothetical protein CARUB_v10009280mg [Capsella rubella]
 gb|EOA40551.1| hypothetical protein CARUB_v10009280mg [Capsella rubella]
Length=415

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC++ G +L+CS S C   VH+EC+  PV  D+ GNF CP C Y +   E
Sbjct  332  NVCWKCEKEGTLLICSRSECATKVHKECLNGPVNVDEDGNFLCPLCWYDRVAME  385



>gb|AFW66932.1| hypothetical protein ZEAMMB73_241747 [Zea mays]
Length=867

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +2

Query  200  VVREMCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFD  379
            +  ++C   + ++ N  +    + G CIKC  GG++L C+   C +  H  C G    F+
Sbjct  549  ISSKICVHFNVQDINDTLEDLSQQGLCIKCGEGGQLLECN--GCFLAAHSSCFGSSATFE  606

Query  380  DRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
                FYCP CLY++A     KA++     ++ L  FL
Sbjct  607  GTNFFYCPVCLYKKATEAYKKAKKTYCETRKNLVAFL  643



>ref|XP_008644322.1| PREDICTED: uncharacterized protein LOC103625712 isoform X2 [Zea 
mays]
 ref|XP_008644323.1| PREDICTED: uncharacterized protein LOC103625712 isoform X2 [Zea 
mays]
Length=895

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +2

Query  200  VVREMCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFD  379
            +  ++C   + ++ N  +    + G CIKC  GG++L C+   C +  H  C G    F+
Sbjct  549  ISSKICVHFNVQDINDTLEDLSQQGLCIKCGEGGQLLECN--GCFLAAHSSCFGSSATFE  606

Query  380  DRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
                FYCP CLY++A     KA++     ++ L  FL
Sbjct  607  GTNFFYCPVCLYKKATEAYKKAKKTYCETRKNLVAFL  643



>ref|XP_008644326.1| PREDICTED: uncharacterized protein LOC103625712 isoform X4 [Zea 
mays]
Length=870

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +2

Query  200  VVREMCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFD  379
            +  ++C   + ++ N  +    + G CIKC  GG++L C+   C +  H  C G    F+
Sbjct  549  ISSKICVHFNVQDINDTLEDLSQQGLCIKCGEGGQLLECN--GCFLAAHSSCFGSSATFE  606

Query  380  DRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
                FYCP CLY++A     KA++     ++ L  FL
Sbjct  607  GTNFFYCPVCLYKKATEAYKKAKKTYCETRKNLVAFL  643



>ref|XP_008644324.1| PREDICTED: uncharacterized protein LOC103625712 isoform X3 [Zea 
mays]
 ref|XP_008644325.1| PREDICTED: uncharacterized protein LOC103625712 isoform X3 [Zea 
mays]
Length=871

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +2

Query  200  VVREMCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFD  379
            +  ++C   + ++ N  +    + G CIKC  GG++L C+   C +  H  C G    F+
Sbjct  549  ISSKICVHFNVQDINDTLEDLSQQGLCIKCGEGGQLLECN--GCFLAAHSSCFGSSATFE  606

Query  380  DRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
                FYCP CLY++A     KA++     ++ L  FL
Sbjct  607  GTNFFYCPVCLYKKATEAYKKAKKTYCETRKNLVAFL  643



>ref|XP_008644320.1| PREDICTED: uncharacterized protein LOC103625712 isoform X1 [Zea 
mays]
Length=897

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +2

Query  200  VVREMCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFD  379
            +  ++C   + ++ N  +    + G CIKC  GG++L C+   C +  H  C G    F+
Sbjct  549  ISSKICVHFNVQDINDTLEDLSQQGLCIKCGEGGQLLECN--GCFLAAHSSCFGSSATFE  606

Query  380  DRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
                FYCP CLY++A     KA++     ++ L  FL
Sbjct  607  GTNFFYCPVCLYKKATEAYKKAKKTYCETRKNLVAFL  643



>gb|AFW66933.1| hypothetical protein ZEAMMB73_241747 [Zea mays]
 gb|AFW66934.1| hypothetical protein ZEAMMB73_241747 [Zea mays]
Length=748

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +2

Query  200  VVREMCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFD  379
            +  ++C   + ++ N  +    + G CIKC  GG++L C+   C +  H  C G    F+
Sbjct  402  ISSKICVHFNVQDINDTLEDLSQQGLCIKCGEGGQLLECN--GCFLAAHSSCFGSSATFE  459

Query  380  DRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
                FYCP CLY++A     KA++     ++ L  FL
Sbjct  460  GTNFFYCPVCLYKKATEAYKKAKKTYCETRKNLVAFL  496



>gb|KFK24460.1| hypothetical protein AALP_AAs46367U000300 [Arabis alpina]
Length=599

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 1/67 (1%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   C  CD +   VL+C    CP+ +H+ C      FD+ GNFYCPYC Y++   +SLK
Sbjct  44   KSNTCYVCDVKDNWVLLCHGEECPVAIHQSCNSGEPDFDEFGNFYCPYCWYKRVVFKSLK  103

Query  443  AREDAML  463
                 M+
Sbjct  104  LERKLMV  110



>ref|XP_002454834.1| hypothetical protein SORBIDRAFT_04g038230 [Sorghum bicolor]
 gb|EES07810.1| hypothetical protein SORBIDRAFT_04g038230 [Sorghum bicolor]
Length=926

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = +2

Query  212  MCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGN  391
            +C++  ++E N  +    +   CIKC +GG++L CS  +C +  HE C    + F+D   
Sbjct  587  LCSQ--DQEANDSLRVSPEQNLCIKCGKGGQLLQCS--SCLLSAHESCFASSLTFEDPRQ  642

Query  392  FYCPYCLYRQANAESLKAREDAMLKKQALSRFLDNE  499
             YCP C+  +A  E  KA++  +  +++L+ F+  E
Sbjct  643  LYCPVCICAKATEEYKKAKKTYIEARKSLAAFVGAE  678



>ref|XP_008645114.1| PREDICTED: uncharacterized protein LOC103626481 isoform X2 [Zea 
mays]
Length=945

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (52%), Gaps = 2/93 (2%)
 Frame = +2

Query  212  MCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGN  391
            +C    +++ N  +    +   CIKC + G++L CS  +C +  H  C G  V F++   
Sbjct  613  ICVHSKDKDINDTLEGLSQQDLCIKCGKVGQLLECS--SCSLAAHNSCFGSSVTFEETNL  670

Query  392  FYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            FYCP C Y++A     KA++     ++ ++ FL
Sbjct  671  FYCPVCFYKRATEAYKKAKKTYGEARKNVAAFL  703



>ref|XP_010474585.1| PREDICTED: hsp70-Hsp90 organizing protein 2-like [Camelina sativa]
Length=227

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 1/64 (2%)
 Frame = +2

Query  278  CIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
            C  CD     VLVC    C I VH+ C      FD+ GNFYCPYC Y++  ++ ++ +E 
Sbjct  164  CFVCDGEDDWVLVCYREECSIAVHQSCASDEPDFDEFGNFYCPYCWYKRVVSKYVELKEK  223

Query  455  AMLK  466
             M+K
Sbjct  224  LMVK  227



>ref|XP_008645115.1| PREDICTED: uncharacterized protein LOC103626481 isoform X3 [Zea 
mays]
Length=934

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (52%), Gaps = 2/93 (2%)
 Frame = +2

Query  212  MCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGN  391
            +C    +++ N  +    +   CIKC + G++L CS  +C +  H  C G  V F++   
Sbjct  613  ICVHSKDKDINDTLEGLSQQDLCIKCGKVGQLLECS--SCSLAAHNSCFGSSVTFEETNL  670

Query  392  FYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            FYCP C Y++A     KA++     ++ ++ FL
Sbjct  671  FYCPVCFYKRATEAYKKAKKTYGEARKNVAAFL  703



>ref|XP_008645113.1| PREDICTED: uncharacterized protein LOC103626481 isoform X1 [Zea 
mays]
Length=984

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (52%), Gaps = 2/93 (2%)
 Frame = +2

Query  212  MCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGN  391
            +C    +++ N  +    +   CIKC + G++L CS  +C +  H  C G  V F++   
Sbjct  613  ICVHSKDKDINDTLEGLSQQDLCIKCGKVGQLLECS--SCSLAAHNSCFGSSVTFEETNL  670

Query  392  FYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            FYCP C Y++A     KA++     ++ ++ FL
Sbjct  671  FYCPVCFYKRATEAYKKAKKTYGEARKNVAAFL  703



>gb|AFW69604.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=938

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (52%), Gaps = 2/93 (2%)
 Frame = +2

Query  212  MCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGN  391
            +C    +++ N  +    +   CIKC + G++L CS  +C +  H  C G  V F++   
Sbjct  571  ICVHSKDKDINDTLEGLSQQDLCIKCGKVGQLLECS--SCSLAAHNSCFGSSVTFEETNL  628

Query  392  FYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            FYCP C Y++A     KA++     ++ ++ FL
Sbjct  629  FYCPVCFYKRATEAYKKAKKTYGEARKNVAAFL  661



>ref|XP_010496532.1| PREDICTED: uncharacterized protein LOC104773571 isoform X2 [Camelina 
sativa]
Length=376

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC R G +L+CS S+C   VH+ C+ CPV  D+ G F CP C Y +   E
Sbjct  293  NLCWKCLRKGTLLICSRSDCASKVHKGCLNCPVNVDEDGCFLCPLCWYDRVAME  346



>gb|AFW69603.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=942

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (52%), Gaps = 2/93 (2%)
 Frame = +2

Query  212  MCTEISNRENNKEMGWPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGN  391
            +C    +++ N  +    +   CIKC + G++L CS  +C +  H  C G  V F++   
Sbjct  571  ICVHSKDKDINDTLEGLSQQDLCIKCGKVGQLLECS--SCSLAAHNSCFGSSVTFEETNL  628

Query  392  FYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            FYCP C Y++A     KA++     ++ ++ FL
Sbjct  629  FYCPVCFYKRATEAYKKAKKTYGEARKNVAAFL  661



>ref|XP_010496518.1| PREDICTED: uncharacterized protein LOC104773571 isoform X1 [Camelina 
sativa]
 ref|XP_010496526.1| PREDICTED: uncharacterized protein LOC104773571 isoform X1 [Camelina 
sativa]
Length=422

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC R G +L+CS S+C   VH+ C+ CPV  D+ G F CP C Y +   E
Sbjct  339  NLCWKCLRKGTLLICSRSDCASKVHKGCLNCPVNVDEDGCFLCPLCWYDRVAME  392



>ref|XP_010458992.1| PREDICTED: uncharacterized protein LOC104740164 isoform X1 [Camelina 
sativa]
 ref|XP_010458993.1| PREDICTED: uncharacterized protein LOC104740164 isoform X2 [Camelina 
sativa]
 ref|XP_010458994.1| PREDICTED: uncharacterized protein LOC104740164 isoform X1 [Camelina 
sativa]
Length=448

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC R G +L+CS S+C   VH+ C+ CPV  D+ G F CP C Y +   E
Sbjct  365  NLCWKCLRKGTLLICSRSDCASKVHKGCLNCPVNVDEDGCFLCPLCWYDRVAME  418



>ref|XP_010458995.1| PREDICTED: uncharacterized protein LOC104740164 isoform X3 [Camelina 
sativa]
Length=424

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC R G +L+CS S+C   VH+ C+ CPV  D+ G F CP C Y +   E
Sbjct  341  NLCWKCLRKGTLLICSRSDCASKVHKGCLNCPVNVDEDGCFLCPLCWYDRVAME  394



>ref|XP_006283306.1| hypothetical protein CARUB_v10004342mg [Capsella rubella]
 gb|EOA16204.1| hypothetical protein CARUB_v10004342mg [Capsella rubella]
Length=643

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   C  CD +   VLVC    CPI +H+ C      FD+ GNFYCPYC Y++  ++ ++
Sbjct  50   KSNTCFVCDGKDDWVLVCYGEECPIAIHQSCASDEPDFDEFGNFYCPYCWYKRVVSKCVE  109

Query  443  AREDAML  463
              E  M+
Sbjct  110  LGEKLMV  116



>ref|XP_006283305.1| hypothetical protein CARUB_v10004342mg [Capsella rubella]
 gb|EOA16203.1| hypothetical protein CARUB_v10004342mg [Capsella rubella]
Length=637

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   C  CD +   VLVC    CPI +H+ C      FD+ GNFYCPYC Y++  ++ ++
Sbjct  50   KSNTCFVCDGKDDWVLVCYGEECPIAIHQSCASDEPDFDEFGNFYCPYCWYKRVVSKCVE  109

Query  443  AREDAML  463
              E  M+
Sbjct  110  LGEKLMV  116



>ref|XP_006395961.1| hypothetical protein EUTSA_v10003829mg [Eutrema salsugineum]
 gb|ESQ33247.1| hypothetical protein EUTSA_v10003829mg [Eutrema salsugineum]
Length=620

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 1/67 (1%)
 Frame = +2

Query  266  KGGFCIKCDRGGK-VLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   C  CD     +LVC    CPI +H+ C      FD+  NFYCPYC Y++  A+S+ 
Sbjct  54   KSNTCYVCDGNDDWLLVCHGEECPIAIHQSCTSDEPDFDEFRNFYCPYCCYKRVIAKSVN  113

Query  443  AREDAML  463
             RE  ++
Sbjct  114  LREKLLV  120



>gb|EYU23569.1| hypothetical protein MIMGU_mgv1a003817mg [Erythranthe guttata]
Length=562

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C KC + GK+L CS  +C +++HE C+G    +D +G FYCP+C   +A +  ++ ++ 
Sbjct  257  HCEKCKKDGKLLSCS--SCSVMIHESCLGSDQIYDPKGIFYCPFCTSSRAISVYVEVKKK  314

Query  455  AMLKKQALSRFL  490
            A   ++ L  F+
Sbjct  315  ASSARKDLGNFI  326



>ref|XP_010476548.1| PREDICTED: uncharacterized protein LOC104755783 [Camelina sativa]
 ref|XP_010476549.1| PREDICTED: uncharacterized protein LOC104755783 [Camelina sativa]
 ref|XP_010476550.1| PREDICTED: uncharacterized protein LOC104755783 [Camelina sativa]
Length=421

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  GFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAE  433
              C KC R G +L+CS S+C   VH+ C+ CPV  D+ G F CP C Y +   E
Sbjct  338  NVCWKCLRKGTLLICSRSDCASKVHKGCLNCPVNVDEDGCFLCPLCWYDRVAME  391



>ref|XP_009340161.1| PREDICTED: uncharacterized protein LOC103932322 [Pyrus x bretschneideri]
Length=1098

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C K + GG +L+C  SNCP+VVHE  +       ++ NF CP+C Y  A  E L +++ 
Sbjct  751  VCKKPNEGG-LLICDTSNCPVVVHENWLRSSDILYEKDNFKCPFCSYSLALTEYLDSKKR  809

Query  455  AMLKKQALSRFL  490
            A + K+ L  F+
Sbjct  810  ASMLKKDLDAFI  821



>emb|CDY33345.1| BnaC05g12380D [Brassica napus]
Length=274

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   C  CD +   VLVC    C I +H+ C      FD+ GNF+CPYC Y++   +SLK
Sbjct  30   KDNACYVCDGKDDWVLVCHGEQCLISIHQSCTCDEPDFDEFGNFFCPYCWYKRLVLKSLK  89

Query  443  AREDAM  460
             RE  +
Sbjct  90   LREKLL  95



>ref|XP_009334961.1| PREDICTED: uncharacterized protein LOC103927742 [Pyrus x bretschneideri]
Length=1059

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C K + GG +L+C  SNCP+VVHE  +       ++ NF CP+C Y  A  E L +++ 
Sbjct  713  VCKKPNEGG-LLICDTSNCPVVVHENWLRSSDILYEKHNFKCPFCSYSLALTEYLDSKKR  771

Query  455  AMLKKQALSRFL  490
            A + K+ L  F+
Sbjct  772  ASMLKKDLDAFI  783



>ref|XP_002451340.1| hypothetical protein SORBIDRAFT_04g000347 [Sorghum bicolor]
 gb|EES04316.1| hypothetical protein SORBIDRAFT_04g000347 [Sorghum bicolor]
Length=392

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 39/75 (52%), Gaps = 2/75 (3%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             CIKC + G++L CS   C +  H+ C G  V F+    FYCP C Y++A     KA++ 
Sbjct  86   LCIKCGKDGQLLECS--GCSLAAHDSCFGSSVTFEGTDLFYCPRCCYKKATEAYEKAKKT  143

Query  455  AMLKKQALSRFLDNE  499
                ++ L+ F   E
Sbjct  144  YYEAREKLAAFHGTE  158



>emb|CDY35078.1| BnaA06g10880D [Brassica napus]
Length=270

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = +2

Query  266  KGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLK  442
            K   C  CD +   VLVC    C I +H+ C      FD+ GNF+CPYC Y++   +SLK
Sbjct  25   KDNACYVCDGKDDWVLVCHGEQCLISIHQSCTCDEPDFDEFGNFFCPYCWYKRLVLKSLK  84

Query  443  AREDAM  460
             R+  +
Sbjct  85   LRDKLL  90



>ref|XP_009149315.1| PREDICTED: uncharacterized protein LOC103872635 [Brassica rapa]
Length=267

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +2

Query  263  EKGGFCIKCD-RGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESL  439
            +K   C  CD +   VLVC    C I +H+ C      FD+ GNF+CPYC Y++   +SL
Sbjct  24   KKDNACYVCDGKDDWVLVCHGEQCLISIHQSCTCDEPDFDEFGNFFCPYCWYKRLVLKSL  83

Query  440  KAREDAM  460
            K R+  +
Sbjct  84   KLRDKLL  90



>dbj|BAJ93867.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 4/71 (6%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESL-KARED  454
            C+KC + G++L CS  +C +  H  C G  V FDD G+F CP C  R+A AE+L KA++ 
Sbjct  501  CVKCSKDGQLLKCS--SCFLAAHASCFGSSVTFDDSGHFDCPVCYCRKA-AEALEKAKKT  557

Query  455  AMLKKQALSRF  487
                ++ LS F
Sbjct  558  YSEARKNLSVF  568



>ref|XP_008644308.1| PREDICTED: uncharacterized protein LOC103625700 isoform X2 [Zea 
mays]
 gb|AFW66893.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=800

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC +GG++L CS   C + VH  C+G    F+    FYCP C Y++A     KA + 
Sbjct  445  LCLKCGKGGQLLECS--RCFLAVHSSCLGSSATFEGTNLFYCPICSYKKAIEACKKANKT  502

Query  455  AMLKKQALSRFLD-NEVTIGDKLVQP  529
                ++ L+  L   +VT   K VQP
Sbjct  503  YCEARKNLAALLSKTQVT---KQVQP  525



>ref|XP_008644307.1| PREDICTED: uncharacterized protein LOC103625700 isoform X1 [Zea 
mays]
Length=928

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = +2

Query  275  FCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKARED  454
             C+KC +GG++L CS   C + VH  C+G    F+    FYCP C Y++A     KA + 
Sbjct  573  LCLKCGKGGQLLECS--RCFLAVHSSCLGSSATFEGTNLFYCPICSYKKAIEACKKANKT  630

Query  455  AMLKKQALSRFLD-NEVTIGDKLVQP  529
                ++ L+  L   +VT   K VQP
Sbjct  631  YCEARKNLAALLSKTQVT---KQVQP  653



>ref|XP_010930008.1| PREDICTED: uncharacterized protein LOC105051332 [Elaeis guineensis]
Length=466

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = +2

Query  257  WPEKGGFCIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFY  397
            W E+G  CI CD GG++L CS S C I VHE C+G  VK +    FY
Sbjct  361  WTEQG-LCINCDNGGQLLSCSASGCSIGVHESCLGAFVKVEKTCLFY  406



>ref|XP_003561334.1| PREDICTED: uncharacterized protein LOC100826621 [Brachypodium 
distachyon]
 ref|XP_010228264.1| PREDICTED: uncharacterized protein LOC100826621 [Brachypodium 
distachyon]
Length=954

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 2/74 (3%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYRQANAESLKAREDA  457
            CIKC + G++L CS   C +  H+ C G  + F+D   F CP C Y +A     KA+   
Sbjct  586  CIKCGKDGQLLKCS--TCLLAAHDSCFGPSMPFEDSTQFCCPVCFYIKATEAYKKAKNTY  643

Query  458  MLKKQALSRFLDNE  499
               +  L+ FL  E
Sbjct  644  CEARMNLTAFLGTE  657



>ref|XP_007049460.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 ref|XP_007049461.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX93617.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX93618.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=361

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  356  MGCPVKFDDRGNFYCPYCLYRQANAESLKAREDAMLKKQALSRFL  490
            M C  KFD+ G FYCPYC Y++    + + R  AML ++ LS F+
Sbjct  1    MNCNPKFDNMGKFYCPYCWYKRELVRTKELRRKAMLARKELSNFI  45



>gb|EMT02974.1| hypothetical protein F775_18538 [Aegilops tauschii]
Length=802

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 28/47 (60%), Gaps = 2/47 (4%)
 Frame = +2

Query  278  CIKCDRGGKVLVCSDSNCPIVVHEECMGCPVKFDDRGNFYCPYCLYR  418
            C+KC + G++L CS  +C +  H  C G  V FDD G+F CP C  R
Sbjct  456  CVKCGKDGQLLKCS--SCFLAAHARCFGSSVTFDDSGHFDCPVCYCR  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000