BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039M18

Length=361
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACU19312.1|  unknown                                                 131   3e-35   Glycine max [soybeans]
ref|XP_002277525.1|  PREDICTED: CAAX prenyl protease 1 homolog          135   6e-35   Vitis vinifera
gb|KJB41394.1|  hypothetical protein B456_007G102500                    134   8e-35   Gossypium raimondii
gb|KJB41393.1|  hypothetical protein B456_007G102500                    134   1e-34   Gossypium raimondii
gb|KJB41392.1|  hypothetical protein B456_007G102500                    134   2e-34   Gossypium raimondii
ref|XP_006444969.1|  hypothetical protein CICLE_v10020054mg             134   2e-34   
gb|KHG15702.1|  CAAX prenyl protease 1 -like protein                    134   2e-34   Gossypium arboreum [tree cotton]
gb|EYU35101.1|  hypothetical protein MIMGU_mgv1a006971mg                134   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_006396278.1|  hypothetical protein EUTSA_v10028603mg             134   2e-34   
ref|XP_008438005.1|  PREDICTED: CAAX prenyl protease 1 homolog          133   2e-34   Cucumis melo [Oriental melon]
emb|CDP08773.1|  unnamed protein product                                132   4e-34   Coffea canephora [robusta coffee]
ref|XP_003534542.1|  PREDICTED: CAAX prenyl protease 1 homolog          132   4e-34   Glycine max [soybeans]
ref|XP_011093122.1|  PREDICTED: CAAX prenyl protease 1 homolog          132   5e-34   Sesamum indicum [beniseed]
ref|XP_007139795.1|  hypothetical protein PHAVU_008G059300g             132   5e-34   Phaseolus vulgaris [French bean]
ref|XP_006339615.1|  PREDICTED: CAAX prenyl protease 1 homolog          132   8e-34   Solanum tuberosum [potatoes]
ref|XP_004155836.1|  PREDICTED: CAAX prenyl protease 1 homolog          132   8e-34   
ref|XP_004229884.1|  PREDICTED: CAAX prenyl protease 1 homolog          132   8e-34   Solanum lycopersicum
ref|XP_004133850.1|  PREDICTED: CAAX prenyl protease 1 homolog          132   8e-34   Cucumis sativus [cucumbers]
gb|KHM99334.1|  CAAX prenyl protease 1 like                             131   1e-33   Glycine soja [wild soybean]
ref|XP_003552415.1|  PREDICTED: CAAX prenyl protease 1 homolog          131   1e-33   Glycine max [soybeans]
ref|XP_009773920.1|  PREDICTED: CAAX prenyl protease 1 homolog          131   1e-33   Nicotiana sylvestris
emb|CDX74353.1|  BnaA03g26940D                                          131   2e-33   
ref|XP_009134527.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   2e-33   Brassica rapa
gb|KDO86290.1|  hypothetical protein CISIN_1g014430mg                   128   2e-33   Citrus sinensis [apfelsine]
ref|XP_009134526.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    131   2e-33   Brassica rapa
emb|CDX91888.1|  BnaC03g31900D                                          130   3e-33   
ref|XP_010261328.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010669929.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   3e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO86289.1|  hypothetical protein CISIN_1g014430mg                   128   4e-33   Citrus sinensis [apfelsine]
ref|XP_009111448.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   4e-33   Brassica rapa
emb|CDY07191.1|  BnaCnng02060D                                          130   4e-33   
ref|XP_009615410.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   4e-33   Nicotiana tomentosiformis
emb|CDY48517.1|  BnaA09g00060D                                          129   5e-33   Brassica napus [oilseed rape]
ref|XP_010919128.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   7e-33   Elaeis guineensis
ref|XP_009628878.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   8e-33   Nicotiana tomentosiformis
gb|KDO86287.1|  hypothetical protein CISIN_1g014430mg                   129   8e-33   Citrus sinensis [apfelsine]
gb|KDO86288.1|  hypothetical protein CISIN_1g014430mg                   128   8e-33   Citrus sinensis [apfelsine]
ref|XP_007051723.1|  Peptidase family M48 family protein                129   8e-33   
ref|XP_008810111.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   9e-33   Phoenix dactylifera
ref|XP_010544403.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   9e-33   Tarenaya hassleriana [spider flower]
ref|XP_006491174.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   9e-33   Citrus sinensis [apfelsine]
ref|XP_002320821.1|  CAAX protease family protein                       129   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008232992.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   2e-32   Prunus mume [ume]
ref|XP_010933964.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   2e-32   Elaeis guineensis
gb|KFK30712.1|  hypothetical protein AALP_AA6G017800                    128   2e-32   Arabis alpina [alpine rockcress]
ref|XP_011036976.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   2e-32   Populus euphratica
ref|XP_002302601.1|  CAAX protease family protein                       127   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_007218054.1|  hypothetical protein PRUPE_ppa006168mg             126   4e-32   
ref|XP_010053753.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   4e-32   Eucalyptus grandis [rose gum]
ref|XP_009400731.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009762715.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    126   5e-32   Nicotiana sylvestris
ref|XP_007218053.1|  hypothetical protein PRUPE_ppa006168mg             126   7e-32   Prunus persica
ref|XP_010427521.1|  PREDICTED: CAAX prenyl protease 1 homolog          126   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009762714.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    126   7e-32   Nicotiana sylvestris
ref|XP_010422802.1|  PREDICTED: CAAX prenyl protease 1 homolog          126   8e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010456236.1|  PREDICTED: CAAX prenyl protease 1 homolog          126   8e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010556569.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    126   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_002511907.1|  caax prenyl protease ste24, putative               125   1e-31   Ricinus communis
ref|NP_567212.1|  CAAX prenyl protease 1 homolog                        125   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAK39514.1|AF353722_1  CaaX processing zinc-metallo endoprotease     125   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286757.1|  hypothetical protein CARUB_v10003198mg             125   3e-31   Capsella rubella
ref|XP_002874990.1|  ATSTE24                                            125   3e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009393943.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009349805.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_008346138.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   3e-31   
ref|XP_008805562.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   3e-31   Phoenix dactylifera
ref|XP_004306743.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   5e-31   Fragaria vesca subsp. vesca
ref|XP_003624056.1|  CAAX prenyl protease-like protein                  124   6e-31   Medicago truncatula
ref|XP_004306744.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   1e-30   Fragaria vesca subsp. vesca
gb|AAL07084.1|  putative CAAX prenyl protease                           121   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647687.1|  PREDICTED: CAAX prenyl protease 1 homolog          119   3e-29   Oryza brachyantha
ref|XP_002454476.1|  hypothetical protein SORBIDRAFT_04g031850          118   8e-29   Sorghum bicolor [broomcorn]
ref|XP_006828772.1|  hypothetical protein AMTR_s00001p00094700          117   1e-28   Amborella trichopoda
ref|NP_001047739.1|  Os02g0680400                                       117   2e-28   
gb|EEC73787.1|  hypothetical protein OsI_08473                          117   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010112964.1|  CAAX prenyl protease 1-like protein                117   2e-28   
ref|XP_004492786.1|  PREDICTED: CAAX prenyl protease 1 homolog          116   3e-28   
ref|NP_001131195.1|  uncharacterized protein LOC100192503               116   4e-28   Zea mays [maize]
gb|AFW63375.1|  CAAX prenyl protease 1                                  117   7e-28   
ref|XP_004953446.1|  PREDICTED: CAAX prenyl protease 1 homolog          115   9e-28   Setaria italica
emb|CAB80941.1|  putative CAAX prenyl protease                          113   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008643874.1|  PREDICTED: CAAX prenyl protease 1 isoform X2       112   7e-27   
ref|XP_008643873.1|  PREDICTED: CAAX prenyl protease 1 isoform X1       112   7e-27   Zea mays [maize]
ref|XP_004308344.1|  PREDICTED: CAAX prenyl protease 1 homolog          112   1e-26   Fragaria vesca subsp. vesca
gb|KDP28583.1|  hypothetical protein JCGZ_14354                         111   2e-26   Jatropha curcas
gb|KEH18809.1|  CAAX prenyl protease-like protein                       108   2e-25   Medicago truncatula
ref|XP_003570103.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   3e-25   Brachypodium distachyon [annual false brome]
gb|AIC32889.1|  STE24                                                   107   6e-25   Puccinellia tenuiflora
ref|XP_001780822.1|  predicted protein                                  104   5e-24   
ref|XP_001783632.1|  predicted protein                                  103   1e-23   
gb|KCW78104.1|  hypothetical protein EUGRSUZ_D02317                     102   2e-23   Eucalyptus grandis [rose gum]
emb|CAL26913.1|  CAAX peptidase                                         100   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152504.1|  CAAX prenyl protease 1                           99.0    6e-22   Zea mays [maize]
ref|XP_002961362.1|  hypothetical protein SELMODRAFT_266600           94.0    4e-20   Selaginella moellendorffii
ref|XP_003622452.1|  CAAX prenyl protease-like protein                90.9    7e-20   
gb|KHN29321.1|  CAAX prenyl protease 1 like                           82.4    4e-16   Glycine soja [wild soybean]
gb|KFY09356.1|  hypothetical protein V492_05514                       59.3    1e-07   Pseudogymnoascus sp. VKM F-4246
gb|KFY38041.1|  hypothetical protein V494_04536                       58.9    2e-07   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFZ20107.1|  hypothetical protein V502_03363                       58.5    2e-07   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY87676.1|  hypothetical protein V500_06835                       58.9    2e-07   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFZ02509.1|  hypothetical protein V501_09542                       58.5    2e-07   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY76197.1|  hypothetical protein V499_04041                       58.5    2e-07   Pseudogymnoascus sp. VKM F-103
gb|KFY59517.1|  hypothetical protein V496_05652                       57.0    5e-07   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KFX89268.1|  hypothetical protein V490_07139                       57.0    6e-07   Pseudogymnoascus sp. VKM F-3557
gb|ELR10214.1|  STE24 endopeptidase                                   56.6    9e-07   Pseudogymnoascus destructans 20631-21
ref|XP_002945691.1|  hypothetical protein VOLCADRAFT_78672            56.2    1e-06   Volvox carteri f. nagariensis
gb|KFY04966.1|  hypothetical protein V491_09229                       55.8    2e-06   Pseudogymnoascus sp. VKM F-3775
gb|KFY19341.1|  hypothetical protein V493_08005                       55.5    2e-06   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_001559859.1|  hypothetical protein BC1G_01418                  54.7    3e-06   Botrytis cinerea B05.10
ref|XP_003050604.1|  predicted protein                                55.1    4e-06   [Nectria] haematococca mpVI 77-13-4
gb|ESZ94952.1|  putative CAAX prenyl protease 1                       54.3    4e-06   Sclerotinia borealis F-4128
ref|XP_001593172.1|  hypothetical protein SS1G_06094                  53.9    6e-06   Sclerotinia sclerotiorum 1980 UF-70
emb|CCK69867.1|  hypothetical protein KNAG_0D01150                    52.8    2e-05   Kazachstania naganishii CBS 8797
ref|XP_008080326.1|  hypothetical protein GLAREA_07447                52.4    2e-05   Glarea lozoyensis ATCC 20868
gb|KFM64976.1|  CAAX prenyl protease 1-like protein                   52.4    2e-05   Stegodyphus mimosarum
gb|KIN03786.1|  hypothetical protein OIDMADRAFT_158613                52.0    3e-05   Oidiodendron maius Zn
ref|XP_007917686.1|  putative caax prenyl protease 1 protein          51.6    4e-05   Phaeoacremonium minimum UCRPA7
ref|XP_011115562.1|  hypothetical protein H072_10056                  51.2    4e-05   
emb|CCD77520.1|  farnesylated-protein converting enzyme 1 (M48 fa...  51.2    5e-05   Schistosoma mansoni
emb|CCT67513.1|  probable zinc metallo-protease                       51.2    5e-05   Fusarium fujikuroi IMI 58289
gb|EER44696.1|  CaaX prenyl protease                                  50.8    6e-05   Histoplasma capsulatum H143
gb|EEH10632.1|  CaaX prenyl protease                                  50.8    6e-05   Histoplasma capsulatum G186AR
gb|EGC45621.1|  CaaX prenyl protease                                  50.8    6e-05   Histoplasma capsulatum H88
emb|CCX14243.1|  Similar to CAAX prenyl protease 1; acc. no. P47154   50.8    7e-05   Pyronema omphalodes CBS 100304
gb|EZF34879.1|  hypothetical protein H101_01566                       50.4    7e-05   Trichophyton interdigitale H6
emb|CDS32581.1|  farnesylated protein converting enzyme 1             50.8    8e-05   Hymenolepis microstoma
gb|EGE06070.1|  CAAX prenyl protease                                  50.4    8e-05   Trichophyton equinum CBS 127.97
ref|XP_008468578.1|  PREDICTED: uncharacterized protein C10orf118...  50.4    1e-04   
gb|KFH71808.1|  hypothetical protein MVEG_02102                       50.1    1e-04   Mortierella verticillata NRRL 6337
ref|XP_011121081.1|  hypothetical protein AOL_s00076g226              50.1    1e-04   Arthrobotrys oligospora ATCC 24927
ref|XP_003023010.1|  hypothetical protein TRV_02831                   50.4    1e-04   Trichophyton verrucosum HKI 0517
gb|EGD96703.1|  CaaX prenyl protease                                  50.1    1e-04   Trichophyton tonsurans CBS 112818
ref|XP_003685564.1|  hypothetical protein TPHA_0E00340                50.1    1e-04   Tetrapisispora phaffii CBS 4417
ref|XP_009254473.1|  hypothetical protein FPSE_03079                  50.1    1e-04   Fusarium pseudograminearum CS3096
ref|XP_002584079.1|  hypothetical protein UREG_04768                  50.1    1e-04   Uncinocarpus reesii 1704
gb|KHJ35024.1|  putative peptidase family m48                         50.1    1e-04   Erysiphe necator
ref|XP_003012809.1|  hypothetical protein ARB_01060                   50.1    1e-04   Trichophyton benhamiae CBS 112371
gb|AAB61028.1|  A_IG002N01.21 gene product                            49.7    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KIL91310.1|  hypothetical protein FAVG1_04924                      49.7    1e-04   Fusarium avenaceum
gb|KDB15160.1|  putative zinc metallo-protease                        49.7    1e-04   Ustilaginoidea virens
ref|XP_453545.1|  hypothetical protein                                49.7    1e-04   Kluyveromyces lactis
ref|XP_003236858.1|  CaaX prenyl protease                             49.7    2e-04   Trichophyton rubrum CBS 118892
ref|XP_003067440.1|  CAAX prenyl protease, putative                   49.7    2e-04   Coccidioides posadasii C735 delta SOWgp
ref|XP_001239931.1|  hypothetical protein CIMG_09552                  49.7    2e-04   Coccidioides immitis RS
gb|EXL53967.1|  STE24 endopeptidase                                   49.3    2e-04   Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|EWZ02551.1|  STE24 endopeptidase                                   49.3    2e-04   Fusarium oxysporum FOSC 3-a
gb|EXM07215.1|  STE24 endopeptidase                                   49.3    2e-04   Fusarium oxysporum f. sp. cubense tropical race 4 54006
ref|XP_011324509.1|  hypothetical protein FGSG_12839                  49.3    2e-04   Fusarium graminearum PH-1
gb|EGU84979.1|  hypothetical protein FOXB_04560                       49.3    2e-04   Fusarium oxysporum Fo5176
gb|EWG42807.1|  STE24 endopeptidase                                   49.3    2e-04   Fusarium verticillioides 7600
gb|KGB37699.1|  CAAX prenyl protease 1-like protein                   49.3    2e-04   Schistosoma haematobium
ref|XP_001540370.1|  CaaX prenyl protease                             49.3    2e-04   Histoplasma capsulatum NAm1
emb|CCE28602.1|  probable zinc metallo-protease                       49.3    2e-04   Claviceps purpurea 20.1
emb|CCE44422.1|  hypothetical protein CPAR2_402230                    49.3    2e-04   Candida parapsilosis
emb|CDH48818.1|  prenyl protease                                      48.9    2e-04   Lichtheimia corymbifera JMRC:FSU:9682
gb|EMT24778.1|  CAAX prenyl protease 1-like protein                   48.9    3e-04   
gb|EFQ29725.1|  peptidase family M48                                  48.9    3e-04   Colletotrichum graminicola M1.001
emb|CCG83629.1|  CaaX prenyl protease Ste24                           48.9    3e-04   Taphrina deformans PYCC 5710
ref|XP_004226161.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  48.9    3e-04   Ciona intestinalis [sea vase]
gb|KGQ04223.1|  CAAX prenyl protease 1                                48.9    3e-04   Beauveria bassiana D1-5
ref|XP_002627156.1|  CaaX prenyl protease                             48.5    4e-04   Blastomyces gilchristii SLH14081
gb|KHN95623.1|  Peptidase M48                                         48.5    4e-04   Metarhizium album ARSEF 1941
ref|XP_010759714.1|  hypothetical protein PADG_04087                  48.5    4e-04   Paracoccidioides brasiliensis Pb18
ref|XP_007834407.1|  hypothetical protein PFICI_07635                 48.5    4e-04   Pestalotiopsis fici W106-1
ref|XP_002842311.1|  hypothetical protein                             48.5    4e-04   Tuber melanosporum Mel28
gb|EJY68063.1|  Zn-dependent protease with chaperone function         48.9    4e-04   Oxytricha trifallax
ref|XP_003869947.1|  Ste24 prenyl-dependent protease                  48.1    5e-04   Candida orthopsilosis Co 90-125
ref|XP_007376706.1|  hypothetical protein SPAPADRAFT_62544            48.1    5e-04   Spathaspora passalidarum NRRL Y-27907
emb|CDO93753.1|  unnamed protein product                              48.1    6e-04   Kluyveromyces dobzhanskii CBS 2104
ref|XP_460632.1|  DEHA2F06248p                                        47.8    6e-04   Debaryomyces hansenii CBS767
emb|CDS07769.1|  hypothetical protein LRAMOSA01718                    47.8    6e-04   Lichtheimia ramosa
ref|XP_713382.1|  potential a-factor pheromone maturation protease    47.8    6e-04   
gb|ELQ35873.1|  CAAX prenyl protease 1                                47.8    6e-04   Magnaporthe oryzae Y34
gb|KGQ86300.1|  STE24 endopeptidase                                   47.8    7e-04   Candida albicans P94015
ref|XP_003172087.1|  CAAX prenyl protease 1                           47.8    7e-04   Nannizzia gypsea CBS 118893
gb|KHC34914.1|  STE24 endopeptidase                                   47.8    7e-04   Candida albicans P76055
ref|XP_002154940.2|  PREDICTED: CAAX prenyl protease 1 homolog        47.4    8e-04   Hydra vulgaris
dbj|GAA32070.1|  STE24 endopeptidase                                  47.8    8e-04   Clonorchis sinensis [oriental liver fluke]
gb|AAZ80484.1|  membrane-associated metalloproteinase                 47.8    8e-04   Taenia solium [pig tapeworm]
gb|KFH61944.1|  hypothetical protein MVEG_12278                       47.4    8e-04   Mortierella verticillata NRRL 6337
gb|KID96212.1|  Peptidase M48                                         47.4    8e-04   Metarhizium majus ARSEF 297
ref|XP_009532258.1|  hypothetical protein PHYSODRAFT_250864           47.4    9e-04   Phytophthora sojae
ref|XP_006696845.1|  ribosomal protein L34-like protein               47.4    0.001   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_009168050.1|  hypothetical protein T265_13631                  47.4    0.001   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_006673104.1|  CaaX prenyl protease                             47.4    0.001   Cordyceps militaris CM01
ref|XP_002553545.1|  KLTH0E01298p                                     47.4    0.001   Lachancea thermotolerans CBS 6340



>gb|ACU19312.1| unknown [Glycine max]
Length=202

 Score =   131 bits (329),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILMYIFETYL +RQH ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHRALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFVHEF TI+ DS ILYFG+LPWFWKKS  F  +
Sbjct  61   HFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTI  96



>ref|XP_002277525.1| PREDICTED: CAAX prenyl protease 1 homolog [Vitis vinifera]
 emb|CBI40422.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILMYIFETYL +RQHAALKLPTLP+ L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDLRQHAALKLPTLPRTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFVHE  TILMDSAIL+FG+LPWFWKKS  F  V
Sbjct  61   HFHFVHECVTILMDSAILFFGVLPWFWKKSGDFLVV  96



>gb|KJB41394.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=362

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY+FETYL +RQHAALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TIL+DSAIL+FGILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFL  94



>gb|KJB41393.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=391

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY+FETYL +RQHAALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TIL+DSAIL+FGILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFL  94



>gb|KJB41392.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=424

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY+FETYL +RQHAALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TIL+DSAIL+FGILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFL  94



>ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
 gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
Length=463

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  44   GNSAMAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYS  223
             N+AM FPYMEAVVGFMILMY FETYL +RQHAALKLP LPK L G ISQ K EK R YS
Sbjct  36   SNAAMVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYS  95

Query  224  IXKSDFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
            + KS FHFVHEF TILMDSAIL F ILPWFWKKS  F 
Sbjct  96   LDKSHFHFVHEFVTILMDSAILLFRILPWFWKKSGNFL  133



>gb|KHG15702.1| CAAX prenyl protease 1 -like protein [Gossypium arboreum]
Length=424

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY+FETYL +RQHAALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TIL+DSAIL+FGILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFL  94



>gb|EYU35101.1| hypothetical protein MIMGU_mgv1a006971mg [Erythranthe guttata]
Length=424

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVG MIL+YIFE YL  RQHAALKLPTLPKPLVG ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGVMILVYIFECYLDKRQHAALKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFG  340
            +FHFVHE  T+LMDS ILYFGILPWFWK+S  F G
Sbjct  61   NFHFVHELVTVLMDSVILYFGILPWFWKRSGEFLG  95



>ref|XP_006396278.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
 gb|ESQ37731.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
Length=494

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  50   SAMAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIX  229
            +AMA PYME VVGFMI+MYIFETYL +RQHAA KLPTLPK LVG ISQ K EK RAYS+ 
Sbjct  69   AAMAIPYMETVVGFMIVMYIFETYLDLRQHAAHKLPTLPKTLVGVISQEKFEKSRAYSLD  128

Query  230  KSDFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            KS FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  129  KSYFHFVHEFVTILMDSAILFFGILPWFWKLS  160



>ref|XP_008438005.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis melo]
Length=424

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMYIFETYL +RQH ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MEFPYMEAVVGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             FHFVHEF TI+MDSAIL+FG+LPWFWKKS  F
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEF  93



>emb|CDP08773.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFP+MEAVV FMILMY+FE+YL +RQHAALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPFMEAVVCFMILMYLFESYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
            +FHFVHEF TILMDSAIL+FGILPWFWKKS  F 
Sbjct  61   NFHFVHEFFTILMDSAILFFGILPWFWKKSGEFL  94



>ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILMYIFETYL +RQH ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHRALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFVHEF TI+ DS ILYFG+LPWFWKKS  F  +
Sbjct  61   HFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTI  96



>ref|XP_011093122.1| PREDICTED: CAAX prenyl protease 1 homolog [Sesamum indicum]
Length=424

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMIL+Y+FETYL +RQH ALKLPTLP+PLVG ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILVYLFETYLDLRQHTALKLPTLPRPLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHE  TI+MD AILYFGILPWFWK+S  F 
Sbjct  61   HFHFVHELVTIVMDCAILYFGILPWFWKRSGEFL  94



>ref|XP_007139795.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
Length=424

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILMYIFETYL +RQH ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDMRQHKALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            +FHF+HEF TI+ DS ILYFG+LPWFWKKS
Sbjct  61   NFHFIHEFVTIVSDSTILYFGVLPWFWKKS  90



>ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum]
Length=424

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+EAVVGFMILMY+FE+YL +RQHAA KLPTLPKPLVG ISQ K EK RAYS+ KS
Sbjct  1    MAFPYLEAVVGFMILMYLFESYLDVRQHAAHKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHF+HEF TILMDS+ILYF ILPWFWK+S  F 
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKRSGEFL  94



>ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
Length=424

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY FETYL +RQH ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MEFPYMEAVVGFMILMYTFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             FHFVHEF TI+MDSAIL+FG+LPWFWKKS  F
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEF  93



>ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum]
Length=424

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+EAVVGFMILMYIFE+YL +RQHAA KLPTLPKPLVG ISQ K EK RAYS+ KS
Sbjct  1    MAFPYLEAVVGFMILMYIFESYLDVRQHAAHKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHF+HEF TI+MDS+ILYF ILPWFWK+S  F 
Sbjct  61   YFHFIHEFVTIIMDSSILYFRILPWFWKRSGEFL  94



>ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
 gb|KGN56492.1| hypothetical protein Csa_3G121680 [Cucumis sativus]
Length=424

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY FETYL +RQH ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MEFPYMEAVVGFMILMYTFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             FHFVHEF TI+MDSAIL+FG+LPWFWKKS  F
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEF  93



>gb|KHM99334.1| CAAX prenyl protease 1 like [Glycine soja]
Length=424

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILMYIFETYL +RQH+ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFVHEF TI++DS ILYFG+LPWFWK S  F  +
Sbjct  61   HFHFVHEFVTIVIDSTILYFGVLPWFWKISGDFMTI  96



>ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILMYIFETYL +RQH+ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFVHEF TI++DS ILYFG+LPWFWK S  F  +
Sbjct  61   HFHFVHEFVTIVIDSTILYFGVLPWFWKISGDFMTI  96



>ref|XP_009773920.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana sylvestris]
Length=424

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 83/99 (84%), Gaps = 3/99 (3%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+EAV+GFMILMYIFETYL +RQHAA KLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAFPYLEAVLGFMILMYIFETYLDVRQHAAHKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWK---KSLRFFGV  343
             FHF+HEF TILMDS+ILYF ILPWFWK   +SL + G+
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKISGESLVYLGL  99



>emb|CDX74353.1| BnaA03g26940D [Brassica napus]
Length=424

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MY+FETYL +RQH ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFVHEF TILMDSAIL+FGILPWFWK S  F  +
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGGFLPI  96



>ref|XP_009134527.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Brassica 
rapa]
Length=424

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MY+FETYL +RQH ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKIS  90



>gb|KDO86290.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=274

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY FETYL +RQHAALKLP LPK L G ISQ K EK R YS+ KS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TILMDSAIL F ILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFL  94



>ref|XP_009134526.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Brassica 
rapa]
Length=455

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MY+FETYL +RQH ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKIS  90



>emb|CDX91888.1| BnaC03g31900D [Brassica napus]
Length=424

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFM++MY+FETYL +RQH ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMVVMYVFETYLDLRQHTALKLPTLPKTLVGVISQDKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TILMDSAIL+FGILPWFWK S  F 
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGAFL  94



>ref|XP_010261328.1| PREDICTED: CAAX prenyl protease 1 homolog [Nelumbo nucifera]
Length=424

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYME+VVGFMILMYIFETYL IRQH +LKLP LPKPL G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMESVVGFMILMYIFETYLDIRQHRSLKLPNLPKPLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHF+HE  TILMD+AIL+FGILPWFWK+S  F 
Sbjct  61   HFHFIHEAVTILMDTAILFFGILPWFWKRSAEFL  94



>ref|XP_010669929.1| PREDICTED: CAAX prenyl protease 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPY+EAVVGFMILMY FETYL +RQHAA KLPTLPKPL+G ISQ K EK RAYS+ KS
Sbjct  1    MTFPYLEAVVGFMILMYFFETYLDLRQHAAHKLPTLPKPLLGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TI++DS ILYFG+LPWFWKK+  F 
Sbjct  61   GFHFVHEFVTIVLDSGILYFGLLPWFWKKAGDFL  94



>gb|KDO86289.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=304

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY FETYL +RQHAALKLP LPK L G ISQ K EK R YS+ KS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TILMDSAIL F ILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFL  94



>ref|XP_009111448.1| PREDICTED: CAAX prenyl protease 1 homolog [Brassica rapa]
Length=424

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MYIFETYL +RQH+ALKLP+LPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSA+L+FGILPWFWK S
Sbjct  61   HFHFVHEFVTILMDSAMLFFGILPWFWKLS  90



>emb|CDY07191.1| BnaCnng02060D [Brassica napus]
Length=424

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MYIFETYL +RQH+ALKLP+LPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSA+L+FGILPWFWK S
Sbjct  61   HFHFVHEFVTILMDSAMLFFGILPWFWKLS  90



>ref|XP_009615410.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 3/99 (3%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+EAV+GFMILMYIFETYL +RQHAA KLPTLPK LVG ISQ K +K RAYS+ KS
Sbjct  1    MAFPYLEAVLGFMILMYIFETYLDVRQHAAHKLPTLPKTLVGVISQEKFKKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWK---KSLRFFGV  343
             FHF+HEF TILMDS+ILYF ILPWFWK   +SL + G+
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKISGESLLYLGL  99



>emb|CDY48517.1| BnaA09g00060D [Brassica napus]
Length=424

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MYIFETYL +RQH+ALKLP+LPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSA+L+FG+LPWFWK S
Sbjct  61   HFHFVHEFVTILMDSAMLFFGVLPWFWKLS  90



>ref|XP_010919128.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+GFMILMYIFETYL IRQHAALKLP+LPKPL G +SQ K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLGFMILMYIFETYLDIRQHAALKLPSLPKPLEGVVSQEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHE  TILMD+AILY GILPWFWKKS
Sbjct  61   QFHFVHEAVTILMDTAILYLGILPWFWKKS  90



>ref|XP_009628878.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+E+VVGFMILMYIFETYL +RQHAALKLPTLPKPL G ISQ K +K +AYS+ KS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVISQEKFKKSQAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
            +FHFVHEF TILMDSAILYF ILPWFWK S  F 
Sbjct  61   NFHFVHEFVTILMDSAILYFRILPWFWKISRDFL  94



>gb|KDO86287.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=399

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY FETYL +RQHAALKLP LPK L G ISQ K EK R YS+ KS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TILMDSAIL F ILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFL  94



>gb|KDO86288.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=367

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY FETYL +RQHAALKLP LPK L G ISQ K EK R YS+ KS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TILMDSAIL F ILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFL  94



>ref|XP_007051723.1| Peptidase family M48 family protein [Theobroma cacao]
 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao]
Length=435

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAF YMEAVV FMILMY FETYL +RQHAALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFLYMEAVVCFMILMYFFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TILMDSAIL+FGILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKKSGNFL  94



>ref|XP_008810111.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+GFMILMYI ETYL IRQHAALKLP+LPKPL G +SQ K EK RAYS+ KS
Sbjct  1    MALPYLEAVLGFMILMYILETYLDIRQHAALKLPSLPKPLEGVVSQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             FHFVHE  TILMD+AILYFG+LPWFWKKS  F
Sbjct  61   HFHFVHEAVTILMDTAILYFGVLPWFWKKSGDF  93



>ref|XP_010544403.1| PREDICTED: CAAX prenyl protease 1 homolog [Tarenaya hassleriana]
Length=424

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYME VVGFMI+MYIFETYL +RQHAALKLPTLPK LVG I Q K EK RAYS+ KS
Sbjct  1    MAFPYMETVVGFMIMMYIFETYLDLRQHAALKLPTLPKTLVGLIGQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFV  + TILMDSAIL+FGILPWFWKKS  F 
Sbjct  61   YFHFVQGYVTILMDSAILFFGILPWFWKKSGDFL  94



>ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis]
 gb|KDO86285.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=424

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPYMEAVVGFMILMY FETYL +RQHAALKLP LPK L G ISQ K EK R YS+ KS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFVHEF TILMDSAIL F ILPWFWKKS  F 
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFL  94



>ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMIL+Y FETYL +RQ AALKLP LPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILVYFFETYLDLRQRAALKLPILPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             F+FVHEF TIL+DSAIL++GILPWFWKKS  F
Sbjct  61   HFNFVHEFVTILLDSAILFYGILPWFWKKSGSF  93



>ref|XP_008232992.1| PREDICTED: CAAX prenyl protease 1 homolog [Prunus mume]
Length=424

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFP++EAV+GFMILMYIFETYL +RQH ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             FHF+HEF TILMDSAIL+F +LPWFWK+S  F
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRSGDF  93



>ref|XP_010933964.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+GFMILMYIFETYL IRQHAALKLP LPKPL G +SQ K EK RAYS+ KS
Sbjct  1    MALPYLEAVLGFMILMYIFETYLDIRQHAALKLPRLPKPLEGVVSQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHE  TILMD+AILYFGILPWFWK S
Sbjct  61   HFHFVHEAVTILMDTAILYFGILPWFWKIS  90



>gb|KFK30712.1| hypothetical protein AALP_AA6G017800 [Arabis alpina]
Length=424

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MYIFE+YL +RQH ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYIFESYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWK  319
             FHFVHEF TILMDSAIL+FGILPWFWK
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWK  88



>ref|XP_011036976.1| PREDICTED: CAAX prenyl protease 1 homolog [Populus euphratica]
Length=424

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMIL+Y FETYL +RQ AALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILVYFFETYLDLRQLAALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             F+FVHEF TIL+DSAIL++GILPWFWKKS  F
Sbjct  61   HFNFVHEFVTILLDSAILFYGILPWFWKKSGSF  93



>ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILMY FETYL +RQHAALKLP+LPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMYFFETYLDLRQHAALKLPSLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             F+FVHEF TIL+DSAIL++ ILPWFWKKS  F 
Sbjct  61   YFNFVHEFVTILLDSAILFYAILPWFWKKSGSFL  94



>ref|XP_007218054.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19253.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=351

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFP++EAV+GFMILMYIFETYL +RQH ALKLPTLPK L G I Q K EK RAYS+ KS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVIGQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHF+HEF TILMDSAIL+F +LPWFWK+S
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRS  90



>ref|XP_010053753.1| PREDICTED: CAAX prenyl protease 1 homolog [Eucalyptus grandis]
 gb|KCW78103.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=423

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILM+ FETYL +RQHAA KLPTLPKPL G I Q K +K RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMHFFETYLDLRQHAAYKLPTLPKPLEGVIGQEKFQKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHF+HEF +ILMDSAIL FGILPWFWKKS  F 
Sbjct  61   RFHFLHEFVSILMDSAILLFGILPWFWKKSGEFL  94



>ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+EAV+GFMI MY FETYL IRQHAALKL  LPKPL G ISQ K E+ RAYSI KS
Sbjct  1    MAFPYLEAVLGFMIFMYFFETYLDIRQHAALKLTNLPKPLEGVISQEKFERARAYSIDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHF+HE  TILMD+AILYFGILPWFWK S
Sbjct  61   GFHFIHEAVTILMDTAILYFGILPWFWKVS  90



>ref|XP_009762715.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+E+VVGFMILMYIFETYL +RQHAALKLPTLPKPL G I Q K +K +AYS+ KS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVICQEKFKKSQAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
            +FHFVHEF TILMDSA+LYF ILPWFWK S  F 
Sbjct  61   NFHFVHEFVTILMDSAVLYFRILPWFWKISGDFL  94



>ref|XP_007218053.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=424

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFP++EAV+GFMILMYIFETYL +RQH ALKLPTLPK L G I Q K EK RAYS+ KS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVIGQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             FHF+HEF TILMDSAIL+F +LPWFWK+S  F
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRSGDF  93



>ref|XP_010427521.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKIS  90



>ref|XP_009762714.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Nicotiana 
sylvestris]
Length=424

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+E+VVGFMILMYIFETYL +RQHAALKLPTLPKPL G I Q K +K +AYS+ KS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVICQEKFKKSQAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
            +FHFVHEF TILMDSA+LYF ILPWFWK S  F 
Sbjct  61   NFHFVHEFVTILMDSAVLYFRILPWFWKISGDFL  94



>ref|XP_010422802.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKIS  90



>ref|XP_010456236.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKIS  90



>ref|XP_010556569.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556570.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYME VVGFMI+MYI E YL +RQH+ALKLPTLPK L+G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMETVVGFMIMMYILEMYLDLRQHSALKLPTLPKTLIGVISQEKFEKSRAYSLEKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FHFV+EF TILMDSAIL+FGILPWFWK S  F 
Sbjct  61   YFHFVYEFVTILMDSAILFFGILPWFWKISGDFL  94



>ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis]
 gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis]
Length=424

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAV+GFM+LMYIFE+YL +RQH ALKLPTLPK L G ISQ K +K RAYS+ KS
Sbjct  1    MAFPYMEAVLGFMVLMYIFESYLDMRQHCALKLPTLPKTLEGVISQEKFKKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             F+FVHEF TIL+DSAILYFGILPW WK+S  F 
Sbjct  61   HFNFVHEFVTILLDSAILYFGILPWSWKESGNFL  94



>ref|NP_567212.1| CAAX prenyl protease 1 homolog [Arabidopsis thaliana]
 sp|Q8RX88.1|FACE1_ARATH RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=AtFACE-1; Short=FACE-1; 
AltName: Full=Prenyl protein-specific endoprotease 
1; AltName: Full=Zinc metalloproteinase Ste24 homolog; Short=AtSTE24 
[Arabidopsis thaliana]
 gb|AAL90896.1| AT4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AAP21163.1| At4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AEE82008.1| peptidase family M48 family protein [Arabidopsis thaliana]
Length=424

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA P+ME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKMS  90



>gb|AAK39514.1|AF353722_1 CaaX processing zinc-metallo endoprotease [Arabidopsis thaliana]
Length=424

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA P+ME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKMS  90



>ref|XP_006286757.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
 gb|EOA19655.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
Length=424

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA P+ME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKIS  90



>ref|XP_002874990.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51249.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA P+ME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKIS  90



>ref|XP_009393943.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+EAV+GFMI MY+FETYL IRQHAALKLP LPKPL G IS+ K EK RAYSI KS
Sbjct  1    MAFPYLEAVLGFMIFMYLFETYLDIRQHAALKLPNLPKPLEGVISREKFEKARAYSIDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHF+HE  TILMD+AILYFG+LPWFWK S
Sbjct  61   YFHFIHEAVTILMDTAILYFGLLPWFWKLS  90



>ref|XP_009349805.1| PREDICTED: CAAX prenyl protease 1 homolog [Pyrus x bretschneideri]
Length=424

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFP++EAV+GFMI +Y FETYL +RQHAA KLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPFLEAVIGFMISLYFFETYLDLRQHAAHKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFVHEF TILMDSAIL+F +LPWFWK+S  F  +
Sbjct  61   RFHFVHEFVTILMDSAILFFRVLPWFWKRSADFVAL  96



>ref|XP_008346138.1| PREDICTED: CAAX prenyl protease 1 homolog [Malus domestica]
Length=424

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFP++EAV+GFMI +Y FETYL +RQHAA KLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPFLEAVIGFMISLYFFETYLDLRQHAAHKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFVHEF TILMDSAIL+F +LPWFWK+S  F  +
Sbjct  61   RFHFVHEFVTILMDSAILFFRVLPWFWKRSADFVAL  96



>ref|XP_008805562.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805563.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805564.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+GFMILMYI ETYL IRQHAALKLP+LPKPL G + Q K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLGFMILMYILETYLDIRQHAALKLPSLPKPLEGVVGQEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHE  +ILMD+AILYFGILPWFWKK+
Sbjct  61   HFHFVHEAVSILMDTAILYFGILPWFWKKT  90



>ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=424

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFP++EAV+GFMILMY FETYL +RQHAALKLPTLP+ L G ISQ K EK RAY + +S
Sbjct  1    MAFPFLEAVIGFMILMYNFETYLDLRQHAALKLPTLPRTLEGVISQEKFEKSRAYCLERS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            +FHFVH+F T+LMD+AIL++ ILPWFWKKS
Sbjct  61   NFHFVHDFVTLLMDTAILFYRILPWFWKKS  90



>ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula]
 gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=426

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPYMEAVVGFMILMYIFE+YL +RQH ALKLPTLPK L G ISQ K EK RAYS+ KS
Sbjct  1    MAFPYMEAVVGFMILMYIFESYLDLRQHKALKLPTLPKSLEGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             FHFVH   TI+ DS ILYF +LPWFWKKS  F
Sbjct  61   HFHFVHALVTIITDSTILYFKVLPWFWKKSGDF  93



>ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=426

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  59   AFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSD  238
            +FP++E+V+GFMILMY FETYL  RQH+ALKLPTLPK L G ISQ K EK RAYS+ KS 
Sbjct  4    SFPFLESVIGFMILMYFFETYLDTRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLEKSH  63

Query  239  FHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
            FHFVHEF TILMDSAIL+F +LPWFWKKS  F
Sbjct  64   FHFVHEFVTILMDSAILFFRVLPWFWKKSGDF  95



>gb|AAL07084.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=424

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA P+ME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAYS+ KS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMDSAIL+F ILPWFWK S
Sbjct  61   YFHFVHEFVTILMDSAILFFWILPWFWKMS  90



>ref|XP_006647687.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza brachyantha]
Length=425

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMILMYIFETYL IRQH ALKLPTLPKPLVG IS  K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHF+HE  TILMD+ ILY+ +LPWFWKKS
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWFWKKS  90



>ref|XP_002454476.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
 gb|EES07452.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
Length=425

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMILMYIFETYL IRQH ALKLPTLPKPL+G IS  K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHE  TILMD+ ILY+ +LPWFWKKS
Sbjct  61   YFHFVHEAVTILMDTTILYYRVLPWFWKKS  90



>ref|XP_006828772.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
 gb|ERM96188.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
Length=424

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PYME+VVGFM+LMYIFETYL +RQHAALKLPTLP+PL G +SQ K EK +AYS+ KS
Sbjct  1    MALPYMESVVGFMVLMYIFETYLDLRQHAALKLPTLPRPLHGVVSQDKFEKSQAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHF+H   TI+MD +IL FG+LPWFW+KS
Sbjct  61   HFHFIHGVVTIVMDVSILLFGVLPWFWQKS  90



>ref|NP_001047739.1| Os02g0680400 [Oryza sativa Japonica Group]
 sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Oryza sativa Japonica 
Group]
 dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group]
 dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group]
 gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group]
Length=425

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMILMYIFETYL IRQH ALKLPTLPKPLVG IS  K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHF+HE  TILMD+ ILY+ +LPW WKKS
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWVWKKS  90



>gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group]
Length=425

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMILMYIFETYL IRQH ALK PTLPKPLVG IS  K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKEPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHF+HE  TILMD+ ILY+ +LPW WKKS
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWVWKKS  90



>ref|XP_010112964.1| CAAX prenyl protease 1-like protein [Morus notabilis]
 gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis]
Length=436

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  77   AVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHE  256
            A  GFMILMY FETYL +RQHAALKLPTLPK LVG ISQ K EK RAYS+ KS FHFVHE
Sbjct  20   ANTGFMILMYFFETYLDLRQHAALKLPTLPKTLVGVISQEKFEKSRAYSLDKSHFHFVHE  79

Query  257  FXTILMDSAILYFGILPWFWKKSLRFF  337
            F +ILMDS+IL+FG+LPWFWKKS  F 
Sbjct  80   FVSILMDSSILFFGVLPWFWKKSGDFL  106



>ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum]
Length=432

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  68   YMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHF  247
            YMEAVVGFMILMYIFETYL +RQH ALKLPTLPK L G I+Q K EK RAYS+ KS FHF
Sbjct  11   YMEAVVGFMILMYIFETYLDLRQHVALKLPTLPKSLKGVINQEKFEKSRAYSLDKSHFHF  70

Query  248  VHEFXTILMDSAILYFGILPWFWKKSLRF  334
            +H F TI+ DS ILYF +LPWFWKKS  F
Sbjct  71   IHAFVTIVTDSTILYFRVLPWFWKKSGDF  99



>ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays]
 gb|ACF79503.1| unknown [Zea mays]
 gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMI MYIFETYL IRQH ALKLPTLPKPL+G IS  K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLCFMIFMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHE  TILMD+ ILY+ +LPWFWKKS
Sbjct  61   YFHFVHEAVTILMDTTILYYRVLPWFWKKS  90



>gb|AFW63375.1| CAAX prenyl protease 1 [Zea mays]
Length=628

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMI MYIFETYL IRQH ALKLPTLPKPL+G IS  K E+ RAYS+ KS
Sbjct  204  MALPYLEAVLCFMIFMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  263

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHE  TILMD+ ILY+ +LPWFWKKS
Sbjct  264  YFHFVHEAVTILMDTTILYYRVLPWFWKKS  293



>ref|XP_004953446.1| PREDICTED: CAAX prenyl protease 1 homolog [Setaria italica]
Length=425

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMILMYIFETYL IRQH ALKLPTLPKPL+G IS  K ++ R YS+ KS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFKRSRDYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHE  TILMD+ ILY+ +LPWFWKKS
Sbjct  61   HFHFVHEAVTILMDTTILYYRVLPWFWKKS  90



>emb|CAB80941.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=459

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 74/97 (76%), Gaps = 7/97 (7%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA P+ME VVGFMI+MYIFETYL +RQ  ALKLPTLPK LVG ISQ K EK RAY    +
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYRDIIT  60

Query  236  D-------FHFVHEFXTILMDSAILYFGILPWFWKKS  325
            +       FHFVHEF TILMDSAIL+FGILPWFWK S
Sbjct  61   ENFNICSYFHFVHEFVTILMDSAILFFGILPWFWKMS  97



>ref|XP_008643874.1| PREDICTED: CAAX prenyl protease 1 isoform X2 [Zea mays]
Length=425

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA  Y+EAV+ FMILM+IFETYL IRQH ALKLPTLPKPL+G IS  K E+ RAYS+ KS
Sbjct  1    MALSYLEAVLCFMILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMD+ ILY+  +PWFWKKS
Sbjct  61   YFHFVHEFVTILMDTTILYYRSVPWFWKKS  90



>ref|XP_008643873.1| PREDICTED: CAAX prenyl protease 1 isoform X1 [Zea mays]
 gb|ACN31462.1| unknown [Zea mays]
 gb|AFW72802.1| CAAX prenyl protease 1 [Zea mays]
Length=437

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA  Y+EAV+ FMILM+IFETYL IRQH ALKLPTLPKPL+G IS  K E+ RAYS+ KS
Sbjct  1    MALSYLEAVLCFMILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             FHFVHEF TILMD+ ILY+  +PWFWKKS
Sbjct  61   YFHFVHEFVTILMDTTILYYRSVPWFWKKS  90



>ref|XP_004308344.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
 ref|XP_011468984.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=425

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFP+++ VVG MILMYIFETYL +RQH+ALKLPTLPK L G ISQ K EK RAY + +S
Sbjct  1    MAFPFLDVVVGSMILMYIFETYLDLRQHSALKLPTLPKTLEGVISQEKFEKSRAYRLERS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
             FHFV E   ILMD AIL+F +LPWFWKKS  F  +
Sbjct  61   HFHFVCELVRILMDLAILFFKVLPWFWKKSGHFVAL  96



>gb|KDP28583.1| hypothetical protein JCGZ_14354 [Jatropha curcas]
Length=423

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            M FPY+EAV+  MIL+YIFETYL +R+HA LKLPTLPK L G +SQ K EK RAYS+ KS
Sbjct  1    MEFPYLEAVLVVMILIYIFETYLALREHATLKLPTLPKALEGVVSQEKFEKSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             F FVH F T L DSAILYF ILPWFWKKS  F
Sbjct  61   RFGFVHGFVTTLTDSAILYFRILPWFWKKSGNF  93



>gb|KEH18809.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=436

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+EAV+GF ILMY FETYL +RQ  A KL TLPK L G IS+   +K R+YS+  S
Sbjct  1    MAFPYLEAVIGFKILMYFFETYLEVRQLRANKLTTLPKTLEGVISEDTFQKTRSYSLDHS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             FHFV +F TI+ DSAIL+FG++PWFWKKS  F
Sbjct  61   RFHFVCQFVTIVRDSAILFFGVMPWFWKKSEDF  93



>ref|XP_003570103.1| PREDICTED: CAAX prenyl protease 1 homolog [Brachypodium distachyon]
Length=425

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMIL+YIFETYL IRQH ALKLPTLPKPLVG IS  K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLCFMILLYIFETYLNIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            +F+FV E  TI  D  ILY+ +LPWFWKKS
Sbjct  61   NFNFVREAVTITSDIIILYYKVLPWFWKKS  90



>gb|AIC32889.1| STE24 [Puccinellia tenuiflora]
Length=424

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMIL YIFETYL IRQH ALKLPTLPK L G IS  K EK RAYS+ KS
Sbjct  1    MALPYLEAVLCFMILNYIFETYLNIRQHRALKLPTLPKSLAGVISGEKFEKARAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            +F+FV E  TI+ D  ILY+ +LPWFWKKS
Sbjct  61   NFNFVREGVTIVFDITILYYKVLPWFWKKS  90



>ref|XP_001780822.1| predicted protein [Physcomitrella patens]
 gb|EDQ54379.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +2

Query  47   NSAMAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSI  226
             S   FPY+EAVVGFM+ MY+FETYL +RQHAALKLPTLP PLVG +S  K EK +AYS+
Sbjct  2    ESPAPFPYLEAVVGFMVFMYLFETYLDMRQHAALKLPTLPAPLVGIVSMEKFEKAQAYSL  61

Query  227  XKSDFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFG  340
             KS FHFVH    I+ +SA L  G+LPW W KS    G
Sbjct  62   EKSRFHFVHAAVGIVEESATLLLGLLPWTWDKSGSLVG  99



>ref|XP_001783632.1| predicted protein [Physcomitrella patens]
 gb|EDQ51527.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +2

Query  47   NSAMAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSI  226
             ++  FPY+EAVVGFM+ MY+ ETYL IRQH ALKL  LP PL G +SQ K EK +AYS+
Sbjct  2    EASAPFPYLEAVVGFMLFMYMLETYLDIRQHGALKLSNLPAPLKGIVSQEKFEKAQAYSL  61

Query  227  XKSDFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFG  340
             KS FHFVH    I+ +SAIL  G+LPW W KS    G
Sbjct  62   DKSRFHFVHAAVNIVEESAILLLGLLPWAWDKSGSLVG  99



>gb|KCW78104.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=411

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   MILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEFXTIL  271
            MILM+ FETYL +RQHAA KLPTLPKPL G I Q K +K RAYS+ KS FHF+HEF +IL
Sbjct  1    MILMHFFETYLDLRQHAAYKLPTLPKPLEGVIGQEKFQKSRAYSLDKSRFHFLHEFVSIL  60

Query  272  MDSAILYFGILPWFWKKSLRFF  337
            MDSAIL FGILPWFWKKS  F 
Sbjct  61   MDSAILLFGILPWFWKKSGEFL  82



>emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MA PY+EAV+ FMIL YIFETYL IRQH ALKLPTLPK L   IS  K E+ RAYS+ KS
Sbjct  1    MALPYLEAVLCFMILNYIFETYLNIRQHRALKLPTLPKSLAKVISHEKFEQARAYSLDKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            +F+FV E  TI+ D  ILY+ +LPW WK S
Sbjct  61   NFNFVREAITIVCDIIILYYKVLPWLWKNS  90



>ref|NP_001152504.1| CAAX prenyl protease 1 [Zea mays]
 gb|ACG47950.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  92   MILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEFXTIL  271
            MILM+IFETYL IRQH ALKLPTLPKPL+G IS  K E+ RAYS+ KS FHFVHEF TIL
Sbjct  1    MILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKSYFHFVHEFVTIL  60

Query  272  MDSAILYFGILPWFWKKS  325
            MD+ ILY+  +PWFWKKS
Sbjct  61   MDTTILYYRSVPWFWKKS  78



>ref|XP_002961362.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
 gb|EFJ36622.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
Length=424

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKS  235
            MAFPY+E+VVGFMI MY  E+YL +RQ+ ALKLPTLP  L G +SQ K EK RAY+I KS
Sbjct  1    MAFPYLESVVGFMIFMYFVESYLHLRQYRALKLPTLPPTLEGVVSQEKFEKSRAYTIEKS  60

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
             F F+H   TI+ +  +L   ILPW W KS
Sbjct  61   RFQFIHSVWTIVEECCMLLLKILPWIWMKS  90



>ref|XP_003622452.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=195

 Score = 90.9 bits (224),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +2

Query  59   AFPYMEAVV----GFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSI  226
              P  +AV+    GF ILMY FETYL +RQ  A KL TLPK L G IS+   +K R+YS+
Sbjct  53   GLPQPKAVLVANDGFKILMYFFETYLEVRQLRANKLTTLPKTLEGVISEDTFQKTRSYSL  112

Query  227  XKSDFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
              S FHFV +F TI+ DSAIL+FG++PWFWKKS  F
Sbjct  113  DHSRFHFVCQFVTIVRDSAILFFGVMPWFWKKSEDF  148



>gb|KHN29321.1| CAAX prenyl protease 1 like [Glycine soja]
Length=375

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  179  GXISQXKXEKXRAYSIXKSDFHFVHEFXTILMDSAILYFGILPWFWKKSLRFFGV  343
            G ISQ K EK RAYS+ KS FHFVHEF TI+ DS ILYFG+LPWFWKKS  F  +
Sbjct  31   GVISQEKFEKSRAYSLDKSHFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTI  85



>gb|KFY09356.1| hypothetical protein V492_05514 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=698

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  256  FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  315

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  316  SFVSSLYGQIQNTAFIYYDILPKLW  340



>gb|KFY38041.1| hypothetical protein V494_04536 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=527

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  85   FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  144

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  145  SFVSSLYGQIQNTAFIYYDILPKLW  169



>gb|KFZ20107.1| hypothetical protein V502_03363 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=458

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLW  100



>gb|KFY87676.1| hypothetical protein V500_06835 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=679

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  237  FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  296

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  297  SFVSSLYGQIQNTAFIYYDILPKLW  321



>gb|KFZ02509.1| hypothetical protein V501_09542 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=680

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  238  FPWKKLIVGFSLAQYLFESYLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  297

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  298  SFVSSLYGQIQNTAFIYYDILPKLW  322



>gb|KFY76197.1| hypothetical protein V499_04041 [Pseudogymnoascus pannorum VKM 
F-103]
Length=680

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  238  FPWKKLIVGFSLAQYLFESYLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  297

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  298  SFVSSLYGQIQNTAFIYYDILPKLW  322



>gb|KFY59517.1| hypothetical protein V496_05652 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=458

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFWK  319
             FV      + ++A +Y+ ILP  W 
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWN  101



>gb|KFX89268.1| hypothetical protein V490_07139 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFX89748.1| hypothetical protein O988_08517 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY43474.1| hypothetical protein V495_03913 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY52182.1| hypothetical protein V497_08611 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=458

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLW  100



>gb|ELR10214.1| STE24 endopeptidase [Pseudogymnoascus destructans 20631-21]
Length=487

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  45   FPWKKLIVGFSLAQYLFESFLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  104

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  105  SFVSSLYGQVQNTAFIYYDILPKLW  129



>ref|XP_002945691.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
 gb|EFJ52686.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
Length=460

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   PYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFH  244
            PY+   VGF + +Y+F TYL +RQ  AL+ P+ P+ L G  S     K RAY++ K  F 
Sbjct  19   PYLHLYVGFTVAVYLFHTYLDVRQLRALRRPSPPEALAGLFSPELYAKTRAYNLDKWSFS  78

Query  245  FVHEFXTILMDSAILYFGILPWFW  316
            F H   + +   A++  G+LP+ W
Sbjct  79   FAHSLYSTVETLALILAGVLPYVW  102



>gb|KFY04966.1| hypothetical protein V491_09229 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=678

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE++L  RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  236  FPWKKLIVGFSLAQYLFESFLSARQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  295

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  296  SFVSSLYGQIQNTAFIYYDILPKLW  320



>gb|KFY19341.1| hypothetical protein V493_08005 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=458

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE++L  RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSARQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +Y+ ILP  W
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLW  100



>ref|XP_001559859.1| hypothetical protein BC1G_01418 [Botrytis cinerea B05.10]
 emb|CCD46490.1| similar to CaaX prenyl protease [Botrytis cinerea T4]
 gb|EMR91295.1| putative caax prenyl protease 1 protein [Botrytis cinerea BcDW1]
Length=456

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFEGFLSLRQYQVLKQTRPPKVLSNEVSQEVFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +YF ILP  W
Sbjct  76   GFVAGLYGQIQNTAFIYFDILPKLW  100



>ref|XP_003050604.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU44891.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=868

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FET+L +RQ+  L+    P  L   +SQ   +K +AY   K+ F
Sbjct  420  FPWKKLIMGFSVGQYLFETFLTLRQYRVLQNTKPPVVLSKEVSQEVFDKSQAYGRAKAKF  479

Query  242  HFVHEFXTILMDSAILYFGILPWFWKKS  325
              V+   + L + A ++F ILP  W  S
Sbjct  480  EIVNGLYSQLQNIAFMHFDILPKLWSWS  507



>gb|ESZ94952.1| putative CAAX prenyl protease 1 [Sclerotinia borealis F-4157]
Length=462

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFEGFLSLRQYQVLKQTRPPKVLSNEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFWK  319
             FV      + ++A +YF +LP  W+
Sbjct  76   GFVAGLYGQIQNTAFIYFDVLPKLWE  101



>ref|XP_001593172.1| hypothetical protein SS1G_06094 [Sclerotinia sclerotiorum 1980]
 gb|EDO03613.1| hypothetical protein SS1G_06094 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=461

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIVGFSLTQYLFEGFLSLRQYQILKQTRPPKVLSNEVSQEVFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +YF +LP  W
Sbjct  76   GFVAGLYGQIQNTAFIYFDVLPKLW  100



>emb|CCK69867.1| hypothetical protein KNAG_0D01150 [Kazachstania naganishii CBS 
8797]
Length=460

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +2

Query  59   AFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSD  238
            AFP+   V+G  +  + FETYL  RQ+  L    LP  LV  I +   EK + YS  K  
Sbjct  15   AFPWKSVVIGVTVAQFAFETYLSFRQYRVLARKQLPDVLVDEIDKETFEKSQEYSKAKIK  74

Query  239  FHFVHEFXTILMDSAILYFGILPWFW  316
            F  V +  ++L + A++ F +LP  W
Sbjct  75   FSVVSDVFSLLQNYALVKFNMLPRLW  100



>ref|XP_008080326.1| hypothetical protein GLAREA_07447 [Glarea lozoyensis ATCC 20868]
 gb|EHK96814.1| putative CAAX prenyl protease 1 [Glarea lozoyensis 74030]
 gb|EPE32314.1| hypothetical protein GLAREA_07447 [Glarea lozoyensis ATCC 20868]
Length=456

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y FE +L +RQ+  LK    PK L   +SQ   +K +AY   K+ +
Sbjct  16   FPWKKLIVGFSLAQYAFEGFLSLRQYQVLKQTKPPKVLKNEVSQEVFDKSQAYGRAKAKY  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + ++A +YF ILP  W
Sbjct  76   GFVSGLYGQIQNTAFIYFDILPKLW  100



>gb|KFM64976.1| CAAX prenyl protease 1-like protein, partial [Stegodyphus mimosarum]
Length=465

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = +2

Query  71   MEAVVGFMILMYIFETYLXIRQHAAlklptlpkplV-GXISQXKXEKXRAYSIXKSDFHF  247
            M A++ F  ++YI+E YL  RQH  ++  T   P + G + Q    K R Y++ KS F F
Sbjct  35   MTAIIAFTWVVYIWEAYLSYRQHVVMQKVTSVPPELAGVMDQTTYNKARLYNLDKSRFSF  94

Query  248  VHEFXTILMDSAILYFGILPWFWKKS  325
            V      +  +A+L FG +P+ W  S
Sbjct  95   VSSLYEQVFQTAVLVFGGIPFLWSAS  120



>gb|KIN03786.1| hypothetical protein OIDMADRAFT_158613 [Oidiodendron maius Zn]
Length=456

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+   +VGF I  Y+FE +L +RQ+  LK    PK L   +SQ   +K +AY   K+ +
Sbjct  16   FPWKNLIVGFSIAQYLFEGFLSLRQYRVLKQTRPPKVLQNEVSQDVFDKSQAYGRAKAKY  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++     + ++A +YF +LP  W
Sbjct  76   SLINGLYGQIQNTAFIYFDVLPKLW  100



>ref|XP_007917686.1| putative caax prenyl protease 1 protein [Togninia minima UCRPA7]
 gb|EON97602.1| putative caax prenyl protease 1 protein [Togninia minima UCRPA7]
Length=462

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE +L +RQ+  LK    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIIGFSVAQYVFEGFLSLRQYQVLKKAKPPKVLEQEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV+     + + A ++F +LP  W
Sbjct  76   EFVNGLYGQIQNIAFIHFDVLPKLW  100



>ref|XP_011115562.1| hypothetical protein H072_10056 [Dactylellina haptotyla CBS 200.50]
 gb|EPS36425.1| hypothetical protein H072_10056 [Dactylellina haptotyla CBS 200.50]
Length=439

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+   ++GF +  Y+FETYL  RQ+  L+   +PK L G + Q   +K +AY   K+DF
Sbjct  16   FPWKNLILGFSVAQYLFETYLSARQYKVLRGTRIPKQLEGSVEQDVFDKSQAYGRAKADF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             ++      + + + + F +LP  W
Sbjct  76   GYLRGLYGQVQNVSFIVFDVLPKLW  100



>emb|CCD77520.1| farnesylated-protein converting enzyme 1 (M48 family) [Schistosoma 
mansoni]
Length=473

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 1/81 (1%)
 Frame = +2

Query  77   AVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXI-SQXKXEKXRAYSIXKSDFHFVH  253
            AV  F+  MYI+ETYL IRQ   +         +  +    K +K R Y+I +S F  V 
Sbjct  20   AVFVFLWCMYIWETYLSIRQRRKIVDTRTVPIELASVMDNDKFQKSRLYAIDRSSFGLVS  79

Query  254  EFXTILMDSAILYFGILPWFW  316
             F  ++  S  LYF ++PW W
Sbjct  80   GFYHMIELSVTLYFSLIPWLW  100



>emb|CCT67513.1| probable zinc metallo-protease [Fusarium fujikuroi IMI 58289]
Length=463

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++ F + + + A ++F +LP  W
Sbjct  76   EIINGFYSQVQNIAFMHFDVLPKLW  100



>gb|EER44696.1| CaaX prenyl protease [Histoplasma capsulatum H143]
Length=456

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  YI E +L +RQ+  L+    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQYIIEGFLSLRQYKILQQKKPPKVLAEEVSQSVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y+ +LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYYDVLPKLW  100



>gb|EEH10632.1| CaaX prenyl protease [Histoplasma capsulatum G186AR]
Length=456

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  YI E +L +RQ+  L+    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQYIIEGFLSLRQYKILQQKKPPKVLAEEVSQSVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y+ +LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYYDVLPKLW  100



>gb|EGC45621.1| CaaX prenyl protease [Histoplasma capsulatum H88]
Length=456

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  YI E +L +RQ+  L+    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQYIIEGFLSLRQYKILQQKKPPKVLAEEVSQSVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y+ +LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYYDVLPKLW  100



>emb|CCX14243.1| Similar to CAAX prenyl protease 1; acc. no. P47154 [Pyronema 
omphalodes CBS 100304]
Length=438

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  59   AFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSD  238
             FP+   ++GF    Y+ ET+L  RQH  L+   +PK L G + +   +K +AY   KS+
Sbjct  15   GFPWKTLIIGFSASQYLLETWLSYRQHKKLQETKVPKALEGVVEKEVYDKSQAYGRAKSN  74

Query  239  FHFVHEFXTILMDSAILYFGILPWFW  316
            F FV       ++ A +++ ILP  W
Sbjct  75   FSFVTSLFGQAINIATIHYDILPKLW  100



>gb|EZF34879.1| hypothetical protein H101_01566, partial [Trichophyton interdigitale 
H6]
Length=315

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQ   +K +AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y  +LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYGDVLPKLW  100



>emb|CDS32581.1| farnesylated protein converting enzyme 1 [Hymenolepis microstoma]
Length=882

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  59   AFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXI-SQXKXEKXRAYSIXKS  235
            +F    A++ F+ L++ +ETYL +RQ +  K        +  I S+   +K R YSI K 
Sbjct  13   SFSCYNAIIIFVWLLFAWETYLNLRQISLAKKTIKRPQQIEKIMSEEDFDKSRRYSIEKM  72

Query  236  DFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            +F  V  F  I+  S +L+FG++ W W  S
Sbjct  73   NFEVVSSFYNIISMSVVLHFGLIAWAWNIS  102



>gb|EGE06070.1| CAAX prenyl protease [Trichophyton equinum CBS 127.97]
 gb|KDB23738.1| hypothetical protein H109_04418 [Trichophyton interdigitale MR816]
Length=457

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQ   +K +AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y  +LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYGDVLPKLW  100



>ref|XP_008468578.1| PREDICTED: uncharacterized protein C10orf118 homolog [Diaphorina 
citri]
Length=858

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/91 (31%), Positives = 46/91 (51%), Gaps = 1/91 (1%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGX-ISQXKXEKXRAYSIXK  232
            + F     ++GF  ++++FE YL IRQ       T+    +   +     EK R YS+ K
Sbjct  5    LEFQIFYGIIGFSWIVFLFEFYLSIRQRRVYHETTIVPHQIAHGMDAESFEKSRRYSLDK  64

Query  233  SDFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            + F    E  + +M++A+L    LP+FW KS
Sbjct  65   NVFSMFKETVSNVMNTALLVCNGLPYFWSKS  95



>gb|KFH71808.1| hypothetical protein MVEG_02102 [Mortierella verticillata NRRL 
6337]
Length=451

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FPY   V+GFM+L++ +E YL +R ++ L+    PK L   ++  + +K +AY   K+ F
Sbjct  25   FPYKAFVLGFMLLVFYWEEYLRLRHYSNLRSKECPKALREHVTDEEFQKAQAYGRDKATF  84

Query  242  HFVHEFXTILMDSAILYFGILPWFWKKSLR  331
             FV      +  + +L    LPW W  S R
Sbjct  85   GFVSNLVDQIQSALMLVLDFLPWLWGVSGR  114



>ref|XP_011121081.1| hypothetical protein AOL_s00076g226 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX50261.1| hypothetical protein AOL_s00076g226 [Arthrobotrys oligospora 
ATCC 24927]
Length=439

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FETYL  RQ+  L+   +P  L G + +   +K +AY   K+DF
Sbjct  16   FPWKKLILGFSVAQYLFETYLSARQYKVLRKDKIPNQLDGAVEKEVFDKSQAYGRAKADF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             ++      L +   + + +LP  W
Sbjct  76   GYIKGLYGQLQNVGFIVYDVLPKLW  100



>ref|XP_003023010.1| hypothetical protein TRV_02831 [Trichophyton verrucosum HKI 0517]
 gb|EFE42392.1| hypothetical protein TRV_02831 [Trichophyton verrucosum HKI 0517]
Length=585

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQ   +K +AY   K+ F
Sbjct  143  FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  202

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y  +LP  W
Sbjct  203  GFVSGLYSQIQNLAFIYGDVLPKIW  227



>gb|EGD96703.1| CaaX prenyl protease [Trichophyton tonsurans CBS 112818]
Length=431

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQ   +K +AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y  +LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYGDVLPKLW  100



>ref|XP_003685564.1| hypothetical protein TPHA_0E00340 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE63130.1| hypothetical protein TPHA_0E00340 [Tetrapisispora phaffii CBS 
4417]
Length=457

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = +2

Query  65   PYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFH  244
            P+   ++   I  ++FETYL +RQ+  L    LP  L   I Q   EK   YS  K+ F 
Sbjct  17   PWKSIILSISIAQFVFETYLTVRQYKVLSGKKLPPVLENEIDQETFEKTEKYSKAKAKFS  76

Query  245  FVHEFXTILMDSAILYFGILPWFWKKS  325
             +    ++L ++A+L++ ++P  W ++
Sbjct  77   IIVSIYSLLQNAAVLHYDLMPLIWNRA  103



>ref|XP_009254473.1| hypothetical protein FPSE_03079 [Fusarium pseudograminearum CS3096]
 gb|EKJ76893.1| hypothetical protein FPSE_03079 [Fusarium pseudograminearum CS3096]
Length=463

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              V+   + + + A ++F +LP  W
Sbjct  76   EIVNGLYSQVQNIAFMHFDVLPKLW  100



>ref|XP_002584079.1| hypothetical protein UREG_04768 [Uncinocarpus reesii 1704]
 gb|EEP79926.1| hypothetical protein UREG_04768 [Uncinocarpus reesii 1704]
Length=456

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
             P+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQ   EK +AY   K+ F
Sbjct  16   LPWKKIIVGFSLGQYLLEGFLSLRQYKVLQQKRPPKVLEGEVSQEVFEKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y+  LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYYDALPKLW  100



>gb|KHJ35024.1| putative peptidase family m48 [Erysiphe necator]
Length=456

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 54/101 (53%), Gaps = 4/101 (4%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+   ++GF I  Y+FE  L +RQ+  LKL   PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKNLILGFSIGQYVFEGLLSLRQYKVLKLTHPPKVLQNEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFWKKS----LRFFGVPWS  352
              +      + ++A +Y+ ILP  W  +    LR+F V +S
Sbjct  76   GLITGLLGQIQNTAFIYYDILPKLWTLTGSWLLRYFPVRFS  116



>ref|XP_003012809.1| hypothetical protein ARB_01060 [Arthroderma benhamiae CBS 112371]
 gb|EFE32169.1| hypothetical protein ARB_01060 [Arthroderma benhamiae CBS 112371]
Length=580

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQ   +K +AY   K+ F
Sbjct  151  FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  210

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y  +LP  W
Sbjct  211  GFVSGLYSQIQNLAFIYGDVLPKIW  235



>gb|AAB61028.1| A_IG002N01.21 gene product [Arabidopsis thaliana]
Length=316

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAA  145
            MA P+ME VVGFMI+MYIFETYL +RQ  A
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTA  30



>gb|KIL91310.1| hypothetical protein FAVG1_04924 [Fusarium avenaceum]
Length=463

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              V+   + + + A ++F +LP  W
Sbjct  76   EIVNGLYSQVQNIAFMHFDVLPKLW  100



>gb|KDB15160.1| putative zinc metallo-protease [Ustilaginoidea virens]
Length=458

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+    P  L   ISQ   +K +AY   K+ F
Sbjct  16   FPWKKLILGFSVGQYLFESFLTLRQYRILQKTQPPAVLAKEISQHTFDKSQAYGRAKARF  75

Query  242  HFVHEFXTILMDSAILYFGILP--WFWKKSL  328
              V      + + A +++ +LP  W W  SL
Sbjct  76   EIVSGLYAQIQNVAFIHYDVLPKLWSWTGSL  106



>ref|XP_453545.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAH00641.1| KLLA0D10846p [Kluyveromyces lactis]
Length=456

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 41/86 (48%), Gaps = 0/86 (0%)
 Frame = +2

Query  59   AFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSD  238
            + P+   + GF +  + FETYL  RQ+ AL    LP  LVG I     +K  AYS  KS 
Sbjct  16   SIPWKTIITGFTVAQFGFETYLTYRQYLALSNKNLPPVLVGEIDDETFQKSEAYSRAKSK  75

Query  239  FHFVHEFXTILMDSAILYFGILPWFW  316
            F  V     +  +   + F ILP  W
Sbjct  76   FSIVSNVINLAQNLIFIKFDILPKLW  101



>ref|XP_003236858.1| CaaX prenyl protease [Trichophyton rubrum CBS 118892]
 gb|EGD85309.1| hypothetical protein TERG_01583 [Trichophyton rubrum CBS 118892]
 gb|EZF13842.1| hypothetical protein H100_06223 [Trichophyton rubrum MR850]
 gb|EZF39575.1| hypothetical protein H102_06190 [Trichophyton rubrum CBS 100081]
 gb|EZF50099.1| hypothetical protein H103_06215 [Trichophyton rubrum CBS 288.86]
 gb|EZF60731.1| hypothetical protein H104_06202 [Trichophyton rubrum CBS 289.86]
 gb|EZF71568.1| hypothetical protein H105_06229 [Trichophyton soudanense CBS 
452.61]
 gb|EZF82058.1| hypothetical protein H110_06211 [Trichophyton rubrum MR1448]
 gb|EZF92801.1| hypothetical protein H113_06258 [Trichophyton rubrum MR1459]
 gb|EZG03811.1| hypothetical protein H106_06053 [Trichophyton rubrum CBS 735.88]
 gb|EZG14381.1| hypothetical protein H107_06355 [Trichophyton rubrum CBS 202.88]
 gb|KDB31307.1| hypothetical protein H112_06208 [Trichophyton rubrum D6]
Length=459

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQ   +K +AY   K+ F
Sbjct  17   FPWKKIIVGFSLGQYLLEGFLSLRQYKILQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  76

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y  +LP  W
Sbjct  77   GFVSGLYSQIQNLAFIYGDVLPKIW  101



>ref|XP_003067440.1| CAAX prenyl protease, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER25295.1| CAAX prenyl protease, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW19732.1| CaaX prenyl protease [Coccidioides posadasii str. Silveira]
Length=455

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQ   +K +AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYRILQQKKPPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y+  LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYYDALPKLW  100



>ref|XP_001239931.1| hypothetical protein CIMG_09552 [Coccidioides immitis RS]
 gb|EAS28348.1| CaaX prenyl protease [Coccidioides immitis RS]
Length=455

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQ   +K +AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYRILQQKKPPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y+  LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYYDALPKLW  100



>gb|EXL53967.1| STE24 endopeptidase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++   + + + A ++F +LP  W
Sbjct  76   EIINGLYSQVQNLAFMHFDVLPKLW  100



>gb|EWZ02551.1| STE24 endopeptidase [Fusarium oxysporum FOSC 3-a]
 gb|EWZ48634.1| STE24 endopeptidase [Fusarium oxysporum Fo47]
 gb|EWZ93702.1| STE24 endopeptidase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41803.1| STE24 endopeptidase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK45987.1| STE24 endopeptidase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK96784.1| STE24 endopeptidase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXM34146.1| STE24 endopeptidase [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++   + + + A ++F +LP  W
Sbjct  76   EIINGLYSQVQNLAFMHFDVLPKLW  100



>gb|EXM07215.1| STE24 endopeptidase [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++   + + + A ++F +LP  W
Sbjct  76   EIINGLYSQVQNLAFMHFDVLPKLW  100



>ref|XP_011324509.1| hypothetical protein FGSG_12839 [Fusarium graminearum PH-1]
 gb|ESU11933.1| hypothetical protein FGSG_12839 [Fusarium graminearum PH-1]
 gb|EYB33412.1| hypothetical protein FG05_12839 [Fusarium graminearum]
 emb|CEF86797.1| unnamed protein product [Fusarium graminearum]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++   + + + A ++F +LP  W
Sbjct  76   EIINGLYSQVQNIAFMHFDVLPKLW  100



>gb|EGU84979.1| hypothetical protein FOXB_04560 [Fusarium oxysporum Fo5176]
 gb|EXL82603.1| STE24 endopeptidase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRVKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++   + + + A ++F +LP  W
Sbjct  76   EIINGLYSQVQNLAFMHFDVLPKLW  100



>gb|EWG42807.1| STE24 endopeptidase [Fusarium verticillioides 7600]
Length=463

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++   + + + A ++F +LP  W
Sbjct  76   EIINGLYSQVQNIAFMHFDVLPKLW  100



>gb|KGB37699.1| CAAX prenyl protease 1-like protein [Schistosoma haematobium]
Length=473

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +2

Query  77   AVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXI-SQXKXEKXRAYSIXKSDFHFVH  253
            AV  F+  MYI+ETYL IRQ   +         +  +    K +K R Y+I +S F  V 
Sbjct  20   AVFVFLWCMYIWETYLSIRQRRKIVDTRTVPIELASVMDNDKFQKSRLYAIDRSSFGLVS  79

Query  254  EFXTILMDSAILYFGILPWFW  316
                ++  S  LYF ++PW W
Sbjct  80   GLYHMIELSVTLYFSLIPWLW  100



>ref|XP_001540370.1| CaaX prenyl protease [Histoplasma capsulatum NAm1]
 gb|EDN07700.1| CaaX prenyl protease [Histoplasma capsulatum NAm1]
Length=453

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  YI E +L +RQ+  L+    PK L   +SQ   +K +AY   K+ F
Sbjct  13   FPWKKVIVGFSVGQYIIEGFLSLRQYKILQQKKPPKVLAEEVSQSVFDKSQAYGRAKAKF  72

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y+  LP  W
Sbjct  73   GFVSGLYSQIQNLAFIYYDALPKLW  97



>emb|CCE28602.1| probable zinc metallo-protease [Claviceps purpurea 20.1]
Length=464

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF I  Y+FE++L +RQ+  L+    P  L   ISQ   +K +AY   K+ F
Sbjct  16   FPWRKLILGFSIGQYVFESFLTLRQYRVLQSTKPPAVLAKEISQETFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              +      + + A + + +LP  W
Sbjct  76   EIISGLWAQIQNVAFIQYDVLPKLW  100



>emb|CCE44422.1| hypothetical protein CPAR2_402230 [Candida parapsilosis]
Length=465

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  80   VVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEF  259
            + GF I  Y+FETYL  RQ+  LK  + P  +   + Q   +K + YS  K+ F      
Sbjct  22   IAGFTIGQYVFETYLDYRQYKVLKNKSPPASIKAEVDQATFDKSQKYSRSKAKFSIFSST  81

Query  260  XTILMDSAILYFGILPWFWKKS  325
              +L + AIL F  LP  W KS
Sbjct  82   FGLLQNLAILRFDFLPRLWNKS  103



>emb|CDH48818.1| prenyl protease [Lichtheimia corymbifera JMRC:FSU:9682]
Length=447

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 44/91 (48%), Gaps = 0/91 (0%)
 Frame = +2

Query  68   YMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHF  247
            Y + V+GF   +Y FE YL  RQH    +   P+ L   +++    K ++Y++ KS F F
Sbjct  16   YKDYVLGFSCAVYAFEQYLNYRQHCRYLMRERPQDLADIVNETDFSKSQSYNLEKSRFAF  75

Query  248  VHEFXTILMDSAILYFGILPWFWKKSLRFFG  340
            V      L     L++ +LPW W  S R   
Sbjct  76   VENAYKQLEILLQLHYDVLPWLWDFSGRLLS  106



>gb|EMT24778.1| CAAX prenyl protease 1-like protein [Aegilops tauschii]
Length=355

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAA  145
            MA PY+EAV+ FM L YIFETYL IRQH A
Sbjct  1    MALPYLEAVLCFMTLNYIFETYLNIRQHRA  30



>gb|EFQ29725.1| peptidase family M48 [Colletotrichum graminicola M1.001]
Length=454

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+   ++GF I  +IFE+ L +RQ+  LK    PK L   +SQ   +K +AY+  K++F
Sbjct  16   FPWKRLILGFSIGQFIFESLLSLRQYQVLKKNKPPKVLEQEVSQEVFDKSQAYNRAKAEF  75

Query  242  HFVHEFXTILMDSAILYFGILP--WFWKKSL  328
             F++     + + A + F +LP  W W  +L
Sbjct  76   GFINNLWGQIQNIAFIQFDVLPKLWSWSGNL  106



>emb|CCG83629.1| CaaX prenyl protease Ste24 [Taphrina deformans PYCC 5710]
Length=448

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 5/89 (6%)
 Frame = +2

Query  65   PYMEAVVGFMILMYIFE-----TYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIX  229
            P+   V+GF +  + FE      +L +RQ+  L+  T+PK L G I Q   +K +AY   
Sbjct  22   PWKNLVIGFTLAQFTFERLLIRQFLALRQYRKLQSKTIPKALAGVIDQDTFDKSQAYGRA  81

Query  230  KSDFHFVHEFXTILMDSAILYFGILPWFW  316
            K+ F F      ++ + A+L F +LPW W
Sbjct  82   KAKFGFFTSVYGLVQNLAVLSFNVLPWMW  110



>ref|XP_004226161.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Ciona intestinalis]
Length=469

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  74   EAVVGFMILMYIFETYLXIRQHAA-lklptlpkplVGXISQXKXEKXRAYSIXKSDFHFV  250
            E+V+GF  ++Y++E+YL  RQH+  + + ++PK L   I Q   +K R Y++ KS + F 
Sbjct  4    ESVLGFSWIVYLWESYLSKRQHSIYVNVQSVPKELTSVIDQSTFDKSRRYALDKSTYGFW  63

Query  251  HEFXTILMDSAILYFGILPWFWKKS  325
            +   + +  +AIL+ G LP+ W  S
Sbjct  64   NGLYSQIESTAILWLGGLPFLWAAS  88



>gb|KGQ04223.1| CAAX prenyl protease 1 [Beauveria bassiana D1-5]
Length=455

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  YIFE++L  RQ+  L+    P  L   I Q   +K +AY   K+ F
Sbjct  16   FPWKKLLLGFSVGQYIFESFLTFRQYRILQATKPPAVLAKEIPQDTFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              V  F + + + A ++F +LP  W
Sbjct  76   GLVSGFWSQIQNFAFIHFDLLPKLW  100



>ref|XP_002627156.1| CaaX prenyl protease [Blastomyces dermatitidis SLH14081]
 gb|EEQ74796.1| CaaX prenyl protease [Blastomyces dermatitidis SLH14081]
 gb|EEQ88614.1| CaaX prenyl protease [Blastomyces dermatitidis ER-3]
 gb|EGE77219.1| CaaX prenyl protease [Blastomyces dermatitidis ATCC 18188]
 gb|EQL38711.1| STE24 endopeptidase [Blastomyces dermatitidis ATCC 26199]
Length=456

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  +I E +L +RQ+  L+    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQFILEGFLSLRQYGILQKTKPPKVLEEEVSQSVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + + AI+Y+  LP  W
Sbjct  76   GFVSGLYGQIQNLAIIYYDALPKLW  100



>gb|KHN95623.1| Peptidase M48 [Metarhizium album ARSEF 1941]
Length=493

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  YIFE++L +RQ+  L+    P  L   ISQ   +K +AY   K+ F
Sbjct  53   FPWKKLILGFSVGQYIFESFLTLRQYRILQQTKPPAVLSKEISQETFDKSQAYGRAKAQF  112

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              +      + + A + F +LP  W
Sbjct  113  DIISGLWAQVQNVAFIQFDVLPKLW  137



>ref|XP_010759714.1| hypothetical protein PADG_04087 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH19164.1| hypothetical protein PABG_01483 [Paracoccidioides brasiliensis 
Pb03]
 gb|EEH48003.1| hypothetical protein PADG_04087 [Paracoccidioides brasiliensis 
Pb18]
Length=456

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+    PK L   +SQ   +K +AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQYLIEGFLSLRQYRVLQQTKPPKVLAEEVSQSVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV      + + A +Y+  LP  W
Sbjct  76   GFVSSLYGQIQNLAFIYYDALPKLW  100



>ref|XP_007834407.1| hypothetical protein PFICI_07635 [Pestalotiopsis fici W106-1]
 gb|ETS80106.1| hypothetical protein PFICI_07635 [Pestalotiopsis fici W106-1]
Length=453

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF I  Y+FE +L  RQ+  LK    PK L   ISQ   +K + Y   K+ F
Sbjct  16   FPWKKVIIGFSIGQYLFEEFLSYRQYQVLKKSKPPKVLEAEISQETYDKSQEYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             F+      + + A ++F +LP  W
Sbjct  76   GFIKGLYGQIQNIAFIHFDVLPKLW  100



>ref|XP_002842311.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ86502.1| unnamed protein product [Tuber melanosporum]
Length=438

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +2

Query  59   AFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSD  238
             F +   ++G  +  Y FE+YL IRQH  L+    PK L   ++Q   +K +AY   KS 
Sbjct  15   GFDWKGLIIGIGLAHYAFESYLSIRQHKKLQETKPPKSLEAAVTQEVHDKSQAYGRAKSK  74

Query  239  FHFVHEFXTILMDSAILYFGILPWFW  316
            + FV  F   + + + +YF +LP  W
Sbjct  75   YGFVESFFGQVTNVSTIYFDVLPKGW  100



>gb|EJY68063.1| Zn-dependent protease with chaperone function [Oxytricha trifallax]
Length=1433

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (51%), Gaps = 0/95 (0%)
 Frame = +2

Query  50    SAMAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIX  229
             S   FPY+ AV+ F IL+Y+FE YL  RQ+       +PK +   ++  + EK +A++  
Sbjct  986   SKQVFPYIYAVLAFEILVYLFEQYLNWRQYKKYCEKEMPKEITTIVTMEQFEKSQAHNKD  1045

Query  230   KSDFHFVHEFXTILMDSAILYFGILPWFWKKSLRF  334
             K +F F+  +      +    F +  W W  S++ 
Sbjct  1046  KMEFEFLKNYLEQFESTLWQLFRMPVWLWGYSVQL  1080



>ref|XP_003869947.1| Ste24 prenyl-dependent protease [Candida orthopsilosis Co 90-125]
 emb|CCG23815.1| Ste24 prenyl-dependent protease [Candida orthopsilosis]
Length=465

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  80   VVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEF  259
            + GF +  Y+FETYL  RQ+  LK  + P  +   + Q   +K + YS  K+ F      
Sbjct  22   IAGFTVGQYVFETYLDYRQYQVLKNKSPPASIKAEVDQATFDKSQKYSRSKAKFSIFSST  81

Query  260  XTILMDSAILYFGILPWFWKKS  325
              +L + AIL F  LP  W KS
Sbjct  82   FGLLQNLAILRFDFLPKLWSKS  103



>ref|XP_007376706.1| hypothetical protein SPAPADRAFT_62544 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW30673.1| hypothetical protein SPAPADRAFT_62544 [Spathaspora passalidarum 
NRRL Y-27907]
Length=456

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  80   VVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEF  259
            ++GF +  +IFE YL  RQ+  L+  + P  +   +SQ   EK +AYS  KS F     F
Sbjct  22   ILGFTVGQFIFENYLEYRQYRVLQRKSPPASIKKEVSQETFEKSQAYSRAKSKFSIFSGF  81

Query  260  XTILMDSAILYFGILPWFWK  319
              ++ + AI+ F +LP  W 
Sbjct  82   YGLVQNLAIIKFDVLPKAWN  101



>emb|CDO93753.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=455

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 41/84 (49%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   PYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFH  244
            P+   + GF +  + FETYL  RQ+ AL   TLP  LVG I     +K  AY+  KS F 
Sbjct  17   PWKTIITGFTVAQFAFETYLTYRQYVALSKKTLPPVLVGEIDDETFQKSEAYARAKSKFS  76

Query  245  FVHEFXTILMDSAILYFGILPWFW  316
             V     +  +   + + +LP  W
Sbjct  77   IVSNVINLAQNLIFIKYDVLPKLW  100



>ref|XP_460632.1| DEHA2F06248p [Debaryomyces hansenii CBS767]
 emb|CAG88960.1| DEHA2F06248p [Debaryomyces hansenii CBS767]
Length=446

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  80   VVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEF  259
            +VGF +  ++FE YL  RQ+  LK  T P  L   +SQ   +K + YS  K+ F F+ + 
Sbjct  22   IVGFTVGQFLFENYLDYRQYQVLKRTTPPDTLKAEVSQETFDKSQDYSRAKAKFGFLSDS  81

Query  260  XTILMDSAILYFGILPWFWK  319
              +  + AI+ + +LP FW 
Sbjct  82   INLFQNLAIIKYDLLPKFWN  101



>emb|CDS07769.1| hypothetical protein LRAMOSA01718 [Absidia idahoensis var. thermophila]
Length=447

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 43/91 (47%), Gaps = 0/91 (0%)
 Frame = +2

Query  68   YMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHF  247
            Y + V+GF   +Y FE YL  RQH    +   P  L   +++    K ++Y++ KS F F
Sbjct  16   YKDYVLGFSCAVYAFEQYLNYRQHRRYLMRERPHDLADIVNETDFSKSQSYNLEKSRFAF  75

Query  248  VHEFXTILMDSAILYFGILPWFWKKSLRFFG  340
            V      L     L++ +LPW W  S R   
Sbjct  76   VENAYKQLEILLQLHYDVLPWLWDFSGRLLS  106



>ref|XP_713382.1| potential a-factor pheromone maturation protease [Candida albicans 
SC5314]
 ref|XP_713335.1| potential a-factor pheromone maturation protease [Candida albicans 
SC5314]
 gb|EAK94218.1| potential a-factor pheromone maturation protease [Candida albicans 
SC5314]
 gb|EAK94265.1| potential a-factor pheromone maturation protease [Candida albicans 
SC5314]
 gb|EEQ45429.1| CAAX prenyl protease 1 [Candida albicans WO-1]
Length=456

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  80   VVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEF  259
            +VGF I  Y+FETYL +RQ+  L+  T PK +   +SQ   +K + YS  K+ F      
Sbjct  33   IVGFTIGQYVFETYLDLRQYRVLQSKTAPKSIEKEVSQETFDKSQEYSRAKAQFSVFSST  92

Query  260  XTILMDSAILYFGILPWFW  316
             ++L + AI  + +LP  W
Sbjct  93   FSLLQNLAIFKYDLLPKTW  111



>gb|ELQ35873.1| CAAX prenyl protease 1 [Magnaporthe oryzae Y34]
 gb|ELQ68969.1| CAAX prenyl protease 1 [Magnaporthe oryzae P131]
Length=514

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 49/92 (53%), Gaps = 0/92 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y FE++L +RQ+  L+    PK L   ISQ   +K +AY   K+ +
Sbjct  71   FPWKKLIVGFSLAHYFFESFLSLRQYQVLQKTKPPKVLEQQISQEVFDKSQAYGRAKAKY  130

Query  242  HFVHEFXTILMDSAILYFGILPWFWKKSLRFF  337
             FV +    + + A + + +LP  W  S R  
Sbjct  131  GFVSKLWGQIQNIAFIQYDVLPKLWAWSGRLL  162



>gb|KGQ86300.1| STE24 endopeptidase [Candida albicans P94015]
 gb|KGQ89995.1| STE24 endopeptidase [Candida albicans P37005]
 gb|KGQ96997.1| STE24 endopeptidase [Candida albicans GC75]
 gb|KGR07975.1| STE24 endopeptidase [Candida albicans P57072]
 gb|KGR09804.1| STE24 endopeptidase [Candida albicans P78048]
 gb|KGR16113.1| STE24 endopeptidase [Candida albicans P37037]
 gb|KGT68274.1| STE24 endopeptidase [Candida albicans 12C]
 gb|KGU07506.1| STE24 endopeptidase [Candida albicans P87]
 gb|KGU09020.1| STE24 endopeptidase [Candida albicans 19F]
 gb|KGU10550.1| STE24 endopeptidase [Candida albicans L26]
 gb|KGU25899.1| STE24 endopeptidase [Candida albicans P34048]
 gb|KGU29279.1| STE24 endopeptidase [Candida albicans P75063]
 gb|KGU29824.1| STE24 endopeptidase [Candida albicans P57055]
 gb|KHC35689.1| STE24 endopeptidase [Candida albicans P76067]
 gb|KHC41510.1| STE24 endopeptidase [Candida albicans Ca6]
 gb|KHC51116.1| STE24 endopeptidase [Candida albicans P60002]
 gb|KHC53022.1| STE24 endopeptidase [Candida albicans P37039]
 gb|KHC62950.1| STE24 endopeptidase [Candida albicans P75010]
 gb|KHC69067.1| STE24 endopeptidase [Candida albicans P75016]
 gb|KHC77345.1| STE24 endopeptidase [Candida albicans P78042]
 gb|KHC77979.1| STE24 endopeptidase [Candida albicans SC5314]
 gb|KHC86830.1| STE24 endopeptidase [Candida albicans SC5314]
Length=445

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  80   VVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEF  259
            +VGF I  Y+FETYL +RQ+  L+  T PK +   +SQ   +K + YS  K+ F      
Sbjct  22   IVGFTIGQYVFETYLDLRQYRVLQSKTAPKSIEKEVSQETFDKSQEYSRAKAQFSVFSST  81

Query  260  XTILMDSAILYFGILPWFW  316
             ++L + AI  + +LP  W
Sbjct  82   FSLLQNLAIFKYDLLPKTW  100



>ref|XP_003172087.1| CAAX prenyl protease 1 [Microsporum gypseum CBS 118893]
 gb|EFR01676.1| CAAX prenyl protease 1 [Microsporum gypseum CBS 118893]
Length=457

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQ   +K +AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKFLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
             FV    + + + A +Y   LP  W
Sbjct  76   GFVSGLYSQIQNLAFIYGDALPKLW  100



>gb|KHC34914.1| STE24 endopeptidase [Candida albicans P76055]
Length=445

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  80   VVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVHEF  259
            +VGF I  Y+FETYL +RQ+  L+  T PK +   +SQ   +K + YS  K+ F      
Sbjct  22   IVGFTIGQYVFETYLDLRQYRVLQSKTAPKSIEKEVSQETFDKSQEYSRAKAQFSVFSST  81

Query  260  XTILMDSAILYFGILPWFW  316
             ++L + AI  + +LP  W
Sbjct  82   FSLLQNLAIFKYDLLPKTW  100



>ref|XP_002154940.2| PREDICTED: CAAX prenyl protease 1 homolog [Hydra vulgaris]
Length=385

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = +2

Query  56   MAFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplV-GXISQXKXEKXRAYSIXK  232
            M  P    V+ FM + +++ETYL  RQH            +   + +   EK R Y + +
Sbjct  1    MVDPIFAGVLTFMWITFLWETYLSYRQHKVYLNTKDIPVELKDSLDKQTFEKSRLYQVDR  60

Query  233  SDFHFVHEFXTILMDSAILYFGILPWFWKKS  325
            S F FV    + L  + IL FG LP+ W  S
Sbjct  61   SKFGFVSSIYSQLELTVILLFGGLPFLWAVS  91



>dbj|GAA32070.1| STE24 endopeptidase [Clonorchis sinensis]
Length=472

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query  77   AVVGFMILMYIFETYLXIRQ-HAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVH  253
            AV  F+ L+Y++ETYL  RQ    L    +P  LV  I+  +  K +AY + K  F F H
Sbjct  19   AVFCFLWLVYLWETYLDRRQRQVVLNTSNVPSELVHVINADEFSKSKAYVLDKMMFSFFH  78

Query  254  EFXTILMDSAILYFGILPWFWKK  322
            +   +L  + +L+F ++PW W K
Sbjct  79   DAYDMLEATLVLWFSVVPWLWDK  101



>gb|AAZ80484.1| membrane-associated metalloproteinase [Taenia solium]
Length=472

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +2

Query  74   EAVVGFMILMYIFETYLXIRQ-HAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFV  250
             A++ F+ +++++ETY+ +RQ   A ++   P+ +   ++    +K R Y+I K +F  V
Sbjct  18   NAILIFIWVLFLWETYINLRQLKVAKRVTESPEEIKCLMNDVDFDKSRRYAIDKMNFDIV  77

Query  251  HEFXTILMDSAILYFGILPWFWKKS  325
              F  IL  SA+LYF ++ W W KS
Sbjct  78   SGFYNILSLSAVLYFQLIAWAWHKS  102



>gb|KFH61944.1| hypothetical protein MVEG_12278 [Mortierella verticillata NRRL 
6337]
Length=450

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 4/99 (4%)
 Frame = +2

Query  59   AFPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSD  238
            AFPYM  ++G   L + +E Y+  R +  L    LP  L G +S+ +  K +AY   K+ 
Sbjct  21   AFPYMNTLLGCKYLFFFWEQYILYRHYRNLCSKVLPTALKGYVSEEQFRKAQAYGRDKTR  80

Query  239  FHFVHEFXTILMDSAILYFGILPWFWKKS----LRFFGV  343
              F     +++ +S  L   +LPW W  S     RF G+
Sbjct  81   CSFSKATFSLVQESLWLTCDVLPWLWGVSGRIMFRFLGL  119



>gb|KID96212.1| Peptidase M48, partial [Metarhizium majus ARSEF 297]
Length=456

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + +VGF +  Y+FE++L +RQ+  L+    P  L   ISQ   +K +AY   K+ F
Sbjct  16   FPWKKLIVGFSVGQYLFESFLTLRQYRILQQTKPPAVLSKEISQETFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              +      + + A +   +LP  W
Sbjct  76   EIISGLWAQIQNVAFIQLDVLPKLW  100



>ref|XP_009532258.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
 gb|EGZ11925.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
Length=468

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 48/113 (42%), Gaps = 21/113 (19%)
 Frame = +2

Query  50   SAMAFPYMEAVVGFMILMYIFETYLXIRQHAAl------klptlpkplVGXISQ------  193
            SA   PY +  + FM L+++FETYL +RQH  L      K        +G  SQ      
Sbjct  19   SASPVPYFQGALVFMTLVFLFETYLDLRQHRKLHDKQFPKPLAEAIEGLGSYSQKEEEEE  78

Query  194  ---------XKXEKXRAYSIXKSDFHFVHEFXTILMDSAILYFGILPWFWKKS  325
                      K +K RAY + KS F FV      L  +  L  G LP+ W  S
Sbjct  79   ETTLLEATRTKFDKSRAYGLDKSTFGFVSGGYNQLEATVFLLLGYLPFAWTMS  131



>ref|XP_006696845.1| ribosomal protein L34-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS17227.1| ribosomal protein L34-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=682

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  Y+FE++L  RQ+  L+    PK L   +SQ   +K +AYS  K+ F
Sbjct  17   FPWKKLIIGFSVGQYLFESFLSWRQYQVLQRTQPPKVLEHEVSQDVFDKSQAYSRAKAKF  76

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              ++   + L++    +F +LP  W
Sbjct  77   SAINGLYSQLLNLGFYHFDVLPKLW  101



>ref|XP_009168050.1| hypothetical protein T265_13631, partial [Opisthorchis viverrini]
 gb|KER28247.1| hypothetical protein T265_13631, partial [Opisthorchis viverrini]
Length=472

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query  77   AVVGFMILMYIFETYLXIRQ-HAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFHFVH  253
            AV  F+ L+Y++ETYL  RQ    L    +P  LV  I+  +  K +AY + K  F F H
Sbjct  19   AVFCFLWLVYLWETYLDRRQRQVVLNTSDVPSELVHVINADEFSKSKAYVLDKMMFSFFH  78

Query  254  EFXTILMDSAILYFGILPWFWKK  322
            +   +L  + +L+F ++PW W K
Sbjct  79   DAYDMLEATLVLWFSVVPWLWDK  101



>ref|XP_006673104.1| CaaX prenyl protease [Cordyceps militaris CM01]
 gb|EGX89649.1| CaaX prenyl protease [Cordyceps militaris CM01]
Length=455

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = +2

Query  62   FPYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDF  241
            FP+ + ++GF +  YIFE+ L +RQ+  L+    P  L   I Q   +K +AY   K+ F
Sbjct  16   FPWKKLILGFSVGQYIFESLLTLRQYRVLQATKPPAVLAKEIPQDTFDKSQAYGRAKAQF  75

Query  242  HFVHEFXTILMDSAILYFGILPWFW  316
              V+   + + + A + + +LP  W
Sbjct  76   SLVNGLWSQISNVAFIQYDVLPKLW  100



>ref|XP_002553545.1| KLTH0E01298p [Lachancea thermotolerans]
 emb|CAR23108.1| KLTH0E01298p [Lachancea thermotolerans CBS 6340]
Length=455

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 41/84 (49%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   PYMEAVVGFMILMYIFETYLXIRQHAAlklptlpkplVGXISQXKXEKXRAYSIXKSDFH  244
            P+   V  F +  + FETY+  RQ+  L    LPK L G I +   +K   YS  K+ F 
Sbjct  17   PWKSIVTAFTLGQFCFETYVTFRQYRTLSKKQLPKVLEGEIEEETMQKAEKYSRAKAKFS  76

Query  245  FVHEFXTILMDSAILYFGILPWFW  316
               +   +L +  IL F +LP FW
Sbjct  77   IFSDVLGLLQNLCILKFDLLPRFW  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563570228265