BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039L13

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802964.1|  PREDICTED: probable aspartyl aminopeptidase        279   3e-87   Nicotiana sylvestris
ref|XP_006361458.1|  PREDICTED: probable aspartyl aminopeptidase-...    278   6e-87   Solanum tuberosum [potatoes]
ref|XP_009596186.1|  PREDICTED: probable aspartyl aminopeptidase        274   3e-85   Nicotiana tomentosiformis
ref|XP_004249975.1|  PREDICTED: probable aspartyl aminopeptidase        272   1e-84   Solanum lycopersicum
ref|XP_011076919.1|  PREDICTED: probable aspartyl aminopeptidase ...    271   2e-84   Sesamum indicum [beniseed]
gb|EYU19780.1|  hypothetical protein MIMGU_mgv1a004147mg                268   7e-83   Erythranthe guttata [common monkey flower]
ref|XP_008232012.1|  PREDICTED: probable aspartyl aminopeptidase        267   7e-83   Prunus mume [ume]
ref|XP_010088778.1|  Aspartyl aminopeptidase                            263   3e-81   Morus notabilis
emb|CAN73045.1|  hypothetical protein VITISV_008667                     254   4e-81   Vitis vinifera
ref|XP_009336015.1|  PREDICTED: probable aspartyl aminopeptidase ...    261   2e-80   Pyrus x bretschneideri [bai li]
ref|XP_009336013.1|  PREDICTED: probable aspartyl aminopeptidase ...    261   2e-80   Pyrus x bretschneideri [bai li]
ref|XP_010244537.1|  PREDICTED: probable aspartyl aminopeptidase ...    258   4e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010244532.1|  PREDICTED: probable aspartyl aminopeptidase ...    260   4e-80   Nelumbo nucifera [Indian lotus]
ref|XP_008347038.1|  PREDICTED: probable aspartyl aminopeptidase        258   2e-79   
ref|XP_009356123.1|  PREDICTED: probable aspartyl aminopeptidase        258   4e-79   Pyrus x bretschneideri [bai li]
ref|XP_002266672.1|  PREDICTED: probable aspartyl aminopeptidase ...    255   3e-78   Vitis vinifera
emb|CDO99897.1|  unnamed protein product                                254   8e-78   Coffea canephora [robusta coffee]
ref|XP_002524995.1|  Aspartyl aminopeptidase, putative                  253   2e-77   Ricinus communis
gb|KDP35783.1|  hypothetical protein JCGZ_10419                         251   1e-76   Jatropha curcas
gb|KHG01889.1|  Aspartyl aminopeptidase                                 252   1e-76   Gossypium arboreum [tree cotton]
gb|KJB78672.1|  hypothetical protein B456_013G012600                    250   3e-76   Gossypium raimondii
ref|XP_011076920.1|  PREDICTED: probable aspartyl aminopeptidase ...    247   2e-75   
ref|XP_010907134.1|  PREDICTED: probable aspartyl aminopeptidase ...    246   2e-75   
ref|XP_010543610.1|  PREDICTED: probable aspartyl aminopeptidase        248   2e-75   Tarenaya hassleriana [spider flower]
gb|KCW51473.1|  hypothetical protein EUGRSUZ_J00993                     246   3e-75   Eucalyptus grandis [rose gum]
ref|XP_007213437.1|  hypothetical protein PRUPE_ppa025466mg             246   3e-75   
ref|XP_002311031.2|  hypothetical protein POPTR_0008s02250g             246   4e-75   
gb|KCW51472.1|  hypothetical protein EUGRSUZ_J00993                     246   6e-75   Eucalyptus grandis [rose gum]
ref|XP_010032079.1|  PREDICTED: probable aspartyl aminopeptidase ...    246   7e-75   Eucalyptus grandis [rose gum]
ref|XP_002311016.2|  hypothetical protein POPTR_0008s02250g             246   7e-75   
ref|XP_007010330.1|  Zn-dependent exopeptidases superfamily prote...    244   8e-75   
ref|XP_007010329.1|  Zn-dependent exopeptidases superfamily prote...    246   1e-74   
ref|XP_010452373.1|  PREDICTED: probable aspartyl aminopeptidase        246   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006398926.1|  hypothetical protein EUTSA_v10013255mg             245   2e-74   Eutrema salsugineum [saltwater cress]
ref|XP_010907133.1|  PREDICTED: probable aspartyl aminopeptidase ...    245   2e-74   Elaeis guineensis
ref|XP_010490993.1|  PREDICTED: probable aspartyl aminopeptidase        245   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008788174.1|  PREDICTED: probable aspartyl aminopeptidase        244   5e-74   Phoenix dactylifera
ref|XP_010694702.1|  PREDICTED: probable aspartyl aminopeptidase ...    244   5e-74   
ref|XP_010423546.1|  PREDICTED: probable aspartyl aminopeptidase        244   6e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008446766.1|  PREDICTED: probable aspartyl aminopeptidase        244   8e-74   Cucumis melo [Oriental melon]
ref|XP_009390025.1|  PREDICTED: probable aspartyl aminopeptidase        244   8e-74   
ref|XP_011032849.1|  PREDICTED: probable aspartyl aminopeptidase        244   8e-74   Populus euphratica
ref|XP_010694703.1|  PREDICTED: probable aspartyl aminopeptidase ...    243   8e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694701.1|  PREDICTED: probable aspartyl aminopeptidase ...    244   9e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006287486.1|  hypothetical protein CARUB_v10000697mg             243   1e-73   Capsella rubella
ref|NP_196091.1|  Zn-dependent exopeptidases superfamily protein        243   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150844.1|  PREDICTED: probable aspartyl aminopeptidase-...    242   4e-73   
ref|XP_009122574.1|  PREDICTED: probable aspartyl aminopeptidase        242   5e-73   Brassica rapa
dbj|BAC43404.1|  putative aspartyl aminopeptidase                       241   1e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44874.1|  BnaC09g50740D                                          240   1e-72   Brassica napus [oilseed rape]
gb|KGN52197.1|  hypothetical protein Csa_5G615200                       240   2e-72   Cucumis sativus [cucumbers]
gb|KFK24913.1|  hypothetical protein AALP_AA8G041200                    240   3e-72   Arabis alpina [alpine rockcress]
ref|XP_006485213.1|  PREDICTED: probable aspartyl aminopeptidase-...    238   1e-71   Citrus sinensis [apfelsine]
gb|KDO42029.1|  hypothetical protein CISIN_1g009941mg                   238   1e-71   Citrus sinensis [apfelsine]
ref|XP_006436621.1|  hypothetical protein CICLE_v10031166mg             238   1e-71   
emb|CDX70207.1|  BnaA10g25560D                                          236   9e-71   
ref|XP_004496198.1|  PREDICTED: probable aspartyl aminopeptidase-...    234   3e-70   
ref|XP_002873165.1|  hypothetical protein ARALYDRAFT_487250             234   4e-70   
gb|AES62027.2|  aspartyl aminopeptidase-like protein, putative          233   1e-69   Medicago truncatula
ref|XP_006645339.1|  PREDICTED: probable aspartyl aminopeptidase-...    232   2e-69   Oryza brachyantha
ref|NP_001045513.1|  Os01g0967900                                       232   3e-69   
gb|EEC72239.1|  hypothetical protein OsI_05355                          231   3e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_007143804.1|  hypothetical protein PHAVU_007G103100g             229   3e-68   Phaseolus vulgaris [French bean]
ref|XP_006851486.1|  hypothetical protein AMTR_s00040p00143220          229   4e-68   
ref|XP_003565148.1|  PREDICTED: probable aspartyl aminopeptidase        228   5e-68   Brachypodium distachyon [annual false brome]
gb|EPS58587.1|  aspartyl aminopeptidase                                 226   9e-68   Genlisea aurea
dbj|BAJ86698.1|  predicted protein                                      223   5e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002457006.1|  hypothetical protein SORBIDRAFT_03g047100          223   5e-66   Sorghum bicolor [broomcorn]
ref|XP_003556268.2|  PREDICTED: probable aspartyl aminopeptidase-...    223   8e-66   Glycine max [soybeans]
gb|KHN00906.1|  Aspartyl aminopeptidase                                 223   8e-66   Glycine soja [wild soybean]
ref|XP_004971394.1|  PREDICTED: probable aspartyl aminopeptidase-...    221   2e-65   Setaria italica
gb|KHN37829.1|  Aspartyl aminopeptidase                                 219   1e-64   Glycine soja [wild soybean]
ref|XP_003591776.1|  Aspartyl aminopeptidase                            219   2e-64   
ref|XP_004971395.1|  PREDICTED: probable aspartyl aminopeptidase-...    214   1e-62   
ref|XP_001751765.1|  predicted protein                                  207   4e-60   
ref|XP_002975004.1|  hypothetical protein SELMODRAFT_442726             196   5e-56   
ref|XP_003055398.1|  predicted protein                                  194   2e-55   Micromonas pusilla CCMP1545
gb|KHN31910.1|  Aspartyl aminopeptidase                                 186   6e-53   Glycine soja [wild soybean]
ref|XP_002507546.1|  aspartyl aminopeptidase                            187   2e-52   Micromonas commoda
ref|XP_003523136.1|  PREDICTED: probable aspartyl aminopeptidase-...    186   3e-52   Glycine max [soybeans]
ref|XP_003526970.1|  PREDICTED: probable aspartyl aminopeptidase-...    186   5e-52   Glycine max [soybeans]
ref|XP_003578741.1|  PREDICTED: probable aspartyl aminopeptidase        184   1e-51   Brachypodium distachyon [annual false brome]
gb|KJB80475.1|  hypothetical protein B456_013G099300                    175   2e-51   Gossypium raimondii
ref|XP_002949870.1|  hypothetical protein VOLCADRAFT_104511             180   2e-51   Volvox carteri f. nagariensis
ref|XP_006664453.1|  PREDICTED: probable aspartyl aminopeptidase-...    184   2e-51   Oryza brachyantha
ref|XP_010674696.1|  PREDICTED: probable aspartyl aminopeptidase        184   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004960722.1|  PREDICTED: probable aspartyl aminopeptidase-...    183   3e-51   Setaria italica
ref|XP_002967289.1|  hypothetical protein SELMODRAFT_86972              184   4e-51   
ref|XP_002960428.1|  hypothetical protein SELMODRAFT_164111             184   4e-51   
ref|XP_006826611.1|  hypothetical protein AMTR_s00138p00076250          176   4e-51   
ref|XP_008673044.1|  PREDICTED: hypothetical protein isoform X1         183   4e-51   Zea mays [maize]
ref|XP_009379936.1|  PREDICTED: probable aspartyl aminopeptidase        182   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002458215.1|  hypothetical protein SORBIDRAFT_03g029130          182   5e-51   Sorghum bicolor [broomcorn]
ref|XP_004236341.1|  PREDICTED: probable aspartyl aminopeptidase        182   1e-50   Solanum lycopersicum
ref|XP_009624334.1|  PREDICTED: probable aspartyl aminopeptidase        181   2e-50   Nicotiana tomentosiformis
ref|XP_006476998.1|  PREDICTED: probable aspartyl aminopeptidase-...    181   2e-50   Citrus sinensis [apfelsine]
gb|KDO42027.1|  hypothetical protein CISIN_1g009941mg                   181   2e-50   Citrus sinensis [apfelsine]
ref|XP_007209960.1|  hypothetical protein PRUPE_ppa004869mg             181   3e-50   Prunus persica
ref|XP_006436620.1|  hypothetical protein CICLE_v10031166mg             181   3e-50   
ref|XP_002950223.1|  hypothetical protein VOLCADRAFT_104613             180   3e-50   Volvox carteri f. nagariensis
ref|XP_009404266.1|  PREDICTED: probable aspartyl aminopeptidase        181   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009346502.1|  PREDICTED: probable aspartyl aminopeptidase        181   4e-50   Pyrus x bretschneideri [bai li]
ref|XP_006351481.1|  PREDICTED: probable aspartyl aminopeptidase-...    180   5e-50   Solanum tuberosum [potatoes]
ref|XP_006440072.1|  hypothetical protein CICLE_v10019750mg             181   6e-50   Citrus clementina [clementine]
ref|XP_009790447.1|  PREDICTED: probable aspartyl aminopeptidase        180   6e-50   Nicotiana sylvestris
ref|XP_008807556.1|  PREDICTED: probable aspartyl aminopeptidase ...    180   7e-50   
ref|XP_008807558.1|  PREDICTED: probable aspartyl aminopeptidase ...    180   7e-50   Phoenix dactylifera
ref|XP_010248918.1|  PREDICTED: probable aspartyl aminopeptidase ...    180   8e-50   Nelumbo nucifera [Indian lotus]
ref|XP_004138058.1|  PREDICTED: probable aspartyl aminopeptidase-...    179   9e-50   
ref|XP_007137936.1|  hypothetical protein PHAVU_009G167900g             179   1e-49   Phaseolus vulgaris [French bean]
ref|XP_004165826.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    179   1e-49   
gb|ABR17053.1|  unknown                                                 180   1e-49   Picea sitchensis
ref|XP_010248919.1|  PREDICTED: probable aspartyl aminopeptidase ...    179   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_003602076.1|  Aspartyl aminopeptidase                            179   1e-49   Medicago truncatula
emb|CDP05422.1|  unnamed protein product                                179   1e-49   Coffea canephora [robusta coffee]
gb|KFK26680.1|  hypothetical protein AALP_AA8G278900                    179   2e-49   Arabis alpina [alpine rockcress]
gb|KGN63496.1|  hypothetical protein Csa_1G002160                       179   2e-49   Cucumis sativus [cucumbers]
ref|XP_008374264.1|  PREDICTED: probable aspartyl aminopeptidase        179   2e-49   Malus domestica [apple tree]
ref|XP_009336570.1|  PREDICTED: probable aspartyl aminopeptidase        179   2e-49   Pyrus x bretschneideri [bai li]
ref|NP_001066463.1|  Os12g0236500                                       178   3e-49   
gb|AFK46082.1|  unknown                                                 178   3e-49   Lotus japonicus
ref|XP_009359462.1|  PREDICTED: probable aspartyl aminopeptidase        178   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_005648131.1|  peptidase M18, aminopeptidase I                    177   4e-49   Coccomyxa subellipsoidea C-169
ref|XP_008239439.1|  PREDICTED: probable aspartyl aminopeptidase        178   5e-49   Prunus mume [ume]
ref|XP_010536640.1|  PREDICTED: probable aspartyl aminopeptidase        177   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_007037930.1|  Zn-dependent exopeptidases superfamily protein     178   6e-49   
gb|EPS62030.1|  aspartyl aminopeptidase-like protein                    177   6e-49   Genlisea aurea
ref|XP_002321687.1|  aspartyl aminopeptidase family protein             177   8e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011024060.1|  PREDICTED: probable aspartyl aminopeptidase        177   9e-49   Populus euphratica
ref|XP_010930126.1|  PREDICTED: probable aspartyl aminopeptidase        176   2e-48   Elaeis guineensis
ref|XP_002866374.1|  hypothetical protein ARALYDRAFT_332278             176   2e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_004500663.1|  PREDICTED: probable aspartyl aminopeptidase-...    176   2e-48   Cicer arietinum [garbanzo]
ref|XP_001784619.1|  predicted protein                                  176   2e-48   
ref|XP_001690598.1|  aspartyl aminopeptidase-like protein               177   3e-48   Chlamydomonas reinhardtii
ref|XP_006280394.1|  hypothetical protein CARUB_v10026321mg             175   4e-48   Capsella rubella
ref|XP_002318119.2|  aspartyl aminopeptidase family protein             175   5e-48   
ref|XP_008464465.1|  PREDICTED: probable aspartyl aminopeptidase ...    175   6e-48   Cucumis melo [Oriental melon]
ref|XP_008464464.1|  PREDICTED: probable aspartyl aminopeptidase ...    174   6e-48   Cucumis melo [Oriental melon]
ref|XP_010443807.1|  PREDICTED: probable aspartyl aminopeptidase        174   6e-48   Camelina sativa [gold-of-pleasure]
gb|KHF99832.1|  Aspartyl aminopeptidase                                 174   7e-48   Gossypium arboreum [tree cotton]
gb|KJB27157.1|  hypothetical protein B456_004G282900                    174   7e-48   Gossypium raimondii
ref|XP_004165827.1|  PREDICTED: probable aspartyl aminopeptidase-...    174   7e-48   
gb|KJB27155.1|  hypothetical protein B456_004G282900                    174   7e-48   Gossypium raimondii
gb|KJB27156.1|  hypothetical protein B456_004G282900                    174   7e-48   Gossypium raimondii
ref|XP_004138060.1|  PREDICTED: probable aspartyl aminopeptidase-...    174   8e-48   
ref|XP_002283475.1|  PREDICTED: probable aspartyl aminopeptidase        174   8e-48   Vitis vinifera
ref|XP_001773362.1|  predicted protein                                  174   1e-47   
ref|XP_009134060.1|  PREDICTED: probable aspartyl aminopeptidase        174   1e-47   Brassica rapa
ref|XP_008367478.1|  PREDICTED: probable aspartyl aminopeptidase        174   1e-47   
emb|CDX83160.1|  BnaA03g23460D                                          174   1e-47   
ref|XP_010483659.1|  PREDICTED: probable aspartyl aminopeptidase        174   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010456062.1|  PREDICTED: probable aspartyl aminopeptidase        173   2e-47   Camelina sativa [gold-of-pleasure]
emb|CDY34036.1|  BnaC03g27790D                                          173   3e-47   Brassica napus [oilseed rape]
ref|XP_011044185.1|  PREDICTED: probable aspartyl aminopeptidase        173   3e-47   Populus euphratica
gb|KCW83185.1|  hypothetical protein EUGRSUZ_B00132                     171   3e-47   Eucalyptus grandis [rose gum]
gb|EMS55846.1|  Aspartyl aminopeptidase                                 174   3e-47   Triticum urartu
ref|NP_200824.1|  zn-dependent exopeptidases superfamily protein        172   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61631.1|  aspartyl aminopeptidase-like protein                    172   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KIY94035.1|  Aminopeptidase I zinc metalloprotease                   172   3e-47   Monoraphidium neglectum
ref|XP_002977420.1|  hypothetical protein SELMODRAFT_176342             171   6e-47   
gb|KDP30945.1|  hypothetical protein JCGZ_11321                         172   6e-47   Jatropha curcas
ref|XP_011396821.1|  Aspartyl aminopeptidase                            171   1e-46   Auxenochlorella protothecoides
ref|XP_010026684.1|  PREDICTED: probable aspartyl aminopeptidase        171   1e-46   Eucalyptus grandis [rose gum]
gb|KCW83184.1|  hypothetical protein EUGRSUZ_B00132                     171   2e-46   Eucalyptus grandis [rose gum]
gb|EMT03759.1|  Aspartyl aminopeptidase                                 174   2e-46   
ref|XP_011083884.1|  PREDICTED: probable aspartyl aminopeptidase        170   2e-46   Sesamum indicum [beniseed]
ref|XP_002511215.1|  Aspartyl aminopeptidase, putative                  169   4e-46   
gb|KCW51475.1|  hypothetical protein EUGRSUZ_J00996                     160   5e-46   Eucalyptus grandis [rose gum]
ref|XP_005849269.1|  hypothetical protein CHLNCDRAFT_143544             169   6e-46   Chlorella variabilis
sp|B9RAJ0.2|DNPEP_RICCO  RecName: Full=Probable aspartyl aminopep...    169   6e-46   Ricinus communis
ref|XP_008392833.1|  PREDICTED: probable aspartyl aminopeptidase        168   1e-45   
ref|XP_002963681.1|  hypothetical protein SELMODRAFT_80579              168   2e-45   
ref|XP_008394651.1|  PREDICTED: aspartyl aminopeptidase isoform X2      159   2e-45   
ref|XP_008394645.1|  PREDICTED: aspartyl aminopeptidase isoform X1      159   2e-45   
gb|EYU43065.1|  hypothetical protein MIMGU_mgv1a005789mg                167   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_009025082.1|  hypothetical protein HELRODRAFT_187369             166   1e-44   Helobdella robusta
ref|XP_001756754.1|  predicted protein                                  165   2e-44   
emb|CEF99925.1|  Peptidase M18                                          164   9e-44   Ostreococcus tauri
ref|XP_003082377.1|  aspartyl aminopeptidase (ISS)                      163   1e-43   
ref|XP_001420830.1|  predicted protein                                  162   2e-43   Ostreococcus lucimarinus CCE9901
ref|XP_011463290.1|  PREDICTED: probable aspartyl aminopeptidase        162   2e-43   Fragaria vesca subsp. vesca
ref|XP_010102886.1|  Aspartyl aminopeptidase                            162   3e-43   
ref|XP_005814088.1|  PREDICTED: aspartyl aminopeptidase-like            162   3e-43   
ref|XP_007575368.1|  PREDICTED: aspartyl aminopeptidase isoform X1      161   7e-43   Poecilia formosa
ref|XP_007575369.1|  PREDICTED: aspartyl aminopeptidase isoform X2      160   7e-43   Poecilia formosa
gb|EIE78284.1|  hypothetical protein RO3G_02988                         160   2e-42   Rhizopus delemar RA 99-880
ref|XP_002592514.1|  hypothetical protein BRAFLDRAFT_69005              158   5e-42   Branchiostoma floridae
gb|EFB19842.1|  hypothetical protein PANDA_014251                       157   6e-42   Ailuropoda melanoleuca
ref|XP_004662959.1|  PREDICTED: aspartyl aminopeptidase                 158   7e-42   Jaculus jaculus
ref|XP_003446617.1|  PREDICTED: aspartyl aminopeptidase-like isof...    158   7e-42   Oreochromis niloticus
ref|XP_004563349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    158   7e-42   Maylandia zebra
ref|XP_004563350.1|  PREDICTED: aspartyl aminopeptidase-like isof...    158   8e-42   Maylandia zebra
ref|XP_005452349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    158   8e-42   Oreochromis niloticus
ref|XP_010859552.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   9e-42   Bison bison bison
ref|XP_008323213.1|  PREDICTED: aspartyl aminopeptidase isoform X3      158   9e-42   
ref|XP_008323211.1|  PREDICTED: aspartyl aminopeptidase isoform X1      158   1e-41   
gb|ACC64563.1|  aspartyl aminopeptidase (predicted)                     157   1e-41   Rhinolophus ferrumequinum
ref|XP_008323212.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   1e-41   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004262732.1|  PREDICTED: aspartyl aminopeptidase isoform 2       157   1e-41   Orcinus orca [Orca]
gb|EWM25484.1|  aspartyl aminopeptidase                                 159   1e-41   Nannochloropsis gaditana
gb|KFH62765.1|  aspartyl aminopeptidase                                 155   1e-41   Mortierella verticillata NRRL 6337
ref|XP_004262731.1|  PREDICTED: aspartyl aminopeptidase isoform 1       157   1e-41   
ref|XP_004325560.1|  PREDICTED: aspartyl aminopeptidase isoform 3       157   1e-41   
ref|XP_004325559.1|  PREDICTED: aspartyl aminopeptidase isoform 2       157   1e-41   
ref|XP_007122487.1|  PREDICTED: aspartyl aminopeptidase                 157   1e-41   
gb|ELR60782.1|  Aspartyl aminopeptidase                                 157   2e-41   Bos mutus
ref|XP_005202875.1|  PREDICTED: aspartyl aminopeptidase isoform X5      157   2e-41   Bos taurus [bovine]
ref|NP_001039417.1|  aspartyl aminopeptidase                            157   2e-41   Bos taurus [bovine]
gb|EPZ34400.1|  Peptidase M18 2 domain-containing protein               156   2e-41   Rozella allomycis CSF55
ref|XP_004762907.1|  PREDICTED: aspartyl aminopeptidase isoform X6      157   2e-41   Mustela putorius furo [black ferret]
ref|XP_004325558.1|  PREDICTED: aspartyl aminopeptidase isoform 1       157   2e-41   
ref|XP_010859551.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   2e-41   Bison bison bison
ref|XP_007519740.1|  PREDICTED: aspartyl aminopeptidase                 157   2e-41   
ref|XP_005676646.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   
ref|XP_004005000.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    157   2e-41   
ref|XP_005676645.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   2e-41   
ref|XP_006906751.1|  PREDICTED: aspartyl aminopeptidase                 157   2e-41   Pteropus alecto
ref|XP_003784969.1|  PREDICTED: aspartyl aminopeptidase                 157   2e-41   Otolemur garnettii
ref|XP_006935664.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   Felis catus [cat]
ref|XP_010748613.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   
ref|XP_010748612.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   2e-41   
ref|XP_007445869.1|  PREDICTED: aspartyl aminopeptidase                 157   2e-41   Lipotes vexillifer [baiji]
ref|XP_006739743.1|  PREDICTED: aspartyl aminopeptidase                 157   2e-41   Leptonychotes weddellii
ref|XP_006935665.1|  PREDICTED: aspartyl aminopeptidase isoform X3      157   2e-41   Felis catus [cat]
ref|XP_006792993.1|  PREDICTED: aspartyl aminopeptidase-like            157   2e-41   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004762903.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   Mustela putorius furo [black ferret]
ref|XP_004402809.1|  PREDICTED: aspartyl aminopeptidase isoform 2       157   2e-41   Odobenus rosmarus divergens
ref|XP_010800626.1|  PREDICTED: aspartyl aminopeptidase isoform X4      157   2e-41   
pdb|3VAR|A  Chain A, Crystal Structure Of Dnpep, Znzn Form              157   2e-41   Bos taurus [bovine]
ref|XP_010800625.1|  PREDICTED: aspartyl aminopeptidase isoform X3      157   2e-41   
ref|XP_005956749.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   Pantholops hodgsonii [Tibetan antelope]
ref|XP_002712541.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004427652.1|  PREDICTED: aspartyl aminopeptidase                 157   3e-41   
gb|ELK17177.1|  Aspartyl aminopeptidase                                 157   3e-41   Pteropus alecto
ref|XP_004402808.1|  PREDICTED: aspartyl aminopeptidase isoform 1       157   3e-41   Odobenus rosmarus divergens
ref|XP_006890316.1|  PREDICTED: aspartyl aminopeptidase                 156   3e-41   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005640751.1|  PREDICTED: aspartyl aminopeptidase isoform X4      157   3e-41   
ref|XP_010765444.1|  PREDICTED: aspartyl aminopeptidase isoform X2      152   3e-41   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005202874.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   3e-41   
ref|XP_006402123.1|  hypothetical protein EUTSA_v10015798mg             156   3e-41   
ref|XP_010765443.1|  PREDICTED: aspartyl aminopeptidase isoform X1      152   3e-41   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004762902.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   3e-41   Mustela putorius furo [black ferret]
ref|XP_005956748.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   3e-41   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006935663.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   3e-41   Felis catus [cat]
ref|XP_008257444.1|  PREDICTED: aspartyl aminopeptidase isoform X1      156   3e-41   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007956515.1|  PREDICTED: aspartyl aminopeptidase                 156   4e-41   Orycteropus afer afer
ref|XP_011404738.1|  PREDICTED: aspartyl aminopeptidase-like            156   4e-41   
ref|XP_011230094.1|  PREDICTED: aspartyl aminopeptidase                 156   5e-41   
emb|CEP14293.1|  hypothetical protein                                   155   6e-41   Parasitella parasitica
ref|XP_004576859.1|  PREDICTED: aspartyl aminopeptidase                 155   6e-41   Ochotona princeps [southern American pika]
gb|ELK30546.1|  Aspartyl aminopeptidase                                 155   6e-41   Myotis davidii
ref|XP_004876190.1|  PREDICTED: aspartyl aminopeptidase isoform X2      155   6e-41   
dbj|BAB13923.1|  unnamed protein product                                151   7e-41   Homo sapiens [man]
ref|XP_006763438.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    155   7e-41   Myotis davidii
emb|CEG81490.1|  Putative Aspartyl aminopeptidase                       155   7e-41   Rhizopus microsporus
ref|XP_005883531.1|  PREDICTED: aspartyl aminopeptidase isoform X1      155   7e-41   Myotis brandtii
ref|XP_005610686.1|  PREDICTED: aspartyl aminopeptidase isoform X3      155   8e-41   Equus caballus [domestic horse]
ref|XP_006082619.1|  PREDICTED: aspartyl aminopeptidase isoform X2      155   8e-41   
dbj|BAH13808.1|  unnamed protein product                                151   8e-41   Homo sapiens [man]
ref|XP_006082618.1|  PREDICTED: aspartyl aminopeptidase isoform X1      155   8e-41   Myotis lucifugus
ref|XP_005883532.1|  PREDICTED: aspartyl aminopeptidase isoform X2      155   9e-41   Myotis brandtii
ref|XP_005610687.1|  PREDICTED: aspartyl aminopeptidase isoform X4      155   9e-41   Equus caballus [domestic horse]
ref|XP_006082620.1|  PREDICTED: aspartyl aminopeptidase isoform X3      155   9e-41   
gb|EHA97554.1|  Aspartyl aminopeptidase                                 155   1e-40   Heterocephalus glaber [naked mole rat]
ref|XP_005001095.1|  PREDICTED: aspartyl aminopeptidase isoform X2      155   1e-40   Cavia porcellus [guinea pig]
dbj|GAN09714.1|  aspartyl aminopeptidase                                155   1e-40   Mucor ambiguus
ref|NP_001172115.1|  aspartyl aminopeptidase                            155   1e-40   Sus scrofa [pigs]
ref|XP_001492028.3|  PREDICTED: aspartyl aminopeptidase isoform X1      155   1e-40   
ref|XP_008143354.1|  PREDICTED: aspartyl aminopeptidase                 155   1e-40   Eptesicus fuscus
ref|XP_004876189.1|  PREDICTED: aspartyl aminopeptidase isoform X1      155   1e-40   
ref|XP_008578710.1|  PREDICTED: aspartyl aminopeptidase                 154   1e-40   Galeopterus variegatus [Malayan flying lemur]
ref|XP_003464074.1|  PREDICTED: aspartyl aminopeptidase isoform X1      155   1e-40   Cavia porcellus [guinea pig]
ref|XP_008823992.1|  PREDICTED: aspartyl aminopeptidase isoform X1      154   1e-40   Nannospalax galili
ref|XP_008823997.1|  PREDICTED: aspartyl aminopeptidase isoform X2      154   1e-40   Nannospalax galili
ref|XP_005610685.1|  PREDICTED: aspartyl aminopeptidase isoform X2      155   1e-40   Equus caballus [domestic horse]
ref|XP_008293068.1|  PREDICTED: aspartyl aminopeptidase isoform X2      154   2e-40   Stegastes partitus
ref|XP_008293067.1|  PREDICTED: aspartyl aminopeptidase isoform X1      154   2e-40   Stegastes partitus
ref|XP_004638242.1|  PREDICTED: aspartyl aminopeptidase                 154   2e-40   
ref|XP_008823998.1|  PREDICTED: aspartyl aminopeptidase isoform X3      154   2e-40   Nannospalax galili
ref|XP_005330568.1|  PREDICTED: aspartyl aminopeptidase                 154   2e-40   
gb|EDL75431.1|  aspartyl aminopeptidase, isoform CRA_e                  146   2e-40   
gb|EDL75433.1|  aspartyl aminopeptidase, isoform CRA_f                  146   2e-40   
ref|XP_010986678.1|  PREDICTED: aspartyl aminopeptidase                 154   2e-40   
ref|XP_009062504.1|  hypothetical protein LOTGIDRAFT_220342             154   2e-40   
ref|XP_006207284.1|  PREDICTED: aspartyl aminopeptidase isoform X2      154   2e-40   
gb|EDL75429.1|  aspartyl aminopeptidase, isoform CRA_d                  145   2e-40   
ref|XP_010947125.1|  PREDICTED: aspartyl aminopeptidase                 154   2e-40   
ref|NP_956447.1|  aspartyl aminopeptidase                               154   3e-40   
ref|XP_008057077.1|  PREDICTED: aspartyl aminopeptidase                 154   3e-40   
ref|XP_005165919.1|  PREDICTED: aspartyl aminopeptidase isoform X1      154   3e-40   
ref|XP_006207283.1|  PREDICTED: aspartyl aminopeptidase isoform X1      154   3e-40   
ref|XP_006186935.1|  PREDICTED: aspartyl aminopeptidase                 154   3e-40   
ref|XP_004701682.1|  PREDICTED: aspartyl aminopeptidase isoform X1      154   3e-40   
gb|EPB92944.1|  aspartyl aminopeptidase                                 153   4e-40   
ref|XP_001163232.1|  PREDICTED: aspartyl aminopeptidase isoform X1      153   4e-40   
ref|XP_008970257.1|  PREDICTED: aspartyl aminopeptidase isoform X2      153   4e-40   
ref|XP_008528206.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    154   4e-40   
ref|XP_010890471.1|  PREDICTED: aspartyl aminopeptidase isoform X2      153   5e-40   
ref|XP_004467839.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    153   5e-40   
gb|ACA64864.1|  aspartyl aminopeptidase (predicted)                     153   5e-40   
ref|XP_010890470.1|  PREDICTED: aspartyl aminopeptidase isoform X1      153   5e-40   
ref|XP_008997791.1|  PREDICTED: aspartyl aminopeptidase isoform X1      153   6e-40   
ref|XP_002796805.1|  aspartyl aminopeptidase                            154   6e-40   
ref|NP_001133447.1|  aspartyl aminopeptidase                            153   6e-40   
ref|XP_009236412.1|  PREDICTED: aspartyl aminopeptidase isoform X1      153   6e-40   
gb|ABY89804.1|  aspartyl aminopeptidase (predicted)                     153   6e-40   
ref|XP_009236415.1|  PREDICTED: aspartyl aminopeptidase isoform X3      152   6e-40   
emb|CDS03243.1|  hypothetical protein LRAMOSA00645                      152   7e-40   
ref|XP_003966622.1|  PREDICTED: aspartyl aminopeptidase-like            152   7e-40   
ref|XP_008997792.1|  PREDICTED: aspartyl aminopeptidase isoform X2      152   7e-40   
ref|XP_009236411.1|  PREDICTED: aspartyl aminopeptidase isoform X2      153   7e-40   
ref|XP_010334577.1|  PREDICTED: aspartyl aminopeptidase isoform X4      152   8e-40   
ref|XP_010334576.1|  PREDICTED: aspartyl aminopeptidase isoform X3      152   8e-40   
ref|XP_004674317.1|  PREDICTED: aspartyl aminopeptidase                 152   8e-40   
ref|XP_006168733.1|  PREDICTED: aspartyl aminopeptidase                 152   8e-40   
ref|XP_010334575.1|  PREDICTED: aspartyl aminopeptidase isoform X2      152   8e-40   
ref|XP_003406097.1|  PREDICTED: aspartyl aminopeptidase                 152   8e-40   
ref|XP_003925541.1|  PREDICTED: aspartyl aminopeptidase isoform X1      152   8e-40   
gb|EAW70735.1|  aspartyl aminopeptidase, isoform CRA_f                  152   9e-40   
ref|XP_010759752.1|  hypothetical protein PADG_04167                    153   9e-40   
gb|EHH55189.1|  hypothetical protein EGM_04343                          152   1e-39   
ref|XP_008863481.1|  hypothetical protein H310_01914                    152   1e-39   
ref|XP_005574437.1|  PREDICTED: aspartyl aminopeptidase isoform X3      152   1e-39   
ref|XP_006867902.1|  PREDICTED: aspartyl aminopeptidase                 152   1e-39   
ref|XP_003895756.1|  PREDICTED: aspartyl aminopeptidase                 152   1e-39   
ref|XP_005395588.1|  PREDICTED: aspartyl aminopeptidase isoform X4      152   1e-39   
ref|XP_005395587.1|  PREDICTED: aspartyl aminopeptidase isoform X3      152   1e-39   
gb|AAY15050.1|  unknown                                                 152   1e-39   
ref|XP_007964572.1|  PREDICTED: aspartyl aminopeptidase isoform X3      152   1e-39   
emb|CDH60153.1|  aspartyl aminopeptidase                                153   1e-39   
ref|XP_010358610.1|  PREDICTED: aspartyl aminopeptidase isoform X2      152   1e-39   
sp|Q9ULA0.1|DNPEP_HUMAN  RecName: Full=Aspartyl aminopeptidase          152   1e-39   
ref|XP_010610129.1|  PREDICTED: aspartyl aminopeptidase                 152   1e-39   
ref|XP_005574436.1|  PREDICTED: aspartyl aminopeptidase isoform X2      152   1e-39   
ref|XP_003272451.1|  PREDICTED: aspartyl aminopeptidase isoform 1       152   1e-39   
ref|NP_036232.2|  aspartyl aminopeptidase                               152   1e-39   
ref|XP_005246487.2|  PREDICTED: aspartyl aminopeptidase isoform X2      152   1e-39   
pdb|4DYO|A  Chain A, Crystal Structure Of Human Aspartyl Aminopep...    152   1e-39   
ref|XP_006818200.1|  PREDICTED: aspartyl aminopeptidase-like            145   1e-39   
ref|XP_004033307.1|  PREDICTED: aspartyl aminopeptidase                 152   1e-39   
emb|CEJ04001.1|  Putative Aspartyl aminopeptidase                       152   1e-39   
ref|NP_001162487.1|  aspartyl aminopeptidase                            152   1e-39   
gb|KIW96803.1|  aspartyl aminopeptidase                                 152   1e-39   
ref|XP_001103498.1|  PREDICTED: aspartyl aminopeptidase isoform 7       152   1e-39   
ref|XP_007964571.1|  PREDICTED: aspartyl aminopeptidase isoform X2      152   1e-39   
ref|NP_001271904.1|  uncharacterized protein LOC101867207               152   1e-39   
ref|XP_007743164.1|  aspartyl aminopeptidase                            152   1e-39   
ref|XP_010358609.1|  PREDICTED: aspartyl aminopeptidase isoform X1      152   1e-39   
dbj|BAH13586.1|  unnamed protein product                                152   2e-39   
gb|EHH21700.1|  hypothetical protein EGK_04825                          152   2e-39   
ref|XP_007964570.1|  PREDICTED: aspartyl aminopeptidase isoform X1      152   2e-39   
gb|EAW70730.1|  aspartyl aminopeptidase, isoform CRA_c                  152   2e-39   
ref|XP_005395585.1|  PREDICTED: aspartyl aminopeptidase isoform X1      152   2e-39   
ref|XP_005395586.1|  PREDICTED: aspartyl aminopeptidase isoform X2      152   2e-39   
dbj|BAA91903.1|  unnamed protein product                                151   2e-39   
ref|NP_001125438.1|  aspartyl aminopeptidase                            151   2e-39   
ref|XP_005520045.1|  PREDICTED: aspartyl aminopeptidase                 151   3e-39   
ref|XP_008688803.1|  PREDICTED: aspartyl aminopeptidase                 151   3e-39   
emb|CEG69346.1|  Putative Aspartyl aminopeptidase                       151   3e-39   
emb|CEI95696.1|  Putative Aspartyl aminopeptidase                       151   3e-39   
ref|XP_005101285.1|  PREDICTED: aspartyl aminopeptidase-like            150   4e-39   
gb|KFY30391.1|  hypothetical protein V493_01948                         150   4e-39   
gb|EPY79425.1|  receptor-type tyrosine-protein phosphatase-like N...    155   4e-39   
emb|CEG81693.1|  Putative Aspartyl aminopeptidase                       151   4e-39   
gb|KFY13166.1|  hypothetical protein V492_03441                         151   4e-39   
ref|XP_009086531.1|  PREDICTED: aspartyl aminopeptidase                 150   4e-39   
ref|XP_007234617.1|  PREDICTED: aspartyl aminopeptidase                 150   5e-39   
dbj|BAA92014.1|  unnamed protein product                                150   5e-39   
gb|KFY42594.1|  hypothetical protein V494_02343                         150   6e-39   
gb|KFY79508.1|  hypothetical protein V499_01520                         150   6e-39   
gb|ELU07857.1|  hypothetical protein CAPTEDRAFT_158105                  150   7e-39   
gb|EDL00399.1|  aspartyl aminopeptidase, isoform CRA_c                  150   7e-39   
ref|XP_005049624.1|  PREDICTED: aspartyl aminopeptidase                 150   7e-39   
gb|EKG17055.1|  Peptidase M18                                           150   7e-39   
gb|KEF61787.1|  aspartyl aminopeptidase                                 150   7e-39   
ref|XP_007580092.1|  putative aspartyl aminopeptidase protein           150   7e-39   
ref|XP_007501721.1|  PREDICTED: aspartyl aminopeptidase                 150   7e-39   
dbj|BAC34830.1|  unnamed protein product                                150   7e-39   
gb|AFK11572.1|  aspartyl aminopeptidase                                 150   7e-39   
ref|NP_001279935.1|  aspartyl aminopeptidase                            150   8e-39   
ref|NP_058574.3|  aspartyl aminopeptidase isoform b                     150   8e-39   
dbj|BAC30079.1|  unnamed protein product                                150   8e-39   
ref|NP_001088602.1|  uncharacterized protein LOC495491                  150   8e-39   
ref|NP_001104301.1|  aspartyl aminopeptidase isoform a                  150   8e-39   
gb|KFY92019.1|  hypothetical protein V500_04378                         150   9e-39   
ref|XP_003729436.1|  PREDICTED: aspartyl aminopeptidase-like            150   9e-39   
dbj|GAC99602.1|  aspartyl aminopeptidase                                150   9e-39   
ref|XP_006972210.1|  PREDICTED: aspartyl aminopeptidase isoform X1      150   9e-39   
gb|EDL00397.1|  aspartyl aminopeptidase, isoform CRA_b                  150   9e-39   
ref|NP_001085525.1|  aspartyl aminopeptidase                            150   9e-39   
ref|XP_006972211.1|  PREDICTED: aspartyl aminopeptidase isoform X2      149   9e-39   
ref|XP_004376401.1|  PREDICTED: aspartyl aminopeptidase                 149   1e-38   
ref|XP_007188042.1|  PREDICTED: aspartyl aminopeptidase                 149   1e-38   
ref|XP_002505350.1|  predicted protein                                  150   1e-38   
gb|ELR06737.1|  hypothetical protein GMDG_00354                         150   1e-38   
gb|KIW57576.1|  aspartyl aminopeptidase                                 150   1e-38   
ref|XP_003510642.1|  PREDICTED: aspartyl aminopeptidase                 149   1e-38   
gb|KIW71613.1|  aspartyl aminopeptidase                                 149   1e-38   
ref|XP_002974770.1|  hypothetical protein SELMODRAFT_101663             149   1e-38   
ref|XP_005070528.1|  PREDICTED: aspartyl aminopeptidase                 149   1e-38   
ref|XP_001641062.1|  predicted protein                                  149   2e-38   
ref|XP_009519985.1|  hypothetical protein PHYSODRAFT_539739             149   2e-38   
dbj|BAE32800.1|  unnamed protein product                                149   2e-38   
ref|NP_001016026.1|  aspartyl aminopeptidase                            149   2e-38   
gb|KIW02677.1|  hypothetical protein PV09_06114                         149   2e-38   
gb|AAD01212.1|  aspartyl aminopeptidase                                 149   2e-38   
gb|ETE70732.1|  Aspartyl aminopeptidase                                 149   2e-38   
ref|NP_001012937.1|  aspartyl aminopeptidase                            149   2e-38   
ref|XP_007883309.1|  PREDICTED: aspartyl aminopeptidase                 149   2e-38   
ref|XP_005361637.1|  PREDICTED: aspartyl aminopeptidase isoform X2      149   2e-38   
ref|XP_010567906.1|  PREDICTED: aspartyl aminopeptidase                 148   3e-38   
ref|XP_005361636.1|  PREDICTED: aspartyl aminopeptidase isoform X1      148   3e-38   
ref|XP_007778599.1|  aspartyl aminopeptidase                            149   3e-38   
ref|XP_004994670.1|  aspartyl aminopeptidase                            148   3e-38   
ref|XP_003111055.1|  hypothetical protein CRE_04518                     148   3e-38   
gb|EPB84012.1|  aspartyl aminopeptidase                                 148   3e-38   
ref|XP_005279931.1|  PREDICTED: aspartyl aminopeptidase                 148   4e-38   
ref|XP_006245246.1|  PREDICTED: aspartyl aminopeptidase isoform X1      148   4e-38   
ref|NP_001020050.1|  aspartyl aminopeptidase                            148   4e-38   
ref|XP_003655852.1|  hypothetical protein THITE_2120008                 149   4e-38   
ref|XP_006245247.1|  PREDICTED: aspartyl aminopeptidase isoform X2      148   4e-38   
ref|XP_001937243.1|  aspartyl aminopeptidase                            148   4e-38   
ref|XP_002155387.2|  PREDICTED: aspartyl aminopeptidase-like            147   4e-38   
ref|XP_006636850.1|  PREDICTED: aspartyl aminopeptidase-like            147   4e-38   
ref|XP_008110204.1|  PREDICTED: aspartyl aminopeptidase                 148   5e-38   
ref|XP_003297234.1|  hypothetical protein PTT_07560                     148   5e-38   
ref|XP_007419855.1|  PREDICTED: aspartyl aminopeptidase                 147   5e-38   
ref|XP_002109666.1|  hypothetical protein TRIADDRAFT_37272              147   5e-38   
ref|XP_007686414.1|  hypothetical protein COCMIDRAFT_35352              148   5e-38   
ref|XP_009217911.1|  aspartyl aminopeptidase                            148   5e-38   
gb|EMD89639.1|  hypothetical protein COCHEDRAFT_1021930                 148   5e-38   
gb|EUN29634.1|  hypothetical protein COCVIDRAFT_35507                   148   5e-38   
gb|KIW26829.1|  aspartyl aminopeptidase                                 148   5e-38   
ref|XP_007755763.1|  aspartyl aminopeptidase                            148   5e-38   
gb|KFZ06387.1|  hypothetical protein V501_07458                         148   6e-38   
ref|XP_007711530.1|  hypothetical protein COCCADRAFT_36117              148   6e-38   
ref|XP_007698413.1|  hypothetical protein COCSADRAFT_35844              148   6e-38   
dbj|GAN06933.1|  aspartyl aminopeptidase                                148   6e-38   
gb|EMT26810.1|  Aspartyl aminopeptidase                                 145   6e-38   
emb|CCF51316.1|  probable aspartyl aminopeptidase                       147   6e-38   
gb|KIW47212.1|  aspartyl aminopeptidase                                 148   7e-38   
ref|XP_005485343.1|  PREDICTED: aspartyl aminopeptidase                 148   7e-38   
ref|XP_009825683.1|  hypothetical protein H257_03355                    147   7e-38   
gb|EGE77302.1|  aspartyl aminopeptidase                                 148   8e-38   
ref|XP_008727381.1|  aspartyl aminopeptidase                            147   8e-38   
ref|XP_004346183.2|  aspartyl aminopeptidase                            147   1e-37   
gb|KJE94975.1|  aspartyl aminopeptidase                                 147   1e-37   
emb|CBQ68247.1|  probable aspartyl aminopeptidase                       147   1e-37   
ref|XP_009909456.1|  PREDICTED: aspartyl aminopeptidase                 147   1e-37   
ref|XP_003006452.1|  aspartyl aminopeptidase                            147   1e-37   
ref|XP_009652940.1|  aspartyl aminopeptidase                            147   1e-37   
emb|CCE31713.1|  probable aspartyl aminopeptidase                       147   1e-37   
gb|KIV85113.1|  aspartyl aminopeptidase                                 147   1e-37   
ref|XP_006272731.1|  PREDICTED: aspartyl aminopeptidase                 147   1e-37   
ref|XP_003838183.1|  hypothetical protein LEMA_P117070.1                147   1e-37   
gb|KIW75583.1|  aspartyl aminopeptidase                                 147   1e-37   
emb|CCG83236.1|  Aspartyl aminopeptidase                                146   1e-37   
ref|XP_002641207.1|  Hypothetical protein CBG09068                      146   1e-37   
gb|EUC66389.1|  aspartyl aminopeptidase                                 146   1e-37   
gb|EGT44396.1|  CBN-DNPP-1 protein                                      146   1e-37   
gb|KIX93688.1|  aspartyl aminopeptidase                                 147   2e-37   
ref|XP_002668236.1|  predicted protein                                  142   2e-37   
ref|XP_003333509.2|  hypothetical protein PGTG_14931                    146   2e-37   
ref|XP_007681528.1|  hypothetical protein BAUCODRAFT_80469              146   2e-37   
gb|EPE06234.1|  aspartyl aminopeptidase                                 146   2e-37   
gb|EHK15593.1|  hypothetical protein TRIVIDRAFT_82549                   146   2e-37   
ref|XP_003713775.1|  aspartyl aminopeptidase                            146   2e-37   
ref|XP_002907085.1|  aspartyl aminopeptidase, putative                  145   2e-37   
ref|XP_007912218.1|  putative aspartyl aminopeptidase protein           146   2e-37   
gb|KDO32253.1|  hypothetical protein SPRG_02733                         146   2e-37   
gb|EKC33057.1|  Aspartyl aminopeptidase                                 145   2e-37   
ref|XP_008620058.1|  aspartyl aminopeptidase                            145   2e-37   
ref|XP_003850739.1|  hypothetical protein MYCGRDRAFT_60951              146   2e-37   
gb|AAX07699.1|  aspartyl aminopeptidase-like protein                    146   2e-37   
ref|XP_011442611.1|  PREDICTED: aspartyl aminopeptidase-like            145   3e-37   
gb|KFY64115.1|  hypothetical protein V497_01817                         146   3e-37   
gb|KIW10192.1|  aspartyl aminopeptidase                                 146   3e-37   
emb|CDI51753.1|  probable aspartyl aminopeptidase                       146   3e-37   
ref|XP_007411864.1|  hypothetical protein MELLADRAFT_123262             145   3e-37   
gb|EFX00349.1|  aspartyl aminopeptidase                                 145   3e-37   
gb|EEH10698.1|  aspartyl aminopeptidase                                 145   3e-37   
gb|KFA70034.1|  hypothetical protein S40285_02036                       146   3e-37   
emb|CEG01789.1|  Peptidase M18                                          145   3e-37   
ref|XP_008717567.1|  aspartyl aminopeptidase                            145   4e-37   
ref|XP_007655567.1|  PREDICTED: aspartyl aminopeptidase                 139   4e-37   
gb|KFA55851.1|  hypothetical protein S40293_01900                       145   4e-37   
gb|KEY64841.1|  hypothetical protein S7711_08849                        145   4e-37   
gb|EGC45688.1|  aspartyl aminopeptidase                                 145   4e-37   
gb|KFX49953.1|  Aspartyl aminopeptidase                                 145   4e-37   
ref|XP_001263609.1|  aspartyl aminopeptidase                            145   5e-37   
gb|KIX10260.1|  aspartyl aminopeptidase                                 145   5e-37   
gb|EER44627.1|  aspartyl aminopeptidase                                 145   5e-37   
dbj|GAM41037.1|  aspartyl aminopeptidase                                145   6e-37   
ref|XP_008909814.1|  hypothetical protein PPTG_14635                    144   6e-37   
ref|NP_594745.1|  aspartyl aminopeptidase Aap1                          144   6e-37   
ref|XP_007600979.1|  aminopeptidase I zinc metalloprotease              145   6e-37   
ref|XP_001421486.1|  predicted protein                                  145   7e-37   
ref|XP_002153488.1|  aspartyl aminopeptidase                            145   7e-37   
gb|ETN72788.1|  aspartyl aminopeptidase                                 145   7e-37   
ref|XP_011386806.1|  putative aspartyl aminopeptidase                   144   9e-37   



>ref|XP_009802964.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=542

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 163/195 (84%), Gaps = 7/195 (4%)
 Frame = +2

Query  74   FHLLYA-PPLSKSSVLLSRFPHSLRP-FSAANANLRTS---HLRNFSA-TPPLCSSSSDA  235
            FH L   P   K SVLLS+FPHS  P FS    N+      H R FS+ T PLCS+S  +
Sbjct  9    FHFLQPYPVFPKPSVLLSKFPHSSSPPFSINVHNINNPCRIHFRKFSSVTSPLCSTSG-S  67

Query  236  VPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGR  415
            +PE+  +SESS+SIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLL ENE+WDL+PGGR
Sbjct  68   IPESAETSESSTSIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLKENEKWDLQPGGR  127

Query  416  YFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGG  595
            YFFTRNMSSLVAFAIGKKYSIGNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQ YGG
Sbjct  128  YFFTRNMSSLVAFAIGKKYSIGNGFHVIAAHTDSPCLKLKPKSASTKSGYLMVNVQLYGG  187

Query  596  GLWHTWFDRDLTVAG  640
            GLWHTWFDRDL+VAG
Sbjct  188  GLWHTWFDRDLSVAG  202



>ref|XP_006361458.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=535

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 160/190 (84%), Gaps = 2/190 (1%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTS-HLRNFSATPPLCSSSSDAVPEAF  250
            F  L   P+SK SV  S+F  S   FS+ ++      H RNFS T PLCSSS  ++PE  
Sbjct  7    FQFLQPYPISKPSVFFSKFLQSSPSFSSFSSIKPCRIHFRNFSVTLPLCSSSG-SIPECP  65

Query  251  VssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTR  430
             SSESS+SIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLL ENE+WDL+PGGRYFFTR
Sbjct  66   ESSESSTSIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLKENEKWDLQPGGRYFFTR  125

Query  431  NMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHT  610
            NMSSLVAFAIGKKYSIGNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHT
Sbjct  126  NMSSLVAFAIGKKYSIGNGFHVIAAHTDSPCLKLKPKSASTKSGYLMVNVQTYGGGLWHT  185

Query  611  WFDRDLTVAG  640
            WFDRDL+VAG
Sbjct  186  WFDRDLSVAG  195



>ref|XP_009596186.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=541

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 157/194 (81%), Gaps = 6/194 (3%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANA----NLRTSHLRNFSA-TPPLCSSSSDAV  238
            F  L   P  K SVLLS+ PHS  P  + N     N    H R FSA T PLCS+S    
Sbjct  9    FQFLQPYPFPKPSVLLSKVPHSSSPRFSINVPNVNNPYRIHFRKFSAVTSPLCSTSGSIP  68

Query  239  PEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRY  418
             E+  SSESS+SIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLL ENE+WDL+PGGRY
Sbjct  69   -ESAESSESSTSIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLKENEKWDLQPGGRY  127

Query  419  FFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGG  598
            FFTRNMSSLVAFAIGKKYSIGNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQ YGGG
Sbjct  128  FFTRNMSSLVAFAIGKKYSIGNGFHVIAAHTDSPCLKLKPKSASTKSGYLMVNVQLYGGG  187

Query  599  LWHTWFDRDLTVAG  640
            LWHTWFDRDL+VAG
Sbjct  188  LWHTWFDRDLSVAG  201



>ref|XP_004249975.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=535

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 157/190 (83%), Gaps = 2/190 (1%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTS-HLRNFSATPPLCSSSSDAVPEAF  250
            F  L   P+SK S   S+   +   FS+ ++      H R FS T PLCSSS  ++PE  
Sbjct  7    FQFLQPYPISKPSAFFSKIRQTSPSFSSFSSTKPCRIHFRKFSVTSPLCSSSG-SIPEFP  65

Query  251  VssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTR  430
             SSESS+SIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLL ENE+WDL+PGGRYFFTR
Sbjct  66   ESSESSTSIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLKENEKWDLQPGGRYFFTR  125

Query  431  NMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHT  610
            NMSSLVAFAIGKKYSIG+GFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHT
Sbjct  126  NMSSLVAFAIGKKYSIGDGFHVIAAHTDSPCLKLKPKSASTKSGYLMVNVQTYGGGLWHT  185

Query  611  WFDRDLTVAG  640
            WFDRDL+VAG
Sbjct  186  WFDRDLSVAG  195



>ref|XP_011076919.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Sesamum 
indicum]
Length=539

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 159/196 (81%), Gaps = 11/196 (6%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFS---AANANLRT----SHLRNFSATPPLCSSSSD  232
            FHLL   P+ + S LL +FPH+ R  +   + + NLR     S  R  S TPPLCS S  
Sbjct  7    FHLLQPSPILRPSALLPKFPHASRLLTIHTSYSTNLRRNGAGSGGRKLSITPPLCSKSE-  65

Query  233  AVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGG  412
                +  ++ESS SIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNENEEW+LKPGG
Sbjct  66   ---NSSSNTESSQSIVGDLLDYLNESWTQFHATAEAKRQLLAAGFHLLNENEEWELKPGG  122

Query  413  RYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYG  592
             YFFTRNMSSLVAFAIG+KYS+GNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYG
Sbjct  123  CYFFTRNMSSLVAFAIGEKYSLGNGFHVIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYG  182

Query  593  GGLWHTWFDRDLTVAG  640
            GGLWHTWFDRDL++AG
Sbjct  183  GGLWHTWFDRDLSLAG  198



>gb|EYU19780.1| hypothetical protein MIMGU_mgv1a004147mg [Erythranthe guttata]
Length=542

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 154/200 (77%), Gaps = 16/200 (8%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPF----SAANANLR-------TSHLRNFSATPPLCS  220
            FHL    PL K S +L  +P +  PF    +  N+NLR           R  S TPPL S
Sbjct  7    FHLFQPSPLLKPSAILYNYPLA-SPFFTTRANDNSNLRHNIGGGGGGGRRKLSTTPPLRS  65

Query  221  SSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDL  400
            +S   +       +SS SIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNENEEW L
Sbjct  66   NSEGGISST----QSSMSIVGDLLDYLNESWTQFHATAEAKRQLVAAGFHLLNENEEWKL  121

Query  401  KPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNV  580
            KPGGRYFFTRNMSSLVAFAIG+KYSIGNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNV
Sbjct  122  KPGGRYFFTRNMSSLVAFAIGEKYSIGNGFHVIAAHTDSPCLKLKPKSASSKSGYLMVNV  181

Query  581  QTYGGGLWHTWFDRDLTVAG  640
            QTYGGGLWHTWFDRDL++AG
Sbjct  182  QTYGGGLWHTWFDRDLSLAG  201



>ref|XP_008232012.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=530

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 152/190 (80%), Gaps = 11/190 (6%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
              LL+ PPL+    LL   P            L  S  R+FS +P LCS++S   PE+  
Sbjct  10   LQLLHPPPLTLRRSLLFHKP----------KQLTRSRPRSFSTSPILCSNNSHNTPESSA  59

Query  254  sse-ssssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTR  430
            S+  +++SIVGDLLDYLNESWT FHATAEAKRQLIAAGFHLLNEN+EWDLKPGGRYFFTR
Sbjct  60   STVGANASIVGDLLDYLNESWTHFHATAEAKRQLIAAGFHLLNENDEWDLKPGGRYFFTR  119

Query  431  NMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHT  610
            NMS LVAF++G+KY++GNGFH+IAAHTDSPC+KLKPRSAS KSGYLM+NVQTYGGGLWHT
Sbjct  120  NMSCLVAFSVGEKYTVGNGFHVIAAHTDSPCLKLKPRSASSKSGYLMINVQTYGGGLWHT  179

Query  611  WFDRDLTVAG  640
            WFDRDL+VAG
Sbjct  180  WFDRDLSVAG  189



>ref|XP_010088778.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB36961.1| Aspartyl aminopeptidase [Morus notabilis]
Length=532

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 153/185 (83%), Gaps = 8/185 (4%)
 Frame = +2

Query  86   YAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVsses  265
            + P   K S+LL   P      S ++ N +++  R+FS TP LCS S D VPE+   + +
Sbjct  15   HTPATLKPSILLPNVPR----LSPSSFNFKST--RSFSTTPLLCSVS-DHVPES-SGNGA  66

Query  266  sssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSL  445
            S+SIVGDLLDYLNESWTQFHATAEAKR L+AAGFHLLNEN+EWDLKPGGRYFFTRNMSSL
Sbjct  67   SASIVGDLLDYLNESWTQFHATAEAKRHLVAAGFHLLNENDEWDLKPGGRYFFTRNMSSL  126

Query  446  VAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRD  625
            +AFA+G KY +GNGFH+IAAHTDSPC+KLKP+SAS K+GYLMVNVQTYGGGLW+TWFDRD
Sbjct  127  IAFAVGDKYVVGNGFHVIAAHTDSPCLKLKPKSASSKAGYLMVNVQTYGGGLWYTWFDRD  186

Query  626  LTVAG  640
            LTVAG
Sbjct  187  LTVAG  191



>emb|CAN73045.1| hypothetical protein VITISV_008667 [Vitis vinifera]
Length=250

 Score =   254 bits (648),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 136/158 (86%), Gaps = 2/158 (1%)
 Frame = +2

Query  167  NLRTSHLRNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  346
            N   + LR FS +P LCS S   +  +  S   S SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  40   NFHFTPLRKFSLSPLLCSISDQPLQSS--SGAGSPSIVGDLLDYLNESWTQFHATAEAKR  97

Query  347  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  526
            QLIAAGF LLNEN+EWDL+PGGRY FTRNMSSLVAFAIG+KYS+GNGFH+IAAHTDSPC+
Sbjct  98   QLIAAGFQLLNENDEWDLRPGGRYLFTRNMSSLVAFAIGEKYSVGNGFHVIAAHTDSPCL  157

Query  527  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KLKP+SA+ KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  158  KLKPKSAASKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  195



>ref|XP_009336015.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336016.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 154/191 (81%), Gaps = 14/191 (7%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANAN-LRTSHLRNFSATPPLCSSSSDAVPEAF  250
              L ++P   K SVL   FP         N N LR S  R FS  P LCSS+S  +P++ 
Sbjct  10   MQLPHSPLTVKPSVL---FP---------NPNQLRRSRPRTFSTGPILCSSNSPHLPQSS  57

Query  251  Vsse-ssssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFT  427
            VS+  +++SIVGDLLDYLNESWT FHATAEAKRQLIAAGFHLL+EN+EWDLKPGGRYFFT
Sbjct  58   VSAAGANTSIVGDLLDYLNESWTHFHATAEAKRQLIAAGFHLLSENDEWDLKPGGRYFFT  117

Query  428  RNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWH  607
            RNMS LVAFA+G+KYS+G+GFH+IAAHTDSPC+KLKPRSAS KSGY M+NVQTYGGGLWH
Sbjct  118  RNMSCLVAFAVGEKYSVGSGFHVIAAHTDSPCLKLKPRSASSKSGYQMINVQTYGGGLWH  177

Query  608  TWFDRDLTVAG  640
            TWFDRDL+VAG
Sbjct  178  TWFDRDLSVAG  188



>ref|XP_009336013.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336014.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 152/191 (80%), Gaps = 14/191 (7%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANAN-LRTSHLRNFSATPPLCSSSSDAVPEAF  250
              L ++P   K SVL   FP         N N LR S  R FS  P LCSS+S  +P++ 
Sbjct  10   MQLPHSPLTVKPSVL---FP---------NPNQLRRSRPRTFSTGPILCSSNSPHLPQSS  57

Query  251  Vsses-sssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFT  427
            VS+    +SIVGDLLDYLNESWT FHATAEAKRQLIAAGFHLL+EN+EWDLKPGGRYFFT
Sbjct  58   VSAAGGDTSIVGDLLDYLNESWTHFHATAEAKRQLIAAGFHLLSENDEWDLKPGGRYFFT  117

Query  428  RNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWH  607
            RNMS LVAFA+G+KYS+G+GFH+IAAHTDSPC+KLKPRSAS KSGY M+NVQTYGGGLWH
Sbjct  118  RNMSCLVAFAVGEKYSVGSGFHVIAAHTDSPCLKLKPRSASSKSGYQMINVQTYGGGLWH  177

Query  608  TWFDRDLTVAG  640
            TWFDRDL+VAG
Sbjct  178  TWFDRDLSVAG  188



>ref|XP_010244537.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Nelumbo 
nucifera]
Length=434

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 147/189 (78%), Gaps = 13/189 (7%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
              LL  PP+ KSS+L  ++ +S    S +   L    LR FS  P LCS   D +PE+  
Sbjct  8    LQLLKPPPVVKSSIL-PKYSYS----SFSTPTLHGKRLRKFSTVPHLCSKL-DQLPES--  59

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
                  SIVGDLLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EWDLKPG RYFFTRN
Sbjct  60   -----PSIVGDLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWDLKPGRRYFFTRN  114

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS LVAFAIG+KY++GNGFH+IAAHTDSPC+KLKP+SAS K GYLMVNVQTYG GLWHTW
Sbjct  115  MSCLVAFAIGEKYNVGNGFHVIAAHTDSPCLKLKPKSASSKCGYLMVNVQTYGAGLWHTW  174

Query  614  FDRDLTVAG  640
            FDRDL++AG
Sbjct  175  FDRDLSLAG  183



>ref|XP_010244532.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 147/189 (78%), Gaps = 13/189 (7%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
              LL  PP+ KSS+L  ++ +S    S +   L    LR FS  P LCS   D +PE+  
Sbjct  8    LQLLKPPPVVKSSIL-PKYSYS----SFSTPTLHGKRLRKFSTVPHLCSKL-DQLPES--  59

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
                  SIVGDLLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EWDLKPG RYFFTRN
Sbjct  60   -----PSIVGDLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWDLKPGRRYFFTRN  114

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS LVAFAIG+KY++GNGFH+IAAHTDSPC+KLKP+SAS K GYLMVNVQTYG GLWHTW
Sbjct  115  MSCLVAFAIGEKYNVGNGFHVIAAHTDSPCLKLKPKSASSKCGYLMVNVQTYGAGLWHTW  174

Query  614  FDRDLTVAG  640
            FDRDL++AG
Sbjct  175  FDRDLSLAG  183



>ref|XP_008347038.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=529

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  RFPHS---LRP---FSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVsse-ssssIVG  283
            + PHS   L+P   F   N  LR S  R FS  P LCSS+S  +P++ VS+  +++SI+G
Sbjct  11   QLPHSPLTLKPSVLFPNPN-QLRRSRPRTFSTGPILCSSNSPHLPQSSVSAAGANTSIIG  69

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            DLLDYLNESWT FHATAEAKRQLIAAGFHLL+EN+EWDLKPGGRYFFTRNMS LVAFA+G
Sbjct  70   DLLDYLNESWTHFHATAEAKRQLIAAGFHLLSENDEWDLKPGGRYFFTRNMSCLVAFAVG  129

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            +KYS+G+GFH IAAHTDSPC+KLKPR AS KSGY M+NVQTYGGGLWHTWFDRDL+VAG
Sbjct  130  EKYSVGSGFHAIAAHTDSPCLKLKPRXASSKSGYQMINVQTYGGGLWHTWFDRDLSVAG  188



>ref|XP_009356123.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=531

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 151/190 (79%), Gaps = 10/190 (5%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
               L++P   K SVL   FP   +P+      LR S    FS  P LCSS+S  +P+  V
Sbjct  10   MQFLHSPLTLKPSVL---FP---KPYPN---QLRRSCPHTFSTAPILCSSNSPHLPQCSV  60

Query  254  sse-ssssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTR  430
            S+  +++SIVGDLLDYLNESWT FHATAEAKRQLIA GF LL+EN+EWDLKPGGRYFFTR
Sbjct  61   SAAGANASIVGDLLDYLNESWTHFHATAEAKRQLIATGFQLLSENDEWDLKPGGRYFFTR  120

Query  431  NMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHT  610
            NMS LVAFA+G+KYS+GNGFH+IAAHTDSPC+KLKPRSAS KSGY M+NVQTYGGGLWHT
Sbjct  121  NMSCLVAFAVGEKYSVGNGFHVIAAHTDSPCLKLKPRSASSKSGYQMINVQTYGGGLWHT  180

Query  611  WFDRDLTVAG  640
            WFDRDL+VAG
Sbjct  181  WFDRDLSVAG  190



>ref|XP_002266672.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Vitis 
vinifera]
 ref|XP_010658775.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Vitis 
vinifera]
 ref|XP_010658776.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Vitis 
vinifera]
 ref|XP_010658777.1| PREDICTED: probable aspartyl aminopeptidase isoform X4 [Vitis 
vinifera]
 emb|CBI35256.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 135/158 (85%), Gaps = 2/158 (1%)
 Frame = +2

Query  167  NLRTSHLRNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  346
            N   + LR FS +P LCS S    P    S   S SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  40   NFHFTPLRKFSLSPLLCSISDQ--PLQSSSGAGSPSIVGDLLDYLNESWTQFHATAEAKR  97

Query  347  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  526
            QLIAAGF LLNEN+EWDL+PGGRY FTRNMSSLVAFAIG+KYS+GNGFH+IAAHTDSPC+
Sbjct  98   QLIAAGFQLLNENDEWDLRPGGRYLFTRNMSSLVAFAIGEKYSVGNGFHVIAAHTDSPCL  157

Query  527  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KLKP+SA+ KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  158  KLKPKSAASKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  195



>emb|CDO99897.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 146/193 (76%), Gaps = 5/193 (3%)
 Frame = +2

Query  77   HLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVs  256
             +L+  P  K S L S+FP S  P  +      T   R  S TPPLCSSSS +       
Sbjct  13   QVLHPSPFFKPSTLFSKFPRSSLPIPSTLKRSNTRFRRLSSLTPPLCSSSSHSSSAGGSL  72

Query  257  sessssIVG-----DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYF  421
               SSS  G     DLLDYLNESWTQFHATAEAKRQL+AAGFHLLNEN+EWDLKPGGRYF
Sbjct  73   ESHSSSESGGSVVGDLLDYLNESWTQFHATAEAKRQLLAAGFHLLNENDEWDLKPGGRYF  132

Query  422  FTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGL  601
            FTRNMSSLVAFAIG+KYS GNGFHIIAAHTDSPC+KLKP SAS KSGYLMVNVQTYG GL
Sbjct  133  FTRNMSSLVAFAIGEKYSNGNGFHIIAAHTDSPCLKLKPNSASSKSGYLMVNVQTYGSGL  192

Query  602  WHTWFDRDLTVAG  640
            WHTWFDRDL+VAG
Sbjct  193  WHTWFDRDLSVAG  205



>ref|XP_002524995.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF37402.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=526

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 147/187 (79%), Gaps = 18/187 (10%)
 Frame = +2

Query  80   LLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVss  259
            ++  PP    S+ LS+  HS  P  A    LR S  RNFS+T   CS+S+    +     
Sbjct  18   IINKPP----SLFLSKLSHS--PLYA----LRPS--RNFSSTR--CSTSNQTQTQE----  59

Query  260  essssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMS  439
                SIVGDLLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EWDLKPGGRYFFTRNMS
Sbjct  60   SCDGSIVGDLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWDLKPGGRYFFTRNMS  119

Query  440  SLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFD  619
             LVAFA+G+KY++GNGFH+IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTWFD
Sbjct  120  CLVAFAVGEKYTVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMVNVQTYGGGLWHTWFD  179

Query  620  RDLTVAG  640
            RDL+VAG
Sbjct  180  RDLSVAG  186



>gb|KDP35783.1| hypothetical protein JCGZ_10419 [Jatropha curcas]
Length=526

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 143/187 (76%), Gaps = 22/187 (12%)
 Frame = +2

Query  95   PLSKSSVLLSRF----PHSLRPFSAANANLRTSHLRNFSATPPL-CSSSSDAVPEAFVss  259
            P+ K S+LL +      H+LRP             R FS T    CS+S+ +  +     
Sbjct  17   PIIKPSMLLLKLGNSPSHALRP-------------RKFSVTTTTPCSASNHSQTQE----  59

Query  260  essssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMS  439
                SIVGDLLDYLNESWTQFHATAEAKRQL AAGFHLLNEN+EWDLKPGGRYFFTRNMS
Sbjct  60   SCDGSIVGDLLDYLNESWTQFHATAEAKRQLTAAGFHLLNENDEWDLKPGGRYFFTRNMS  119

Query  440  SLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFD  619
             LVAFA+G+KY++GNGFH+IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTWFD
Sbjct  120  CLVAFAVGEKYTVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMVNVQTYGGGLWHTWFD  179

Query  620  RDLTVAG  640
            RDL+VAG
Sbjct  180  RDLSVAG  186



>gb|KHG01889.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=549

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 144/181 (80%), Gaps = 12/181 (7%)
 Frame = +2

Query  98   LSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVssessssI  277
            L   S   SR PHS   FS    N R    R FS TPPL  SSS +       + ++ SI
Sbjct  10   LHHPSAYFSRLPHSHSSFSI---NFRR---RKFSVTPPLLCSSSSSS------ASTNPSI  57

Query  278  VGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFA  457
            VGDLL+YLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDL+PGGRYFFTRNMS LVAFA
Sbjct  58   VGDLLNYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLRPGGRYFFTRNMSCLVAFA  117

Query  458  IGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVA  637
            +G+KY +GNGFH+IAAHTDSPC+KLKP+SAS KS YLM+NVQTYGGGLWHTWFDRDL+VA
Sbjct  118  VGEKYIVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMLNVQTYGGGLWHTWFDRDLSVA  177

Query  638  G  640
            G
Sbjct  178  G  178



>gb|KJB78672.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
 gb|KJB78673.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
Length=521

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 145/181 (80%), Gaps = 8/181 (4%)
 Frame = +2

Query  98   LSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVssessssI  277
            L   S   SR PHS   FS    N R    R FS TPPL  SSS +   +  S+ ++ SI
Sbjct  10   LHHPSAYFSRLPHSHSSFSI---NFRR---RKFSVTPPLLCSSSSSS--SSSSASTNPSI  61

Query  278  VGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFA  457
            VGDLL+YLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDL+PGGRYFFTRNMS LVAFA
Sbjct  62   VGDLLNYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLRPGGRYFFTRNMSCLVAFA  121

Query  458  IGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVA  637
            +G+KY  GNGFH+IAAHTDSPC+KLKP+SAS KS YLM+NVQTYGGGLWHTWFDRDL+VA
Sbjct  122  VGEKYISGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMLNVQTYGGGLWHTWFDRDLSVA  181

Query  638  G  640
            G
Sbjct  182  G  182



>ref|XP_011076920.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Sesamum 
indicum]
Length=493

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNENEEW+LKPGG YFFTRNMSSLVAF
Sbjct  31   IVGDLLDYLNESWTQFHATAEAKRQLLAAGFHLLNENEEWELKPGGCYFFTRNMSSLVAF  90

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KYS+GNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL++
Sbjct  91   AIGEKYSLGNGFHVIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSL  150

Query  635  AG  640
            AG
Sbjct  151  AG  152



>ref|XP_010907134.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Elaeis 
guineensis]
Length=448

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +2

Query  188  RNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  367
            + FS     CS S D   E   + ESS SIVGDLLDYLNESWTQFHATAEAKRQLIAAGF
Sbjct  37   KGFSTRRLFCSQS-DGSLEDSGAGESSPSIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  95

Query  368  HLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSA  547
             LLNEN++WDL+PGGRYFFTRNMSSLVAFA+G+KY++G+GFH+IAAHTDSPC+KLKPRSA
Sbjct  96   RLLNENDDWDLQPGGRYFFTRNMSSLVAFAVGEKYNVGSGFHVIAAHTDSPCLKLKPRSA  155

Query  548  SCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            S KSG+LMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  156  SSKSGFLMVNVQTYGGGLWHTWFDRDLSVAG  186



>ref|XP_010543610.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=533

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 147/184 (80%), Gaps = 5/184 (3%)
 Frame = +2

Query  92   PPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVssesss  271
            P + K S+ L    H L    A+  N+  S LR+ S +P LCS    + P+   +   S+
Sbjct  14   PTIFKPSLFLR---HHLSRSLASPCNIHGSRLRSLSVSPVLCSQPHHS-PQGESNKPLSA  69

Query  272  sIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVA  451
            SIVGDLLDYLNESWTQFHATAEAKRQL+AAGF LL+ENE+W L+PGGRYFFTRNMS LVA
Sbjct  70   SIVGDLLDYLNESWTQFHATAEAKRQLLAAGFDLLSENEQWKLRPGGRYFFTRNMSCLVA  129

Query  452  FAIGKKYSI-GNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  628
            FA+G+KYS+ GNGFH+IAAHTDSPC+KLKP+SAS KSGYLMV+VQTYGGGLWHTWFDRDL
Sbjct  130  FAVGEKYSVAGNGFHVIAAHTDSPCLKLKPKSASSKSGYLMVSVQTYGGGLWHTWFDRDL  189

Query  629  TVAG  640
            +VAG
Sbjct  190  SVAG  193



>gb|KCW51473.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=459

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 10/189 (5%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
             HLL+ P +S+ S L       L+P    + +  +S +R  S  P LCS +  +   A  
Sbjct  8    LHLLHPPTVSRPSFLF------LKP----SPSPLSSRIRKVSTFPRLCSGADQSPQSASS  57

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
            S+ S  SIVG LLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EW+LKPGGRYFFTRN
Sbjct  58   SAASGGSIVGGLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWNLKPGGRYFFTRN  117

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS L+AFA+G++Y +G+GF +IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTW
Sbjct  118  MSCLIAFAVGERYDVGSGFQVIAAHTDSPCLKLKPKSASTKSNYLMVNVQTYGGGLWHTW  177

Query  614  FDRDLTVAG  640
            FDRDL+VAG
Sbjct  178  FDRDLSVAG  186



>ref|XP_007213437.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
 gb|EMJ14636.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
Length=474

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWT FHATAEAKRQLIAAGFHLLNEN+EWDLKPGGRYFFTRNMS LVAF
Sbjct  12   IVGDLLDYLNESWTHFHATAEAKRQLIAAGFHLLNENDEWDLKPGGRYFFTRNMSCLVAF  71

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            ++G+KY++GNGFH+IAAHTDSPC+KLKPRSAS KSGYLM+NVQTYG GLWHTWFDRDL+V
Sbjct  72   SVGEKYTVGNGFHVIAAHTDSPCLKLKPRSASSKSGYLMINVQTYGSGLWHTWFDRDLSV  131

Query  635  AG  640
            AG
Sbjct  132  AG  133



>ref|XP_002311031.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88398.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=496

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQLI AGF LLNENEEW+LKPGGRYFFTRNMS LVAF
Sbjct  66   IVGDLLDYLNESWTQFHATAEAKRQLIDAGFDLLNENEEWELKPGGRYFFTRNMSCLVAF  125

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KYS+GNGFH+IAAHTDSPC+KLKPRSAS KS YLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  126  AIGEKYSVGNGFHVIAAHTDSPCLKLKPRSASSKSSYLMVNVQTYGGGLWHTWFDRDLSV  185

Query  635  AG  640
            AG
Sbjct  186  AG  187



>gb|KCW51472.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=489

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 10/189 (5%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
             HLL+ P +S+ S L       L+P    + +  +S +R  S  P LCS +  +   A  
Sbjct  8    LHLLHPPTVSRPSFLF------LKP----SPSPLSSRIRKVSTFPRLCSGADQSPQSASS  57

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
            S+ S  SIVG LLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EW+LKPGGRYFFTRN
Sbjct  58   SAASGGSIVGGLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWNLKPGGRYFFTRN  117

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS L+AFA+G++Y +G+GF +IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTW
Sbjct  118  MSCLIAFAVGERYDVGSGFQVIAAHTDSPCLKLKPKSASTKSNYLMVNVQTYGGGLWHTW  177

Query  614  FDRDLTVAG  640
            FDRDL+VAG
Sbjct  178  FDRDLSVAG  186



>ref|XP_010032079.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032080.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Eucalyptus 
grandis]
 ref|XP_010032081.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Eucalyptus 
grandis]
 gb|KCW51471.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=522

 Score =   246 bits (629),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 10/189 (5%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
             HLL+ P +S+ S L       L+P    + +  +S +R  S  P LCS +  +   A  
Sbjct  8    LHLLHPPTVSRPSFLF------LKP----SPSPLSSRIRKVSTFPRLCSGADQSPQSASS  57

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
            S+ S  SIVG LLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EW+LKPGGRYFFTRN
Sbjct  58   SAASGGSIVGGLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWNLKPGGRYFFTRN  117

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS L+AFA+G++Y +G+GF +IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTW
Sbjct  118  MSCLIAFAVGERYDVGSGFQVIAAHTDSPCLKLKPKSASTKSNYLMVNVQTYGGGLWHTW  177

Query  614  FDRDLTVAG  640
            FDRDL+VAG
Sbjct  178  FDRDLSVAG  186



>ref|XP_002311016.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88383.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=526

 Score =   246 bits (629),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQLI AGF LLNENEEW+LKPGGRYFFTRNMS LVAF
Sbjct  66   IVGDLLDYLNESWTQFHATAEAKRQLIDAGFDLLNENEEWELKPGGRYFFTRNMSCLVAF  125

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KYS+GNGFH+IAAHTDSPC+KLKPRSAS KS YLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  126  AIGEKYSVGNGFHVIAAHTDSPCLKLKPRSASSKSSYLMVNVQTYGGGLWHTWFDRDLSV  185

Query  635  AG  640
            AG
Sbjct  186  AG  187



>ref|XP_007010330.1| Zn-dependent exopeptidases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY19140.1| Zn-dependent exopeptidases superfamily protein isoform 2 [Theobroma 
cacao]
Length=452

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDLKPGGRYFFTRNMS LVAF
Sbjct  60   IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLKPGGRYFFTRNMSCLVAF  119

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KY +GNGFH+IAAHTDSPC+KLKP+SAS KS YLM+NVQTYGGGLWHTWFDRDL+V
Sbjct  120  AIGEKYIVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMLNVQTYGGGLWHTWFDRDLSV  179

Query  635  AG  640
            AG
Sbjct  180  AG  181



>ref|XP_007010329.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY19139.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDLKPGGRYFFTRNMS LVAF
Sbjct  60   IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLKPGGRYFFTRNMSCLVAF  119

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KY +GNGFH+IAAHTDSPC+KLKP+SAS KS YLM+NVQTYGGGLWHTWFDRDL+V
Sbjct  120  AIGEKYIVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMLNVQTYGGGLWHTWFDRDLSV  179

Query  635  AG  640
            AG
Sbjct  180  AG  181



>ref|XP_010452373.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 137/157 (87%), Gaps = 4/157 (3%)
 Frame = +2

Query  173  RTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQ  349
            R+  LR+FS+  P LCSS +D+     + S+S++SIVGDLLDYLNESWTQFHATAEAKRQ
Sbjct  36   RSPFLRSFSSVSPILCSSQNDSRS---LGSDSNASIVGDLLDYLNESWTQFHATAEAKRQ  92

Query  350  LIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMK  529
            L+ AGF LL+ENE+W+LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+K
Sbjct  93   LLDAGFDLLSENEDWNLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCLK  152

Query  530  LKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            LKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDLTVAG
Sbjct  153  LKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  189



>ref|XP_006398926.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
 gb|ESQ40379.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
Length=523

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = +2

Query  170  LRTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  346
            L  S  R+FS+  P LCSS S     A        SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  33   LHRSPFRSFSSVSPILCSSHSHGDSNA--------SIVGDLLDYLNESWTQFHATAEAKR  84

Query  347  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  526
            QL+AAGFHLL+ENE+W LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+
Sbjct  85   QLLAAGFHLLSENEDWKLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCL  144

Query  527  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  145  KLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  182



>ref|XP_010907133.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Elaeis 
guineensis]
Length=528

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +2

Query  188  RNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  367
            + FS     CS S D   E   + ESS SIVGDLLDYLNESWTQFHATAEAKRQLIAAGF
Sbjct  37   KGFSTRRLFCSQS-DGSLEDSGAGESSPSIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  95

Query  368  HLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSA  547
             LLNEN++WDL+PGGRYFFTRNMSSLVAFA+G+KY++G+GFH+IAAHTDSPC+KLKPRSA
Sbjct  96   RLLNENDDWDLQPGGRYFFTRNMSSLVAFAVGEKYNVGSGFHVIAAHTDSPCLKLKPRSA  155

Query  548  SCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            S KSG+LMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  156  SSKSGFLMVNVQTYGGGLWHTWFDRDLSVAG  186



>ref|XP_010490993.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 137/157 (87%), Gaps = 4/157 (3%)
 Frame = +2

Query  173  RTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQ  349
            R+  LR+FS+  P LCSS SD+   +F  S+S+ SIVGDLLDYLNESWTQFHATAEAKRQ
Sbjct  36   RSPFLRSFSSVSPILCSSQSDS--RSF-GSDSNGSIVGDLLDYLNESWTQFHATAEAKRQ  92

Query  350  LIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMK  529
            L+ AGF LL+ENE+W LKPGGRYFFTRNMS LVAFA+GK+Y  GNGFH IAAHTDSPC+K
Sbjct  93   LLDAGFDLLSENEDWKLKPGGRYFFTRNMSCLVAFAVGKEYVSGNGFHAIAAHTDSPCLK  152

Query  530  LKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            LKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  153  LKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  189



>ref|XP_008788174.1| PREDICTED: probable aspartyl aminopeptidase [Phoenix dactylifera]
Length=533

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +2

Query  188  RNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  367
            ++FSA    CS S D   E   + ESS SIVGDLLDYLNESWTQFHATAEAKRQLIAAGF
Sbjct  43   KSFSARRLFCSKS-DGPLEDSGAGESSPSIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  101

Query  368  HLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSA  547
             LLNEN++WDL+PGGRYFFTRNMSSLVAFA+G+KY++G+GFH+IAAHTDSPC+KLKPRSA
Sbjct  102  RLLNENDDWDLQPGGRYFFTRNMSSLVAFAVGEKYNVGSGFHVIAAHTDSPCLKLKPRSA  161

Query  548  SCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            S KSG+LMVNVQTYG GLWHTWFDRDL+VAG
Sbjct  162  SSKSGFLMVNVQTYGSGLWHTWFDRDLSVAG  192



>ref|XP_010694702.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +2

Query  194  FSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHL  373
            FS  P L SS++D + E   ++ESS SIVGD L+YLNESWTQFHATAEAKRQL+AAGFHL
Sbjct  42   FSVFPSL-SSNADQIHETSSNAESSGSIVGDFLNYLNESWTQFHATAEAKRQLLAAGFHL  100

Query  374  LNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASC  553
            LNE+EEW+LKPGGRYFFTRNMSSLVAF+IG+KY+ GNGFHIIAAHTDSPC+KLKP SAS 
Sbjct  101  LNESEEWELKPGGRYFFTRNMSSLVAFSIGEKYNAGNGFHIIAAHTDSPCLKLKPISASS  160

Query  554  KSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            K GYLM+NVQTYGGGLWHTWFDRDL+VAG
Sbjct  161  KPGYLMLNVQTYGGGLWHTWFDRDLSVAG  189



>ref|XP_010423546.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=536

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 135/157 (86%), Gaps = 4/157 (3%)
 Frame = +2

Query  173  RTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQ  349
            R+  LR+FS+  P LCSS  D+ P   + S+S++SI GDLLDYLNESWTQFHATAEAKRQ
Sbjct  36   RSPFLRSFSSVSPILCSSQGDSRP---LGSDSNASIFGDLLDYLNESWTQFHATAEAKRQ  92

Query  350  LIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMK  529
            L+ AGF LL+ENE+W LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+K
Sbjct  93   LLDAGFDLLSENEDWKLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCLK  152

Query  530  LKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            LKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  153  LKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  189



>ref|XP_008446766.1| PREDICTED: probable aspartyl aminopeptidase [Cucumis melo]
Length=527

 Score =   244 bits (622),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 139/189 (74%), Gaps = 11/189 (6%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
              LL+  P  KS  + SRFPH  R           S  R F     LCS S      +  
Sbjct  9    LQLLHFTPSLKSPSIFSRFPHFSR-----------SSPRKFLPPRLLCSVSDSTPQNSSS  57

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
               SSSSIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNE+EEWDLKPGG YFFTRN
Sbjct  58   EVGSSSSIVGDLLDYLNESWTQFHATAEAKRQLVAAGFHLLNEDEEWDLKPGGCYFFTRN  117

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS LVAF+IG+KY  GNGFH+IAAHTDSPC+KLKP+S+S K   LMVNVQTYGGGLWHTW
Sbjct  118  MSCLVAFSIGEKYVPGNGFHVIAAHTDSPCLKLKPKSSSNKCNCLMVNVQTYGGGLWHTW  177

Query  614  FDRDLTVAG  640
            FDRDL+VAG
Sbjct  178  FDRDLSVAG  186



>ref|XP_009390025.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EWDL+PGGRYFFTRNMS LVAF
Sbjct  73   IVGDLLDYLNESWTQFHATAEAKRQLIEAGFHLLNENDEWDLRPGGRYFFTRNMSCLVAF  132

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
             +G++YS+G+GFH+IAAHTDSPC+KLKPRSAS KSG+LMVNVQTYGGGLWHTWFDRDL+V
Sbjct  133  VVGERYSVGSGFHVIAAHTDSPCLKLKPRSASSKSGFLMVNVQTYGGGLWHTWFDRDLSV  192

Query  635  AG  640
            AG
Sbjct  193  AG  194



>ref|XP_011032849.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=526

 Score =   244 bits (622),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQLI AGF LLNE+EEW+LKPGGRYFFTRNMS LVAF
Sbjct  66   IVGDLLDYLNESWTQFHATAEAKRQLIDAGFDLLNEHEEWELKPGGRYFFTRNMSCLVAF  125

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KYS+GNGFH+IAAHTDSPC+KLKPRSAS KS YLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  126  AIGEKYSVGNGFHVIAAHTDSPCLKLKPRSASSKSSYLMVNVQTYGGGLWHTWFDRDLSV  185

Query  635  AG  640
            AG
Sbjct  186  AG  187



>ref|XP_010694703.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=505

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +2

Query  194  FSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHL  373
            FS  P L SS++D + E   ++ESS SIVGD L+YLNESWTQFHATAEAKRQL+AAGFHL
Sbjct  42   FSVFPSL-SSNADQIHETSSNAESSGSIVGDFLNYLNESWTQFHATAEAKRQLLAAGFHL  100

Query  374  LNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASC  553
            LNE+EEW+LKPGGRYFFTRNMSSLVAF+IG+KY+ GNGFHIIAAHTDSPC+KLKP SAS 
Sbjct  101  LNESEEWELKPGGRYFFTRNMSSLVAFSIGEKYNAGNGFHIIAAHTDSPCLKLKPISASS  160

Query  554  KSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            K GYLM+NVQTYGGGLWHTWFDRDL+VAG
Sbjct  161  KPGYLMLNVQTYGGGLWHTWFDRDLSVAG  189



>ref|XP_010694701.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +2

Query  194  FSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHL  373
            FS  P L SS++D + E   ++ESS SIVGD L+YLNESWTQFHATAEAKRQL+AAGFHL
Sbjct  42   FSVFPSL-SSNADQIHETSSNAESSGSIVGDFLNYLNESWTQFHATAEAKRQLLAAGFHL  100

Query  374  LNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASC  553
            LNE+EEW+LKPGGRYFFTRNMSSLVAF+IG+KY+ GNGFHIIAAHTDSPC+KLKP SAS 
Sbjct  101  LNESEEWELKPGGRYFFTRNMSSLVAFSIGEKYNAGNGFHIIAAHTDSPCLKLKPISASS  160

Query  554  KSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            K GYLM+NVQTYGGGLWHTWFDRDL+VAG
Sbjct  161  KPGYLMLNVQTYGGGLWHTWFDRDLSVAG  189



>ref|XP_006287486.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
 gb|EOA20384.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
Length=529

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 4/158 (3%)
 Frame = +2

Query  170  LRTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  346
            L  S  R+FS+  P LCSS  D+     + S+S++SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  34   LHRSPFRSFSSVSPILCSSQDDSRS---LGSDSNASIVGDLLDYLNESWTQFHATAEAKR  90

Query  347  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  526
            QL+AAGF LL+ENE+W LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+
Sbjct  91   QLLAAGFDLLSENEDWKLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCL  150

Query  527  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  151  KLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  188



>ref|NP_196091.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 emb|CAB86013.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
 dbj|BAB08975.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AED90774.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 4/158 (3%)
 Frame = +2

Query  170  LRTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  346
            L  S  R+FS+  P LC+S  D+       S+S++SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  33   LHRSPFRSFSSVSPILCTSHRDSRSPG---SDSNASIVGDLLDYLNESWTQFHATAEAKR  89

Query  347  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  526
            QL+AAGF LL+ENE+W+LKPGGRYFFTRNMS LVAFA+G+KY  GNGFH IAAHTDSPC+
Sbjct  90   QLLAAGFDLLSENEDWNLKPGGRYFFTRNMSCLVAFAVGEKYVPGNGFHAIAAHTDSPCL  149

Query  527  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  150  KLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  187



>ref|XP_004150844.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=527

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 140/189 (74%), Gaps = 11/189 (6%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
              LL+  P  KS  + SRFPH  R           S  R F     LCS S      +  
Sbjct  9    LQLLHFTPSLKSPSIFSRFPHFSR-----------SSPRKFFPPRLLCSVSDSTPQNSSS  57

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
             + SSSSIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLL+E+EEWDLKPGG YFFTRN
Sbjct  58   EAGSSSSIVGDLLDYLNESWTQFHATAEAKRQLVAAGFHLLDEDEEWDLKPGGCYFFTRN  117

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS LVAF+IG+KY  GNGFH+IAAHTDSPC+KLKP+S+S K   LMVNVQTYGGGLWHTW
Sbjct  118  MSCLVAFSIGEKYVPGNGFHVIAAHTDSPCLKLKPKSSSNKCNCLMVNVQTYGGGLWHTW  177

Query  614  FDRDLTVAG  640
            FDRDL+VAG
Sbjct  178  FDRDLSVAG  186



>ref|XP_009122574.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=527

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNENE+W+LKPGGRYFFTRNMS LVAF
Sbjct  64   IVGDLLDYLNESWTQFHATAEAKRQLLAAGFHLLNENEDWNLKPGGRYFFTRNMSCLVAF  123

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G KY  GNGFH IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  124  AVGDKYVPGNGFHAIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSV  183

Query  635  AG  640
            AG
Sbjct  184  AG  185



>dbj|BAC43404.1| putative aspartyl aminopeptidase [Arabidopsis thaliana]
Length=526

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 135/158 (85%), Gaps = 4/158 (3%)
 Frame = +2

Query  170  LRTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  346
            L  S  R+FS+  P LC+S  D+       S+S++SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  33   LHRSPFRSFSSVSPILCTSHRDSRSPG---SDSNASIVGDLLDYLNESWTQFHATAEAKR  89

Query  347  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  526
            Q +AAGF LL+ENE+W+LKPGGRYFFTRNMS LVAFA+G+KY  GNGFH IAAHTDSPC+
Sbjct  90   QFLAAGFDLLSENEDWNLKPGGRYFFTRNMSCLVAFAVGEKYVPGNGFHAIAAHTDSPCL  149

Query  527  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  150  KLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  187



>emb|CDY44874.1| BnaC09g50740D [Brassica napus]
Length=517

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 131/157 (83%), Gaps = 14/157 (9%)
 Frame = +2

Query  170  LRTSHLRNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQ  349
            L  S  R+FSA     SS SD+          ++SIVGDLLDYLNESWTQFHATAEAKRQ
Sbjct  34   LNRSPFRSFSAV----SSGSDS----------NASIVGDLLDYLNESWTQFHATAEAKRQ  79

Query  350  LIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMK  529
            L+AAGFHLL+ENE+W+LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+K
Sbjct  80   LLAAGFHLLSENEDWNLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCLK  139

Query  530  LKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            LKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  140  LKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  176



>gb|KGN52197.1| hypothetical protein Csa_5G615200 [Cucumis sativus]
Length=527

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 139/189 (74%), Gaps = 11/189 (6%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
              LL+  P  KS  + SRFPH  R           S  R F     LCS S      +  
Sbjct  9    LQLLHFTPSLKSPSIFSRFPHFSR-----------SSPRKFFPPRLLCSVSDSTPQNSSS  57

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
             + SSSSIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLL+E+EEWDLKPGG YFFTRN
Sbjct  58   EAGSSSSIVGDLLDYLNESWTQFHATAEAKRQLVAAGFHLLDEDEEWDLKPGGCYFFTRN  117

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS  VAF+IG+KY  GNGFH+IAAHTDSPC+KLKP+S+S K   LMVNVQTYGGGLWHTW
Sbjct  118  MSCFVAFSIGEKYVPGNGFHVIAAHTDSPCLKLKPKSSSNKCNCLMVNVQTYGGGLWHTW  177

Query  614  FDRDLTVAG  640
            FDRDL+VAG
Sbjct  178  FDRDLSVAG  186



>gb|KFK24913.1| hypothetical protein AALP_AA8G041200 [Arabis alpina]
Length=523

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  179  SHLRNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIA  358
            S  R+FS   P+  SSS       + S+S++SIVGDLLDYLNESWTQFHATAEAKRQL+A
Sbjct  29   SRFRSFSTVSPILCSSSSQGDSKSLGSDSNASIVGDLLDYLNESWTQFHATAEAKRQLLA  88

Query  359  AGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKP  538
            AGF L++ENE+W LKPGGRYFFTRNMS LVAFA+G+KY  GNGFH IAAHTDSPC+KLKP
Sbjct  89   AGFDLISENEDWKLKPGGRYFFTRNMSCLVAFAVGEKYVPGNGFHAIAAHTDSPCLKLKP  148

Query  539  RSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            +SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  149  KSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAG  182



>ref|XP_006485213.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485214.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Citrus 
sinensis]
 gb|KDO42026.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=522

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 142/189 (75%), Gaps = 19/189 (10%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
            FH  Y     +++V+ S+  HS   F ++N   R   L NFS +                
Sbjct  12   FH--YPSSTVRTTVISSKLHHS---FPSSN-RYRPRTLHNFSTS-------------GIA  52

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
             S SSSSIVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRN
Sbjct  53   QSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRN  112

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS LVAFA+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTW
Sbjct  113  MSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTW  172

Query  614  FDRDLTVAG  640
            FDRDLTVAG
Sbjct  173  FDRDLTVAG  181



>gb|KDO42029.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=510

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 142/189 (75%), Gaps = 19/189 (10%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
            FH  Y     +++V+ S+  HS   F ++N   R   L NFS +                
Sbjct  12   FH--YPSSTVRTTVISSKLHHS---FPSSN-RYRPRTLHNFSTS-------------GIA  52

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
             S SSSSIVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRN
Sbjct  53   QSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRN  112

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS LVAFA+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTW
Sbjct  113  MSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTW  172

Query  614  FDRDLTVAG  640
            FDRDLTVAG
Sbjct  173  FDRDLTVAG  181



>ref|XP_006436621.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49861.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=542

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 142/189 (75%), Gaps = 19/189 (10%)
 Frame = +2

Query  74   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  253
            FH  Y     +++V+ S+  HS   F ++N   R   L NFS +                
Sbjct  32   FH--YPSSTVRTTVISSKLHHS---FPSSN-RYRPRTLHNFSTS-------------GIA  72

Query  254  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  433
             S SSSSIVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRN
Sbjct  73   QSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRN  132

Query  434  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            MS LVAFA+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTW
Sbjct  133  MSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTW  192

Query  614  FDRDLTVAG  640
            FDRDLTVAG
Sbjct  193  FDRDLTVAG  201



>emb|CDX70207.1| BnaA10g25560D [Brassica napus]
Length=528

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV DLLDYLNESWTQFHATAEAKRQL+AAGFHLL+EN++W+LKPGGRYFFTRNMS LVAF
Sbjct  65   IVDDLLDYLNESWTQFHATAEAKRQLLAAGFHLLSENDDWNLKPGGRYFFTRNMSCLVAF  124

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G KY  GNGFH IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  125  AVGDKYVPGNGFHAIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSV  184

Query  635  AG  640
            AG
Sbjct  185  AG  186



>ref|XP_004496198.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=534

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 117/123 (95%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV DLLDYLNESWT FHATAEAKRQLIAAGFHLL+ENEEW+LKPGGRYFFTRNMSSLVAF
Sbjct  71   IVNDLLDYLNESWTHFHATAEAKRQLIAAGFHLLDENEEWNLKPGGRYFFTRNMSSLVAF  130

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCK-SGYLMVNVQTYGGGLWHTWFDRDLT  631
            A+G+KY++G+GFH IAAHTDSPC+KLKP++AS K S YLMVNVQTYGGGLWHTWFDRDL+
Sbjct  131  AVGEKYNVGDGFHAIAAHTDSPCLKLKPKTASLKSSSYLMVNVQTYGGGLWHTWFDRDLS  190

Query  632  VAG  640
            VAG
Sbjct  191  VAG  193



>ref|XP_002873165.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49424.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWTQFHATAEAKRQL+AAGF LL+ENE+W LKPGGRYFFTRNMS LVAF
Sbjct  65   IVGDLLDYLNESWTQFHATAEAKRQLLAAGFDLLSENEDWKLKPGGRYFFTRNMSCLVAF  124

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G+KY  GNGFH IAAHTDSPC+KLKP+SAS K GYLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  125  AVGEKYVPGNGFHAIAAHTDSPCLKLKPKSASSKFGYLMVNVQTYGGGLWHTWFDRDLSV  184

Query  635  AG  640
            AG
Sbjct  185  AG  186



>gb|AES62027.2| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=526

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV DLLDYLNESWT FHATAEAKRQLIAAGFHLLNENEEW+LKPGGRYFFTRNMS LVAF
Sbjct  63   IVNDLLDYLNESWTHFHATAEAKRQLIAAGFHLLNENEEWNLKPGGRYFFTRNMSCLVAF  122

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCK-SGYLMVNVQTYGGGLWHTWFDRDLT  631
            A+G+KY +GNGF+ IAAHTDSPC+KLKP++AS K S Y+MVNVQTYGGGLWHTWFDRDL+
Sbjct  123  AVGQKYDVGNGFYAIAAHTDSPCLKLKPKTASLKASSYMMVNVQTYGGGLWHTWFDRDLS  182

Query  632  VAG  640
            VAG
Sbjct  183  VAG  185



>ref|XP_006645339.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=525

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 141/184 (77%), Gaps = 12/184 (7%)
 Frame = +2

Query  119  LSRFPHSLRPFSAANA-----NLRTSHLRNFSATPP-----LCSSSSDAVPEAFVssess  268
            L R  H LRP +AA        L TS  R    T       LCS  + + P+A    ++S
Sbjct  3    LLRAHHLLRPRAAARPLSLPPPLSTSPCRRALPTTTSSWRLLCSHRTASPPDA--DGDAS  60

Query  269  ssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLV  448
             SIV DLLDYLNESWTQFHATAEAKRQL+ AGF LL+EN++WDL+PGGRYFFTRNMS L+
Sbjct  61   PSIVADLLDYLNESWTQFHATAEAKRQLLDAGFTLLSENDDWDLQPGGRYFFTRNMSCLI  120

Query  449  AFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  628
            AFA+G+KY +GNGF+IIAAHTDSPC+KLKPRSAS KSG+ MVNVQTYGGGLWHTWFDRDL
Sbjct  121  AFAVGEKYKLGNGFNIIAAHTDSPCLKLKPRSASFKSGHQMVNVQTYGGGLWHTWFDRDL  180

Query  629  TVAG  640
            T+AG
Sbjct  181  TLAG  184



>ref|NP_001045513.1| Os01g0967900 [Oryza sativa Japonica Group]
 dbj|BAB85315.1| putative aspartyl aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAF07427.1| Os01g0967900 [Oryza sativa Japonica Group]
 gb|EEE56077.1| hypothetical protein OsJ_04900 [Oryza sativa Japonica Group]
Length=525

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  212  LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEE  391
            LCS  + + PE   S+ +S SIV DLLDYLNESWTQFHATAEAKRQL+ AGF LL+EN++
Sbjct  44   LCSHHASSPPED-ASASASPSIVADLLDYLNESWTQFHATAEAKRQLLDAGFTLLSENDD  102

Query  392  WDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLM  571
            WDL+PGGRYFFTRNMS L+AFA+G+KY +GNGF+IIAAHTDSPC+KLKPRSAS KSG+ M
Sbjct  103  WDLQPGGRYFFTRNMSCLIAFAVGEKYKLGNGFNIIAAHTDSPCLKLKPRSASFKSGHQM  162

Query  572  VNVQTYGGGLWHTWFDRDLTVAG  640
            VNVQTYGGGLWHTWFDRDLT+AG
Sbjct  163  VNVQTYGGGLWHTWFDRDLTLAG  185



>gb|EEC72239.1| hypothetical protein OsI_05355 [Oryza sativa Indica Group]
Length=493

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  212  LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEE  391
            LCS  + + P+    + +S SIV DLLDYLNESWTQFHATAEAKRQL+ AGF LL+EN++
Sbjct  44   LCSHHASSPPDD-APTSASPSIVADLLDYLNESWTQFHATAEAKRQLLDAGFTLLSENDD  102

Query  392  WDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLM  571
            WDL+PGGRYFFTRNMS L+AFA+G+KY +GNGF+IIAAHTDSPC+KLKPRSAS KSG+ M
Sbjct  103  WDLQPGGRYFFTRNMSCLIAFAVGEKYKLGNGFNIIAAHTDSPCLKLKPRSASFKSGHQM  162

Query  572  VNVQTYGGGLWHTWFDRDLTVAG  640
            VNVQTYGGGLWHTWFDRDLT+AG
Sbjct  163  VNVQTYGGGLWHTWFDRDLTLAG  185



>ref|XP_007143804.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
 gb|ESW15798.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
Length=527

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV DLL YLN SWTQFHATAEAKRQL+AAGFH+LNEN++WDLKPGGRYFFTRNMS LVAF
Sbjct  65   IVPDLLQYLNHSWTQFHATAEAKRQLLAAGFHMLNENQDWDLKPGGRYFFTRNMSCLVAF  124

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G+KY++G+GFH+IAAHTDSPC+KLKP++ASCK  Y MVNVQTYG GLW+TWFDRDL+V
Sbjct  125  AVGEKYNVGDGFHVIAAHTDSPCLKLKPKTASCKCNYSMVNVQTYGAGLWYTWFDRDLSV  184

Query  635  AG  640
            AG
Sbjct  185  AG  186



>ref|XP_006851486.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
 gb|ERN13067.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
Length=546

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 147/195 (75%), Gaps = 14/195 (7%)
 Frame = +2

Query  98   LSKSSVLLS-RFPHSLRPFSAA-NANLRTSHLRNFSATPPL--------CSS----SSDA  235
            L+ S ++ S R      PFS   +++ R   L  FSATP +        CS+    SS+ 
Sbjct  9    LNPSPIITSPRICRGRTPFSTILSSDFRGLKLHGFSATPRIPFFLPKLYCSNGELVSSEN  68

Query  236  VPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGR  415
                  SS S  SI+G++LD+LNESWTQFHATAEAKRQL+AAGFH+LNEN+EWD+KPGGR
Sbjct  69   QSFETSSSRSPFSIIGEMLDFLNESWTQFHATAEAKRQLLAAGFHMLNENDEWDIKPGGR  128

Query  416  YFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGG  595
            YFFTRNMS L+AF++G+KY+ G+GFH++AAHTDSPC KLKP +AS KSG+LMVN+QTYG 
Sbjct  129  YFFTRNMSCLIAFSVGEKYNAGSGFHVVAAHTDSPCPKLKPITASSKSGFLMVNIQTYGA  188

Query  596  GLWHTWFDRDLTVAG  640
            GLWHTWFDRDL+VAG
Sbjct  189  GLWHTWFDRDLSVAG  203



>ref|XP_003565148.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=520

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVG LLDYLNESWTQFHATAEAKRQL+ AGF LL+EN++WDL+PGGRYFFTRNMS LVAF
Sbjct  58   IVGGLLDYLNESWTQFHATAEAKRQLLDAGFKLLSENDDWDLQPGGRYFFTRNMSCLVAF  117

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G+KY +GNGF+IIAAHTDSPC+KLKP+SAS KSG+ MVNVQTYGGGLWHTWFDRDLT+
Sbjct  118  AVGEKYRVGNGFNIIAAHTDSPCLKLKPKSASFKSGHQMVNVQTYGGGLWHTWFDRDLTL  177

Query  635  AG  640
            AG
Sbjct  178  AG  179



>gb|EPS58587.1| aspartyl aminopeptidase, partial [Genlisea aurea]
Length=468

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DLLDYLNESWTQFHATAEAKRQLIA+GFHLL+ENEEW+LK GGRYFFTRNMSSLVAF
Sbjct  6    LVRDLLDYLNESWTQFHATAEAKRQLIASGFHLLDENEEWNLKAGGRYFFTRNMSSLVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G++YS  NGFH+IAAHTDSPC+KLKP+SAS K+GYLMV VQTYG GLWHTWFDRDL++
Sbjct  66   AVGERYSGSNGFHVIAAHTDSPCLKLKPKSASSKAGYLMVGVQTYGAGLWHTWFDRDLSL  125

Query  635  AG  640
             G
Sbjct  126  GG  127



>dbj|BAJ86698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVG LLDYLNESWTQFHATAEAK+QL+ AGF LL+EN++W+L+PGGRYFFTRNMS LVAF
Sbjct  51   IVGGLLDYLNESWTQFHATAEAKKQLLEAGFELLSENDDWNLQPGGRYFFTRNMSCLVAF  110

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G+KY +GNGF+IIAAHTDSPC+KLKPRS+S KSG+ MV VQTYGGGLWHTWFDRDLT+
Sbjct  111  AVGEKYRVGNGFNIIAAHTDSPCLKLKPRSSSFKSGHQMVGVQTYGGGLWHTWFDRDLTL  170

Query  635  AG  640
            AG
Sbjct  171  AG  172



>ref|XP_002457006.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
 gb|EES02126.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
Length=524

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV  LLDYLNESWTQFHATAEAKRQL+ AGF LL+E+++WDL+PGGRYFFTRNMS LVAF
Sbjct  63   IVAGLLDYLNESWTQFHATAEAKRQLLDAGFKLLSESDDWDLQPGGRYFFTRNMSCLVAF  122

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KY +GNGF+IIAAHTDSPC+KLKPRSA+ KSG+ MVNVQTYG GLWHTWFDRDLT+
Sbjct  123  AIGEKYRVGNGFNIIAAHTDSPCLKLKPRSATIKSGHQMVNVQTYGSGLWHTWFDRDLTL  182

Query  635  AG  640
            AG
Sbjct  183  AG  184



>ref|XP_003556268.2| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=539

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV DLL YLN SWTQFHATAEAKRQL+AAGFH+L+EN +W LKPGGRYFFTRNMS LVAF
Sbjct  75   IVPDLLHYLNHSWTQFHATAEAKRQLLAAGFHMLDENHDWHLKPGGRYFFTRNMSCLVAF  134

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY++G+GFH+IAAHTDSPC+KLKP++ASCK  Y MVNVQTYG GLW+TWFDRDL+V
Sbjct  135  AIGDKYNVGDGFHVIAAHTDSPCLKLKPKTASCKCNYSMVNVQTYGAGLWYTWFDRDLSV  194

Query  635  AG  640
            AG
Sbjct  195  AG  196



>gb|KHN00906.1| Aspartyl aminopeptidase [Glycine soja]
Length=518

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV DLL YLN SWTQFHATAEAKRQL+AAGFH+L+EN +W LKPGGRYFFTRNMS LVAF
Sbjct  54   IVPDLLHYLNHSWTQFHATAEAKRQLLAAGFHMLDENHDWHLKPGGRYFFTRNMSCLVAF  113

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY++G+GFH+IAAHTDSPC+KLKP++ASCK  Y MVNVQTYG GLW+TWFDRDL+V
Sbjct  114  AIGDKYNVGDGFHVIAAHTDSPCLKLKPKTASCKCNYSMVNVQTYGAGLWYTWFDRDLSV  173

Query  635  AG  640
            AG
Sbjct  174  AG  175



>ref|XP_004971394.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Setaria 
italica]
Length=525

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 120/144 (83%), Gaps = 10/144 (7%)
 Frame = +2

Query  209  PLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENE  388
            PL +SSS A P           IV  LLDYLNESWT FHATAEAKRQL+ AGF LL+E++
Sbjct  52   PLDASSSAAPPS----------IVAGLLDYLNESWTHFHATAEAKRQLLDAGFKLLSESD  101

Query  389  EWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYL  568
            +WDL+PGGRYFFTRNMS LVAFAIG+KY +GNGF+IIAAHTDSPC+KLKPRSA+ KSG+ 
Sbjct  102  DWDLQPGGRYFFTRNMSCLVAFAIGEKYRVGNGFNIIAAHTDSPCLKLKPRSATFKSGHQ  161

Query  569  MVNVQTYGGGLWHTWFDRDLTVAG  640
            MVNVQTYG GLWHTWFDRDLT+AG
Sbjct  162  MVNVQTYGSGLWHTWFDRDLTLAG  185



>gb|KHN37829.1| Aspartyl aminopeptidase [Glycine soja]
Length=500

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 6/142 (4%)
 Frame = +2

Query  215  CSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW  394
            CS +S++ P        SSSIV +LL YLN S TQFHATAEAK+QL+AAGFH+LNEN++W
Sbjct  44   CSINSNSAPHG------SSSIVTNLLHYLNHSCTQFHATAEAKQQLLAAGFHMLNENKDW  97

Query  395  DLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMV  574
             LKPGGRYFFTRNMS L+AFAIG KY++G+GFH+IAAHTDSPC+KLKP++ASCK  Y MV
Sbjct  98   HLKPGGRYFFTRNMSCLIAFAIGDKYNVGDGFHVIAAHTDSPCLKLKPKTASCKCNYSMV  157

Query  575  NVQTYGGGLWHTWFDRDLTVAG  640
            NVQTYG GLW+TWFDRDL+VAG
Sbjct  158  NVQTYGAGLWYTWFDRDLSVAG  179



>ref|XP_003591776.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=550

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 115/147 (78%), Gaps = 25/147 (17%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHAT------------------------AEAKRQLIAAGFHLLNE  382
            IV DLLDYLNESWT FHAT                        AEAKRQLIAAGFHLLNE
Sbjct  63   IVNDLLDYLNESWTHFHATGTVPSFHSYYSSILPKLTFFISCVAEAKRQLIAAGFHLLNE  122

Query  383  NEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCK-S  559
            NEEW+LKPGGRYFFTRNMS LVAFA+G+KY +GNGF+ IAAHTDSPC+KLKP++AS K S
Sbjct  123  NEEWNLKPGGRYFFTRNMSCLVAFAVGQKYDVGNGFYAIAAHTDSPCLKLKPKTASLKAS  182

Query  560  GYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             Y+MVNVQTYGGGLWHTWFDRDL+VAG
Sbjct  183  SYMMVNVQTYGGGLWHTWFDRDLSVAG  209



>ref|XP_004971395.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Setaria 
italica]
Length=523

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 119/144 (83%), Gaps = 12/144 (8%)
 Frame = +2

Query  209  PLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENE  388
            PL +SSS A P           IV  LLDYLNESWT FHATAEAKRQL+ AGF LL+E++
Sbjct  52   PLDASSSAAPPS----------IVAGLLDYLNESWTHFHATAEAKRQLLDAGFKLLSESD  101

Query  389  EWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYL  568
            +WDL+PGGRYFFTRNMS LVAFAIG+K  +GNGF+IIAAHTDSPC+KLKPRSA+ KSG+ 
Sbjct  102  DWDLQPGGRYFFTRNMSCLVAFAIGEK--VGNGFNIIAAHTDSPCLKLKPRSATFKSGHQ  159

Query  569  MVNVQTYGGGLWHTWFDRDLTVAG  640
            MVNVQTYG GLWHTWFDRDLT+AG
Sbjct  160  MVNVQTYGSGLWHTWFDRDLTLAG  183



>ref|XP_001751765.1| predicted protein [Physcomitrella patens]
 gb|EDQ83200.1| predicted protein, partial [Physcomitrella patens]
Length=471

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV D+L++LNESWT FHATAEAKRQL+ AGF  LNE +EW ++PGGRYFFTRNMSS+ AF
Sbjct  2    IVTDMLNFLNESWTPFHATAEAKRQLLKAGFQQLNEEQEWTVQPGGRYFFTRNMSSIFAF  61

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KY  GNGF+I+AAHTDSPC KLKP SA+ K+G+L V VQTYGGGLWHTWFDRDL+V
Sbjct  62   AIGQKYEAGNGFNIVAAHTDSPCPKLKPVSAASKAGFLNVGVQTYGGGLWHTWFDRDLSV  121

Query  635  AG  640
            AG
Sbjct  122  AG  123



>ref|XP_002975004.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
 gb|EFJ23789.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
Length=477

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  236  VPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGR  415
            +PE    +E  +SI+ D L +LN SWT FHAT EAK+ L+ AGF  LNE +EW ++PGGR
Sbjct  1    MPEEPPKTEEDTSILSDFLCFLNASWTPFHATMEAKKLLLDAGFLQLNEEDEWSIEPGGR  60

Query  416  YFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGG  595
            YFFTRNMS+LVAFAIG+KY  GNGFH++AAHTDSPC KLKP SA  KSG+L + VQTYGG
Sbjct  61   YFFTRNMSTLVAFAIGQKYQTGNGFHVVAAHTDSPCPKLKPVSALSKSGFLNLGVQTYGG  120

Query  596  GLWHTWFDRDLTVAG  640
            GLWHTWFDRDL+VAG
Sbjct  121  GLWHTWFDRDLSVAG  135



>ref|XP_003055398.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60650.1| predicted protein [Micromonas pusilla CCMP1545]
Length=476

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            I  +L+DYLN SWT FHAT+E+ R L AAGF  L+E E WDLKPGG+YFFTRNMSS+VAF
Sbjct  12   IATELVDYLNASWTSFHATSESSRMLAAAGFERLSEKESWDLKPGGKYFFTRNMSSIVAF  71

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G+KY+ GNGF+II AHTDSPC KLKP SA  K G+L V VQTYGGGLWHTWFDRDL+V
Sbjct  72   AVGEKYAPGNGFNIIGAHTDSPCPKLKPVSAIKKGGFLSVGVQTYGGGLWHTWFDRDLSV  131

Query  635  AG  640
             G
Sbjct  132  GG  133



>gb|KHN31910.1| Aspartyl aminopeptidase [Glycine soja]
Length=413

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  D++D+LN S T FHA  EAKR+L +AG+H L+E E W L+PG +YFFTRN S++VAF
Sbjct  10   VASDMIDFLNASPTAFHAVDEAKRRLRSAGYHQLSEREPWKLQPGNKYFFTRNHSTIVAF  69

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHII AHTDSPC+KLKP +   K+G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKKYVSGNGFHIIGAHTDSPCLKLKPVTKVVKAGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  635  AG  640
            AG
Sbjct  130  AG  131



>ref|XP_002507546.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
 gb|ACO68804.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
Length=500

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 111/152 (73%), Gaps = 13/152 (9%)
 Frame = +2

Query  194  FSATPP---LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAG  364
            F+++P    L S+SS  VP A            +L++++N SWT +HATA   R+L AAG
Sbjct  5    FASSPANRDLLSTSSSRVPPA----------AQELVEFINNSWTSYHATATTARKLEAAG  54

Query  365  FHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRS  544
            F  LNE +EW+L PGG+YFFTRNMSS+VAFA+G KY  GNG HII AHTDSPC KLKP S
Sbjct  55   FVRLNERDEWNLIPGGKYFFTRNMSSIVAFAVGAKYVPGNGIHIIGAHTDSPCPKLKPVS  114

Query  545  ASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            +  KSG+L V VQTYGGGLWHTWFDRDL+VAG
Sbjct  115  SITKSGFLEVGVQTYGGGLWHTWFDRDLSVAG  146



>ref|XP_003523136.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  D++D+LN S T FHA  EAKR+L +AG+H L+E E W L+PG +YFFTRN S++VAF
Sbjct  10   VASDMIDFLNASPTAFHAVDEAKRRLRSAGYHQLSEREPWKLQPGNKYFFTRNHSTIVAF  69

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHII AHTDSPC+KLKP +   K+G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKKYVSGNGFHIIGAHTDSPCLKLKPVTKVVKAGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  635  AG  640
            AG
Sbjct  130  AG  131



>ref|XP_003526970.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAKR+L +AG+H L+E E W+L+PG +YFFTRN S++VAF
Sbjct  10   VASDLIDFLNASPTAFHAVDEAKRRLRSAGYHQLSEREVWELQPGNKYFFTRNHSTIVAF  69

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGF+II AHTDSPC+KLKP +   K+G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKKYVAGNGFYIIGAHTDSPCLKLKPVTKVVKAGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  635  AG  640
            AG
Sbjct  130  AG  131



>ref|XP_003578741.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=475

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  451
            +V DL+DYLN S T FHA  EAKR+L AAGF  L+E +EW  L+PG +YFFTRN S++VA
Sbjct  8    VVSDLIDYLNASPTAFHAVVEAKRKLKAAGFTQLSERDEWAGLEPGKKYFFTRNHSTIVA  67

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FAIG KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLT
Sbjct  68   FAIGAKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGYLEVGVQTYGGGLWYTWFDRDLT  127

Query  632  VAG  640
            +AG
Sbjct  128  IAG  130



>gb|KJB80475.1| hypothetical protein B456_013G099300 [Gossypium raimondii]
Length=156

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 111/148 (75%), Gaps = 11/148 (7%)
 Frame = +2

Query  89   APPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVssess  268
            A  L   S   SR PHS   FS    N R    R FS TPPL  SSS +   +     ++
Sbjct  7    AQLLHHPSAYFSRLPHSHSSFSI---NFRR---RKFSVTPPLLCSSSSSPSAS-----TN  55

Query  269  ssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLV  448
             SIVGDLL+YLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDL+PGGRYFFTRNMS LV
Sbjct  56   PSIVGDLLNYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLRPGGRYFFTRNMSCLV  115

Query  449  AFAIGKKYSIGNGFHIIAAHTDSPCMKL  532
            AFA+G+KY +GNGFH+IAAHTDSPC+KL
Sbjct  116  AFAVGEKYIVGNGFHVIAAHTDSPCLKL  143



>ref|XP_002949870.1| hypothetical protein VOLCADRAFT_104511 [Volvox carteri f. nagariensis]
 gb|EFJ48973.1| hypothetical protein VOLCADRAFT_104511 [Volvox carteri f. nagariensis]
Length=320

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +L+D+LN +WT FHA  EA++ L+AAGF  L E + WD+ PGGRYFFTRN +++VAFA+G
Sbjct  10   ELVDFLNAAWTPFHAVDEARKMLLAAGFKHLQEKDAWDINPGGRYFFTRNATTIVAFAVG  69

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KKY+ GNGF++I AHTDSPC+KLKP S S KS  LM+NV+TYGGGLW TWFDR+L VAG
Sbjct  70   KKYAPGNGFYMIGAHTDSPCLKLKPVSKSTKSDCLMLNVETYGGGLWSTWFDRELGVAG  128



>ref|XP_006664453.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=474

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  451
            +V DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VA
Sbjct  7    VVCDLVDFLNASPTAFHAVDEAKRRLKAAGFSQLSEREEWVGLEPGRKYFFTRNHSTIVA  66

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FAIG +Y  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT
Sbjct  67   FAIGAQYVAGNGFHIIGAHTDSPCLKLKPVSMVTKGGYLEVGVQTYGGGLWHTWFDRDLT  126

Query  632  VAG  640
            VAG
Sbjct  127  VAG  129



>ref|XP_010674696.1| PREDICTED: probable aspartyl aminopeptidase [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAKR+L  AGF  L+E E+W L+ G +YFFTRN S++VAF
Sbjct  10   VASDLIDFLNASPTAFHAVDEAKRRLKDAGFEQLSEREDWSLQAGKKYFFTRNYSTIVAF  69

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDL V
Sbjct  70   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLAV  129

Query  635  AG  640
            AG
Sbjct  130  AG  131



>ref|XP_004960722.1| PREDICTED: probable aspartyl aminopeptidase-like [Setaria italica]
Length=475

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  451
            +V DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VA
Sbjct  7    VVSDLVDFLNASPTAFHAVDEAKRRLKAAGFAQLSEREEWAGLEPGRKYFFTRNYSTIVA  66

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FAIG KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLT
Sbjct  67   FAIGAKYVAGNGFHIIGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLT  126

Query  632  VAG  640
            VAG
Sbjct  127  VAG  129



>ref|XP_002967289.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
 gb|EFJ31888.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
Length=519

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V +L+++LN S T FHAT EA+R L+ +GF  LNE EEW+L+PGGRYFFTRNMSS+ AF
Sbjct  52   VVPNLIEFLNNSTTPFHATLEARRHLLESGFQQLNECEEWELQPGGRYFFTRNMSSIFAF  111

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KY  G GFH++AAHTDSPC KLKP SA+ K G+L V VQ YG GLW+TWFDRDL+V
Sbjct  112  AIGRKYKPGGGFHVLAAHTDSPCPKLKPVSAATKGGFLRVRVQAYGTGLWNTWFDRDLSV  171

Query  635  AG  640
            AG
Sbjct  172  AG  173



>ref|XP_002960428.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
 gb|EFJ37967.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
Length=516

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V +L+++LN S T FHAT EA+R L+ +GF  LNE EEW+L+PGGRYFFTRNMSS+ AF
Sbjct  52   VVPNLIEFLNNSTTPFHATLEARRHLLESGFQQLNECEEWELQPGGRYFFTRNMSSIFAF  111

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KY  G GFH++AAHTDSPC KLKP SA+ K G+L V VQ YG GLW+TWFDRDL+V
Sbjct  112  AIGRKYKPGGGFHVLAAHTDSPCPKLKPVSAATKGGFLRVRVQAYGTGLWNTWFDRDLSV  171

Query  635  AG  640
            AG
Sbjct  172  AG  173



>ref|XP_006826611.1| hypothetical protein AMTR_s00138p00076250 [Amborella trichopoda]
 gb|ERM93848.1| hypothetical protein AMTR_s00138p00076250 [Amborella trichopoda]
Length=215

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            I  DL+D+LN S T FHA  EAK+ L   GF  L+E ++W L  GG+YFFTRN S++VAF
Sbjct  9    IASDLIDFLNASPTAFHAVDEAKKLLKEEGFQQLSERDDWSLSAGGKYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
             IG+ Y  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   VIGESYVAGNGFHIIGAHTDSPCLKLKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_008673044.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN26704.1| unknown [Zea mays]
 gb|ACN27911.1| unknown [Zea mays]
 tpg|DAA58398.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=475

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  451
            +V DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VA
Sbjct  7    VVSDLVDFLNASPTAFHAVDEAKRRLKAAGFVQLSEREEWAGLEPGRKYFFTRNHSTIVA  66

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FAIG KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLT
Sbjct  67   FAIGAKYVAGNGFHIIGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLT  126

Query  632  VAG  640
            VAG
Sbjct  127  VAG  129



>ref|XP_009379936.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            I  DL+D+LN S T FHA  EAK++L  AGF  L+E E+W L+PGG+YFFTRN S++V F
Sbjct  7    IALDLVDFLNASPTNFHAVDEAKKRLKQAGFVHLSEREDWVLEPGGKYFFTRNHSTVVTF  66

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHII AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  67   AIGKKYVAGNGFHIIGAHTDSPCLKVKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTL  126

Query  635  AG  640
            AG
Sbjct  127  AG  128



>ref|XP_002458215.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
 gb|EES03335.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
Length=475

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  451
            +V DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VA
Sbjct  7    VVSDLVDFLNVSPTAFHAVDEAKRRLKAAGFVQLSEREEWAGLEPGRKYFFTRNHSTIVA  66

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FAIG KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLT
Sbjct  67   FAIGAKYVAGNGFHIIGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLT  126

Query  632  VAG  640
            VAG
Sbjct  127  VAG  129



>ref|XP_004236341.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=482

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAK++L +AG+  ++E  +WDLK G +YFFTRN S++VAF
Sbjct  6    VASDLVDFLNASPTAFHAVDEAKKRLKSAGYVQIDEKLDWDLKAGNKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP +   KSG+L V VQTYGGGLWHTWFDRDLTV
Sbjct  66   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVTKVIKSGFLEVGVQTYGGGLWHTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>ref|XP_009624334.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=479

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAK++L +AG+  + E E+WDLK G +YFFTRN S++VAF
Sbjct  3    VAADLIDFLNASPTAFHAVEEAKKRLKSAGYVQIFEREDWDLKAGNKYFFTRNHSTIVAF  62

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGF+II AHTDSPC+KLKP S   KSG+L V VQTYGGGLWHTWFDRDLTV
Sbjct  63   ALGKKYVAGNGFYIIGAHTDSPCLKLKPVSKVTKSGFLEVGVQTYGGGLWHTWFDRDLTV  122

Query  635  AG  640
            AG
Sbjct  123  AG  124



>ref|XP_006476998.1| PREDICTED: probable aspartyl aminopeptidase-like [Citrus sinensis]
Length=483

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV D L +LN S T FHA  EAKR+L   G+  ++E E+W+L+ G RYFFTRN S+++AF
Sbjct  18   IVSDFLHFLNASPTAFHAVDEAKRRLQTVGYQQISEREDWELEAGKRYFFTRNHSTIIAF  77

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGFH++ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  78   AVGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  137

Query  635  AG  640
            AG
Sbjct  138  AG  139



>gb|KDO42027.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=496

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRNMS LVAF
Sbjct  60   IVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAF  119

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMV  574
            A+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSG ++V
Sbjct  120  AVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGRVIV  159



>ref|XP_007209960.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
 gb|EMJ11159.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
Length=488

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+++LN S T FHA  EAK++L  AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  13   VVSDLINFLNASPTAFHAVDEAKKRLQNAGYEPVSEREDWKLEAGKKYFFTRNYSTIVAF  72

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  73   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVVKGGYLEVGVQTYGGGLWHTWFDRDLTI  132

Query  635  AG  640
            AG
Sbjct  133  AG  134



>ref|XP_006436620.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49860.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=516

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRNMS LVAF
Sbjct  80   IVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAF  139

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMV  574
            A+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSG ++V
Sbjct  140  AVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGRVIV  179



>ref|XP_002950223.1| hypothetical protein VOLCADRAFT_104613 [Volvox carteri f. nagariensis]
 gb|EFJ48891.1| hypothetical protein VOLCADRAFT_104613 [Volvox carteri f. nagariensis]
Length=430

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  287  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGK  466
            LL ++N +WT FHA  EA R+L+AAGF  ++E E W ++PGGRYFFTRNMS++VAFA+G 
Sbjct  61   LLSFINYAWTTFHAVEEAARRLVAAGFTRISEREPWSVQPGGRYFFTRNMSTVVAFAVGT  120

Query  467  KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            K+  GNGF+++ AHTDSPC+KLKP +AS KSGY M+NV+TYGGGLW+TW+DRDL +AG
Sbjct  121  KFQPGNGFYMVGAHTDSPCLKLKPVTASNKSGYNMINVETYGGGLWYTWYDRDLGLAG  178



>ref|XP_009404266.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            I  DL+D+LN S T FHA  EAK++L  AGF  L+E E+W L+ GG+YFFTRN S+++AF
Sbjct  7    IALDLVDFLNASPTNFHAVDEAKKRLKQAGFAHLSEREDWVLESGGKYFFTRNHSTIIAF  66

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  67   AIGKKYVAGNGFHIVGAHTDSPCLKVKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTL  126

Query  635  AG  640
            AG
Sbjct  127  AG  128



>ref|XP_009346502.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+ +LN + T FHA  EAK++L +AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLIGFLNAAPTAFHAVDEAKKRLRSAGYEQVSEREDWKLEAGKKYFFTRNYSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWHTWFDRDLTI  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_006351481.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=483

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAK++L +AG+  ++E ++W LK G +YFFTRN S++VAF
Sbjct  6    VAADLVDFLNASPTAFHAVDEAKKRLKSAGYVQIDEKQDWVLKAGNKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   KSG+L V VQTYGGGLWHTWFDRDLTV
Sbjct  66   AIGKKYVGGNGFHIVGAHTDSPCLKLKPVSKVIKSGFLEVGVQTYGGGLWHTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>ref|XP_006440072.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
 gb|ESR53312.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
Length=515

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV D L +LN S T FHA  EAKR+L   G+  ++E E+W+L+ G RYFFTRN S+++AF
Sbjct  50   IVSDFLHFLNASPTAFHAVDEAKRRLQTVGYQQISEREDWELEVGKRYFFTRNHSTIIAF  109

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGFH++ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  110  AVGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  169

Query  635  AG  640
            AG
Sbjct  170  AG  171



>ref|XP_009790447.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=479

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAK++L +AG+  + E E+WDLK G +YFFTRN S++VAF
Sbjct  3    VAADLIDFLNASPTAFHAVEEAKKRLKSAGYVQIFEREDWDLKAGNKYFFTRNHSTIVAF  62

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGF+II AHTDSPC+KLKP S   K+G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  63   ALGKKYVAGNGFYIIGAHTDSPCLKLKPVSKVTKNGFLEVGVQTYGGGLWHTWFDRDLTV  122

Query  635  AG  640
            AG
Sbjct  123  AG  124



>ref|XP_008807556.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807557.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
Length=487

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAKR+L  AGF  ++E E+W L  G +YFFTRN S+++AF
Sbjct  7    VASDLVDFLNASPTAFHAVDEAKRRLKQAGFKQISEREDWVLDSGKKYFFTRNYSTIIAF  66

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  67   AIGKKYVAGNGFHIVGAHTDSPCLKVKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTL  126

Query  635  AG  640
            AG
Sbjct  127  AG  128



>ref|XP_008807558.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Phoenix 
dactylifera]
Length=476

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAKR+L  AGF  ++E E+W L  G +YFFTRN S+++AF
Sbjct  7    VASDLVDFLNASPTAFHAVDEAKRRLKQAGFKQISEREDWVLDSGKKYFFTRNYSTIIAF  66

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  67   AIGKKYVAGNGFHIVGAHTDSPCLKVKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTL  126

Query  635  AG  640
            AG
Sbjct  127  AG  128



>ref|XP_010248918.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=490

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+++LN S T FHA  EAK++L  AGF  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  12   VVSDLINFLNASPTAFHAVDEAKKRLKNAGFEQISEREDWELQVGKKYFFTRNHSTIVAF  71

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G+KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLTV
Sbjct  72   AVGRKYVAGNGFHIIGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWNTWFDRDLTV  131

Query  635  AG  640
            AG
Sbjct  132  AG  133



>ref|XP_004138058.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=485

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  EAK++LI+ G+  ++E  +W L+ G +YFFTRN S++VAF
Sbjct  14   VVTDFLQFLNASPTAFHAVEEAKKRLISVGYEQVSEKADWKLEAGKKYFFTRNHSTIVAF  73

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  74   AIGKKYVAGNGFHIIGAHTDSPCVKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTI  133

Query  635  AG  640
            AG
Sbjct  134  AG  135



>ref|XP_007137936.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
 gb|ESW09930.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
Length=481

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+D+LN S T FHA   AK++L +AGF  L+E E W+L+PG +YFFTRN S++VAF
Sbjct  9    VVSDLIDFLNASPTAFHAVDVAKQRLQSAGFQQLSERELWELQPGNKYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGF+II AHTDSPC+KLKP S   K G L V VQ YGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFYIIGAHTDSPCLKLKPVSKVVKGGILEVGVQIYGGGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_004165826.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartyl aminopeptidase-like 
[Cucumis sativus]
Length=485

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  EAK++LI+ G+  ++E  +W L+ G +YFFTRN S++VAF
Sbjct  14   VVTDFLQFLNASPTAFHAVEEAKKRLISVGYEQVSEKADWKLEAGKKYFFTRNHSTIVAF  73

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  74   AIGKKYVAGNGFHIIGAHTDSPCVKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTI  133

Query  635  AG  640
            AG
Sbjct  134  AG  135



>gb|ABR17053.1| unknown [Picea sitchensis]
Length=502

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  + +D+LN S T FHA  EAKRQL  AG+  ++E E+W L+PGG+YFFTRN S++VAF
Sbjct  12   VAAEFIDFLNASPTAFHAVGEAKRQLKQAGYEQISEREDWTLEPGGKYFFTRNHSTIVAF  71

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY+ GNGF I+ AHTDSPC+KLKP S   K G+L + VQ YGGGLWHTWFDRDLTV
Sbjct  72   AIGHKYTAGNGFGIVCAHTDSPCLKLKPSSKVTKGGFLEIGVQPYGGGLWHTWFDRDLTV  131

Query  635  AG  640
            AG
Sbjct  132  AG  133



>ref|XP_010248919.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Nelumbo 
nucifera]
Length=481

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+++LN S T FHA  EAK++L  AGF  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  12   VVSDLINFLNASPTAFHAVDEAKKRLKNAGFEQISEREDWELQVGKKYFFTRNHSTIVAF  71

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+G+KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLTV
Sbjct  72   AVGRKYVAGNGFHIIGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWNTWFDRDLTV  131

Query  635  AG  640
            AG
Sbjct  132  AG  133



>ref|XP_003602076.1| Aspartyl aminopeptidase [Medicago truncatula]
 gb|AES72327.1| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=482

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+++LN S T FHA  +AK++L +AG+H ++E E W+LK G +YFFTRN S++VAF
Sbjct  10   VVSDLINFLNASPTAFHAVDDAKKRLQSAGYHQISEKETWELKAGHKYFFTRNHSTIVAF  69

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGK++  GNGFHI+ AHTDSPC+KLKP S   K G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKRFVGGNGFHIVGAHTDSPCLKLKPVSKVVKGGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  635  AG  640
            AG
Sbjct  130  AG  131



>emb|CDP05422.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAKR+L +AG+  + E E+W L+ G +Y+FTRN S++VAF
Sbjct  5    VAADLVDFLNASPTAFHAVEEAKRRLKSAGYEQILEREDWKLEAGKKYYFTRNYSTIVAF  64

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGF I+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  65   AIGKKYVAGNGFQIVGAHTDSPCLKLKPVSKVSKGGYLEVGVQTYGGGLWHTWFDRDLTV  124

Query  635  AG  640
            AG
Sbjct  125  AG  126



>gb|KFK26680.1| hypothetical protein AALP_AA8G278900 [Arabis alpina]
Length=477

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            ++ D L +LN S T FHA  E+KR+L  AG+  L+E ++W L+ G +YFFTRN S++VAF
Sbjct  6    VISDFLSFLNASPTAFHAVDESKRRLRKAGYEQLSEKDDWKLEAGNKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHII AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  66   AIGKKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGFLEVGVQTYGGGLWHTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>gb|KGN63496.1| hypothetical protein Csa_1G002160 [Cucumis sativus]
Length=512

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  EAK++LI+ G+  ++E  +W L+ G +YFFTRN S++VAF
Sbjct  41   VVTDFLQFLNASPTAFHAVEEAKKRLISVGYEQVSEKADWKLEAGKKYFFTRNHSTIVAF  100

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  101  AIGKKYVAGNGFHIIGAHTDSPCVKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTI  160

Query  635  AG  640
            AG
Sbjct  161  AG  162



>ref|XP_008374264.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+ +LN + T FHA  EAK++L +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLIGFLNAAPTAFHAVDEAKKRLRSAGYEQVLEREDWKLEAGKKYFFTRNYSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWHTWFDRDLTI  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_009336570.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+ +LN + T FHA  EAK++L +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLIGFLNAAPTAFHAVDEAKKRLRSAGYEQVLEREDWKLEAGKKYFFTRNYSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWHTWFDRDLTI  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|NP_001066463.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|ABA96906.1| Aspartyl aminopeptidase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29482.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|EAY82691.1| hypothetical protein OsI_37907 [Oryza sativa Indica Group]
 gb|EAZ20072.1| hypothetical protein OsJ_35672 [Oryza sativa Japonica Group]
Length=478

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVAFAI  460
            DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VAFAI
Sbjct  14   DLVDFLNASPTAFHAVDEAKRRLKAAGFSQLSEREEWAGLQPGRKYFFTRNHSTIVAFAI  73

Query  461  GKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            G KY+ GNGFHII AHTDSP +KLKP S   K GYL V VQTYGGGLW+TWFDRDLTVAG
Sbjct  74   GAKYAAGNGFHIIGAHTDSPSLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLTVAG  133



>gb|AFK46082.1| unknown [Lotus japonicus]
Length=479

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV D +D+LN S T FHA  EAK++L   G+  L+E E W+LKPG +YFFTRN S++VAF
Sbjct  9    IVSDFIDFLNASPTAFHAVDEAKKRLRNTGYEHLSEKEVWELKPGSKYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGK+Y  GNGFH+I AHTDSPC+KLKP S   K   L V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKRYVAGNGFHLIGAHTDSPCLKLKPVSKVVKGEILEVGVQTYGGGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_009359462.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+ +LN + T FHA  EAK+QL +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLISFLNAAPTAFHAVDEAKKQLRSAGYVQVLEREDWRLEAGKKYFFTRNYSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGFLEVGVQTYGGGLWHTWFDRDLTI  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_005648131.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
 gb|EIE23587.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
Length=482

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  451
            I   LLDY+N SWT +HA  EA R+L AAGF  L+E + W  LK GGRY+FTRN S++VA
Sbjct  13   IAKALLDYINASWTPYHAVEEASRRLHAAGFEKLSERQPWHGLKKGGRYYFTRNASTIVA  72

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FA+G KY  GNGFH++ AHTDSPC+KLKP S   K+G+L VNV+ YGGGLWHTWFDRDL+
Sbjct  73   FAVGGKYEAGNGFHMVGAHTDSPCLKLKPHSKGVKAGFLTVNVEPYGGGLWHTWFDRDLS  132

Query  632  VAG  640
            VAG
Sbjct  133  VAG  135



>ref|XP_008239439.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=490

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+++LN S T FHA   AK++L  AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  13   VVSDLINFLNASPTAFHAVDGAKKRLQNAGYEPVSEREDWKLEAGKKYFFTRNYSTIVAF  72

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  73   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSMVAKGGYLEVGVQTYGGGLWHTWFDRDLTI  132

Query  635  AG  640
            AG
Sbjct  133  AG  134



>ref|XP_010536640.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=489

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV D L +LN S T FHA  EAKR+L  AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  13   IVSDFLSFLNASPTAFHAVDEAKRRLQKAGYEQVSERDDWKLEAGKKYFFTRNFSTVVAF  72

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  G+GFHI+ AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  73   AIGKKYVAGSGFHIVGAHTDSPCLKLKPVSKVVKGGFLEVGVQTYGGGLWHTWFDRDLTV  132

Query  635  AG  640
            AG
Sbjct  133  AG  134



>ref|XP_007037930.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
 gb|EOY22431.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
Length=520

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+++LN S T FHA AEA+++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  56   VVSDLINFLNASPTAFHAVAEARKRLEEVGYEQVFEREDWKLEVGKRYFFTRNHSTIVAF  115

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYG GLWHTWFDRDLTV
Sbjct  116  AIGKKYVAGNGFHIVGAHTDSPCLKLKPISKVTKGGYLEVGVQTYGSGLWHTWFDRDLTV  175

Query  635  AG  640
            AG
Sbjct  176  AG  177



>gb|EPS62030.1| aspartyl aminopeptidase-like protein, partial [Genlisea aurea]
Length=475

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            DL+++LN S T FHA  E+K++L+++G+  L+E E+W L+ GG+YFFTRN S++VAFAIG
Sbjct  6    DLVEFLNASPTAFHAVDESKKRLVSSGYTYLSEREDWKLEAGGKYFFTRNHSTIVAFAIG  65

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KKY  GNG +II AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDL+VAG
Sbjct  66   KKYVAGNGIYIIGAHTDSPCLKLKPVSKLSKGGYLEVGVQTYGGGLWHTWFDRDLSVAG  124



>ref|XP_002321687.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEF05814.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAKR+L  AG+  ++E  +W L+ G RYFFTRN S+++AF
Sbjct  12   VASDLIDFLNASPTAFHAVEEAKRRLKNAGYEQVSERHDWKLEAGKRYFFTRNHSTILAF  71

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGF+I+ AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  72   AIGKKYVAGNGFYIVGAHTDSPCLKLKPVSKVTKGGFLEVGVQTYGGGLWHTWFDRDLTV  131

Query  635  AG  640
            AG
Sbjct  132  AG  133



>ref|XP_011024060.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=489

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+D+LN S T FHA  EAKR+L  AG+  ++E  +W L+ G RYFFTRN S+++AF
Sbjct  12   VASDLIDFLNASPTAFHAVEEAKRRLKNAGYEQVSERHDWKLEAGKRYFFTRNHSTILAF  71

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGF+I+ AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  72   AIGKKYVAGNGFYIVGAHTDSPCLKLKPVSKVTKGGFLEVGVQTYGGGLWHTWFDRDLTV  131

Query  635  AG  640
            AG
Sbjct  132  AG  133



>ref|XP_010930126.1| PREDICTED: probable aspartyl aminopeptidase [Elaeis guineensis]
Length=476

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            DL+D+LN S T FHA  EAK++L  A F+ ++E E+W L+ G +YFFTRN S++VAFAIG
Sbjct  10   DLVDFLNASPTAFHAVDEAKKRLKQARFNQISEREDWVLESGKKYFFTRNYSTIVAFAIG  69

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KKY  GNGFHII AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+AG
Sbjct  70   KKYVAGNGFHIIGAHTDSPCLKVKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTLAG  128



>ref|XP_002866374.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42633.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+KRQL+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKRQLVKAGYEQISERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGQKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGCLEVGVQTYGGGLWYTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>ref|XP_004500663.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=482

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+++LN S T FHA  +AK++L  AG+  L+E E+W+LK G +YFFTRN S++VAF
Sbjct  10   VVSDLINFLNASPTAFHAVDDAKKRLQTAGYQQLSEKEDWELKAGHKYFFTRNYSTIVAF  69

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GK++  GNGF+I+ AHTDSPC+KLKP S   K G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AVGKRFVAGNGFYIVGAHTDSPCLKLKPVSKVVKGGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  635  AG  640
            AG
Sbjct  130  AG  131



>ref|XP_001784619.1| predicted protein [Physcomitrella patens]
 gb|EDQ50551.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +2

Query  242  EAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYF  421
            +  V  ES SS+V  LLDY+N S T FHATAE +  L+++GF  ++E EEW ++PGGRYF
Sbjct  8    QGLVCRESQSSVVPHLLDYVNNSCTPFHATAETRNHLLSSGFQEISECEEWAVQPGGRYF  67

Query  422  FTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGL  601
            FTRNM S+ AFA+G KY  GNGFH++AAHTDSPC KLKP S S K G+L V VQ YG G+
Sbjct  68   FTRNMCSIYAFAVGHKYKPGNGFHVVAAHTDSPCPKLKPVSYSAKGGFLHVRVQPYGAGV  127

Query  602  WHTWFDRDLTVAG  640
            W TWFDRDL++AG
Sbjct  128  WQTWFDRDLSIAG  140



>ref|XP_001690598.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
 gb|EDP05857.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
Length=565

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 121/181 (67%), Gaps = 14/181 (8%)
 Frame = +2

Query  134  HSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVP---EAFVssessssIVGDLLDYLN  304
            H LR  +A +  + T   R  ++TP   + +++AVP   +A             LLD++N
Sbjct  14   HPLRRLAAPHLIMSTK--RQKTSTPTADNVATEAVPSNADALALHARGKEHAQKLLDFIN  71

Query  305  ESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGN  484
             SWT FHA  EA R+L+AAGF  ++E E W ++PGGRYFFTRN+S++VAFA+G+++  GN
Sbjct  72   YSWTPFHAVEEASRRLVAAGFTPISEREPWSVQPGGRYFFTRNLSTIVAFAVGQQFKPGN  131

Query  485  GFHIIAAHTDSPCMKLKPRSASCKSGYLM---------VNVQTYGGGLWHTWFDRDLTVA  637
            GF ++ AHTDSPC+KLKP S S KSGY M         +NV+TYGGGLW+TW+DRDL +A
Sbjct  132  GFFMVGAHTDSPCLKLKPVSLSNKSGYNMARPGRRAGGINVETYGGGLWYTWYDRDLGLA  191

Query  638  G  640
            G
Sbjct  192  G  192



>ref|XP_006280394.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
 gb|EOA13292.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
Length=478

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+K++L+ AG+  + E ++W L+ G +YFFTRN S++VAF
Sbjct  7    LVSDFLSFLNASPTAFHAVDESKKRLVEAGYEQVFERDDWKLQAGQKYFFTRNYSTIVAF  66

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG+KY  GNGFHII AHTDSPC+KLKP S   K+GYL V VQTYGGGLW+TWFDRDLTV
Sbjct  67   AIGQKYVAGNGFHIIGAHTDSPCLKLKPVSKISKAGYLEVGVQTYGGGLWYTWFDRDLTV  126

Query  635  AG  640
            AG
Sbjct  127  AG  128



>ref|XP_002318119.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEE96339.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=486

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  +L+++LN S T FHA  EAKR+L  AG+  ++E ++WDL+ G RYFFTRN S++VAF
Sbjct  9    VASELINFLNASPTAFHAVEEAKRRLRNAGYEQVSERQDWDLEAGKRYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG K+  GNGF+I+ AHTDSPC+KLKP S   K GYL V VQTYG GLWHTWFDRDLTV
Sbjct  69   AIGNKFEAGNGFYIVGAHTDSPCLKLKPVSKVTKGGYLKVGVQTYGSGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_008464465.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Cucumis 
melo]
Length=481

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D +D+LN S T FHA  EAK++L++ G+  L+E E+W L+ G +YFFTRN S+++AF
Sbjct  11   VVSDFIDFLNASPTAFHAVEEAKKRLVSVGYEQLSETEDWKLEAGKKYFFTRNHSAIIAF  70

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKK+  GN FHI+ AHTDSPC+KLKP S   K G+L V VQ YGGGLWHTWFDRDLT+
Sbjct  71   AVGKKFVAGNAFHIVGAHTDSPCLKLKPISKITKGGFLEVGVQIYGGGLWHTWFDRDLTL  130

Query  635  AG  640
            AG
Sbjct  131  AG  132



>ref|XP_008464464.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Cucumis 
melo]
Length=482

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D +D+LN S T FHA  EAK++L++ G+  L+E E+W L+ G +YFFTRN S+++AF
Sbjct  11   VVSDFIDFLNASPTAFHAVEEAKKRLVSVGYEQLSETEDWKLEAGKKYFFTRNHSAIIAF  70

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKK+  GN FHI+ AHTDSPC+KLKP S   K G+L V VQ YGGGLWHTWFDRDLT+
Sbjct  71   AVGKKFVAGNAFHIVGAHTDSPCLKLKPISKITKGGFLEVGVQIYGGGLWHTWFDRDLTL  130

Query  635  AG  640
            AG
Sbjct  131  AG  132



>ref|XP_010443807.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+K++L+ AG+  ++E ++W+L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKKRLVKAGYEQVSERDDWELEAGKKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G+L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGFLEVGVQTYGGGLWYTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>gb|KHF99832.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=463

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D + +LN S T FHA  EAK++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  9    VVSDFIGFLNASPTAFHAVDEAKKRLQKVGYEQVIEREDWKLEAGKRYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFH++ AHTDSPC+KLKP S   K+ YL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVKKADYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>gb|KJB27157.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=464

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D + +LN S T FHA  EAK++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  9    VVSDFIGFLNASPTAFHAVDEAKKRLQKVGYEQVIEREDWKLEAGKRYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFH++ AHTDSPC+KLKP S   K+ YL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVKKADYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_004165827.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
 gb|KGN63497.1| hypothetical protein Csa_1G002660 [Cucumis sativus]
Length=481

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D +D+LN S T FHA  EAK++L++ G+  L+E E+W L+ G +YFFTRN S+++AF
Sbjct  11   VVSDFIDFLNASPTAFHAVEEAKKRLVSVGYEQLSETEDWKLEAGKKYFFTRNHSAILAF  70

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKK+  GN FHI+ AHTDSPC+KLKP S   K G+L V VQ YGGGLWHTWFDRDLT+
Sbjct  71   AIGKKFVAGNAFHIVGAHTDSPCLKLKPISKITKGGFLEVGVQIYGGGLWHTWFDRDLTL  130

Query  635  AG  640
            AG
Sbjct  131  AG  132



>gb|KJB27155.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=463

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D + +LN S T FHA  EAK++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  9    VVSDFIGFLNASPTAFHAVDEAKKRLQKVGYEQVIEREDWKLEAGKRYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFH++ AHTDSPC+KLKP S   K+ YL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVKKADYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>gb|KJB27156.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=461

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D + +LN S T FHA  EAK++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  9    VVSDFIGFLNASPTAFHAVDEAKKRLQKVGYEQVIEREDWKLEAGKRYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFH++ AHTDSPC+KLKP S   K+ YL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVKKADYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_004138060.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=481

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D +D+LN S T FHA  EAK++L++ G+  L+E E+W L+ G +YFFTRN S+++AF
Sbjct  11   VVSDFIDFLNASPTAFHAVEEAKKRLVSVGYEQLSETEDWKLEAGKKYFFTRNHSAILAF  70

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKK+  GN FHI+ AHTDSPC+KLKP S   K G+L V VQ YGGGLWHTWFDRDLT+
Sbjct  71   AIGKKFVAGNAFHIVGAHTDSPCLKLKPISKITKGGFLEVGVQIYGGGLWHTWFDRDLTL  130

Query  635  AG  640
            AG
Sbjct  131  AG  132



>ref|XP_002283475.1| PREDICTED: probable aspartyl aminopeptidase [Vitis vinifera]
 emb|CBI15632.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+++LN S T FHA  EAK+ L  +GF  ++E + W+L+ G RYFFTRN S++VAF
Sbjct  13   VVSDLINFLNSSPTAFHAVDEAKKLLKESGFVQVSERDNWNLEAGKRYFFTRNYSTIVAF  72

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGF I+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  73   AIGKKYVPGNGFCIVGAHTDSPCLKLKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  132

Query  635  AG  640
            AG
Sbjct  133  AG  134



>ref|XP_001773362.1| predicted protein [Physcomitrella patens]
 gb|EDQ61735.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            I+  LL+Y++ S T FHATAEA++ L+ AGF  ++E EEW L+PGGRYFFTRNM S+ AF
Sbjct  9    IIPHLLEYVDNSCTPFHATAEARKFLLTAGFQEISECEEWALQPGGRYFFTRNMCSIYAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY  G+GFH+IAAHTDSPC KLKP S S K G++ V VQ YG G+W TWFDRDL+V
Sbjct  69   AIGHKYKPGSGFHVIAAHTDSPCPKLKPVSYSAKGGFVHVRVQPYGAGVWQTWFDRDLSV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_009134060.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=478

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+KR+L  AG+  L+E ++W L+ G +YFFTRN S++VAF
Sbjct  7    LVSDFLSFLNASPTAFHAVDESKRRLRHAGYEQLSERDDWKLEAGKKYFFTRNYSTIVAF  66

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  67   AVGKKYEAGNGFHIIGAHTDSPCLKLKPVSKVTKGGCLEVGVQTYGGGLWYTWFDRDLTV  126

Query  635  AG  640
            AG
Sbjct  127  AG  128



>ref|XP_008367478.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+ +LN + T FHA  EAK+ L +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLISFLNAAPTAFHAVDEAKKLLRSAGYEQVLEREDWKLEAGKKYFFTRNYSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K G+L V VQTYG GLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGFLEVGVQTYGSGLWHTWFDRDLTI  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>emb|CDX83160.1| BnaA03g23460D [Brassica napus]
Length=478

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+KR+L  AG+  L+E ++W L+ G +YFFTRN S++VAF
Sbjct  7    LVSDFLSFLNASPTAFHAVDESKRRLRHAGYEQLSERDDWKLEAGKKYFFTRNYSTIVAF  66

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  67   AVGKKYEAGNGFHIIGAHTDSPCLKLKPVSKVTKGGCLEVGVQTYGGGLWYTWFDRDLTV  126

Query  635  AG  640
            AG
Sbjct  127  AG  128



>ref|XP_010483659.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+K++L+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKKRLVKAGYEQVSERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G+L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGFLEVGVQTYGGGLWYTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>ref|XP_010456062.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=475

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+K++L+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKKRLVKAGYEQVSERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G+L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGFLEVGVQTYGGGLWYTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>emb|CDY34036.1| BnaC03g27790D [Brassica napus]
Length=478

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+KR+L  AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  7    LVSDFLSFLNASPTAFHAVDESKRRLRHAGYEQISERDDWKLEAGKKYFFTRNYSTIVAF  66

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  67   AVGKKYEAGNGFHIIGAHTDSPCLKLKPVSKVTKGGCLEVGVQTYGGGLWYTWFDRDLTV  126

Query  635  AG  640
            AG
Sbjct  127  AG  128



>ref|XP_011044185.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=486

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  +L+++LN S T FHA  EAK++L  AG+  ++E ++WDL+ G RYFFTRN S++VAF
Sbjct  9    VASELINFLNASPTAFHAVEEAKKRLRNAGYEQVSERQDWDLEAGKRYFFTRNHSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG K+  GNGF+I+ AHTDSPC+KLKP S   K GYL V VQTYG GLWHTWFDRDLTV
Sbjct  69   AIGNKFEAGNGFYIVGAHTDSPCLKLKPVSKVTKGGYLKVGVQTYGSGLWHTWFDRDLTV  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>gb|KCW83185.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=407

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D + +LN S T FHA  E+KR L  AG+  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  8    VVPDFVAFLNASPTAFHAVDESKRLLREAGYKQVSEREDWNLEAGKKYFFTRNHSTIVAF  67

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGFHI+ AHTDSPC+KLKP +   K G L V VQTYGGGLWHTWFDRDLT+
Sbjct  68   AVGKKYVAGNGFHIVGAHTDSPCLKLKPVTMVSKGGCLQVGVQTYGGGLWHTWFDRDLTI  127

Query  635  AG  640
            AG
Sbjct  128  AG  129



>gb|EMS55846.1| Aspartyl aminopeptidase [Triticum urartu]
Length=618

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATA-EAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLV  448
            +V DL+D+LN S T FHA   EAKR L AAGF  L+E EEW  L+PG +YFFTRN S++V
Sbjct  4    VVSDLVDFLNASPTAFHAVEDEAKRLLKAAGFEQLSEREEWTGLQPGRKYFFTRNHSAIV  63

Query  449  AFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  628
            AFAIG KY  GNGFHII AHTDSPC+KLKP +   K GYL V VQTYGGGLW+TWFDRDL
Sbjct  64   AFAIGAKYVAGNGFHIIGAHTDSPCLKLKPVTKITKGGYLEVGVQTYGGGLWYTWFDRDL  123

Query  629  TVAG  640
            T+AG
Sbjct  124  TIAG  127



>ref|NP_200824.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 dbj|BAA97497.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AAK73942.1| AT5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AAM91365.1| At5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AED97287.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=477

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+KR+L+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKRRLLKAGYEQISERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGCLEVGVQTYGGGLWYTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>gb|AAM61631.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
Length=477

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA  E+KR+L+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKRRLLKAGYEQISERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGCLEVGVQTYGGGLWYTWFDRDLTV  125

Query  635  AG  640
            AG
Sbjct  126  AG  127



>gb|KIY94035.1| Aminopeptidase I zinc metalloprotease [Monoraphidium neglectum]
Length=436

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            D+L+++N +WT +HA  E+ ++L AAGF  + E + WDL+PGG+Y+FTRNMS++VAFA+G
Sbjct  15   DMLEFINAAWTPYHAVEESAKRLAAAGFQHIAEKDAWDLQPGGKYYFTRNMSTIVAFAVG  74

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KKYS GN F++I AHTDSPC+K+KP S +   G  ++NV+TYGGGLW+TWFDRDL VAG
Sbjct  75   KKYSPGNPFYMIGAHTDSPCLKVKPVSKATGGGCQLINVETYGGGLWYTWFDRDLGVAG  133



>ref|XP_002977420.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
 gb|EFJ21424.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
Length=445

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  335  EAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTD  514
            EAK+ L+ AGF  LNE +EW ++PGGRYFFTRNMS+LVAFAIG+KY  GNGFH++AAHTD
Sbjct  2    EAKKLLLDAGFLQLNEEDEWSIEPGGRYFFTRNMSTLVAFAIGQKYQTGNGFHVVAAHTD  61

Query  515  SPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            SPC KLKP SA  KSG+L + VQTYGGGLWHTWFDRDL+VAG
Sbjct  62   SPCPKLKPVSALSKSGFLNLGVQTYGGGLWHTWFDRDLSVAG  103



>gb|KDP30945.1| hypothetical protein JCGZ_11321 [Jatropha curcas]
Length=483

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  DL+ +LN S T FHA  EAK++L  AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  10   VASDLIHFLNASPTAFHAVDEAKKRLRNAGYVQVSEREDWKLEAGKKYFFTRNHSTIVAF  69

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGK+Y  GNGF++I AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKRYVAGNGFYVIGAHTDSPCIKLKPVSKVKKGGYLGVGVQTYGGGLWHTWFDRDLTV  129

Query  635  AG  640
            AG
Sbjct  130  AG  131



>ref|XP_011396821.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
 gb|KFM23943.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
Length=469

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWD-LKPGGRYFFTRNMSSLVA  451
            +  DLL+Y+N+S TQFHA  +AK +L AAG+  L+E + WD L+PGGRY+FTRN S+LVA
Sbjct  12   LADDLLEYINDSDTQFHAVEQAKARLDAAGYMRLSERQSWDGLRPGGRYYFTRNDSTLVA  71

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FA+G +Y  GNGF+I+ AHTDSPC KLKP S   KSGY MVNV+ YGG L HTWFDRDL+
Sbjct  72   FAVGARYEPGNGFYILGAHTDSPCFKLKPVSKCTKSGYAMVNVEPYGGLLQHTWFDRDLS  131

Query  632  VAG  640
            VAG
Sbjct  132  VAG  134



>ref|XP_010026684.1| PREDICTED: probable aspartyl aminopeptidase [Eucalyptus grandis]
 gb|KCW83183.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=473

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D + +LN S T FHA  E+KR L  AG+  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  8    VVPDFVAFLNASPTAFHAVDESKRLLREAGYKQVSEREDWNLEAGKKYFFTRNHSTIVAF  67

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGFHI+ AHTDSPC+KLKP +   K G L V VQTYGGGLWHTWFDRDLT+
Sbjct  68   AVGKKYVAGNGFHIVGAHTDSPCLKLKPVTMVSKGGCLQVGVQTYGGGLWHTWFDRDLTI  127

Query  635  AG  640
            AG
Sbjct  128  AG  129



>gb|KCW83184.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=508

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D + +LN S T FHA  E+KR L  AG+  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  8    VVPDFVAFLNASPTAFHAVDESKRLLREAGYKQVSEREDWNLEAGKKYFFTRNHSTIVAF  67

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            A+GKKY  GNGFHI+ AHTDSPC+KLKP +   K G L V VQTYGGGLWHTWFDRDLT+
Sbjct  68   AVGKKYVAGNGFHIVGAHTDSPCLKLKPVTMVSKGGCLQVGVQTYGGGLWHTWFDRDLTI  127

Query  635  AG  640
            AG
Sbjct  128  AG  129



>gb|EMT03759.1| Aspartyl aminopeptidase [Aegilops tauschii]
Length=893

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATA-EAKRQLIAAGFHLLNENEEWD-LKPGGRYFFTRNMSSLV  448
            +V DL+D+LN S T FHA   EAKR L AAGF  L+E EEW  L+PG +YFFTRN S++V
Sbjct  4    VVSDLVDFLNASPTAFHAVEDEAKRLLKAAGFEQLSEREEWSGLQPGRKYFFTRNHSAIV  63

Query  449  AFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  628
            AFAIG KY  GNGFHII AHTDSPC+KLKP +   K GYL V VQTYGGGLW+TWFDRDL
Sbjct  64   AFAIGAKYVAGNGFHIIGAHTDSPCLKLKPVTKITKGGYLEVGVQTYGGGLWYTWFDRDL  123

Query  629  TVAG  640
            T+AG
Sbjct  124  TIAG  127



>ref|XP_011083884.1| PREDICTED: probable aspartyl aminopeptidase [Sesamum indicum]
Length=480

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            DL+++LN S T FHA  EAK++L +AG+  ++E E+W L+ G +YFFTRN S++VAF IG
Sbjct  8    DLVEFLNASPTAFHAVDEAKKRLRSAGYEQVSEREDWKLEAGKKYFFTRNHSTIVAFGIG  67

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KKY  GNG +I+ AHTDSPC+KLKP +   K GYL V VQTYGGGLWHTWFDRDL +AG
Sbjct  68   KKYVAGNGIYIVGAHTDSPCLKLKPVTKVSKGGYLEVGVQTYGGGLWHTWFDRDLAIAG  126



>ref|XP_002511215.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF51817.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=441

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            I  DL+++LN S T FHA  EAK++L  +G+  ++E ++W L+ G RYFFTRN S++VAF
Sbjct  13   IDSDLINFLNASPTAFHAIDEAKKRLKHSGYVQVSERDDWKLELGKRYFFTRNHSTIVAF  72

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGF+++ AHTDSPC+KLKP S   KSGYL V VQ YGGGLWHTWFDRDL V
Sbjct  73   AIGKKYVAGNGFYVVGAHTDSPCIKLKPVSKVTKSGYLEVGVQPYGGGLWHTWFDRDLAV  132

Query  635  AG  640
            AG
Sbjct  133  AG  134



>gb|KCW51475.1| hypothetical protein EUGRSUZ_J00996 [Eucalyptus grandis]
Length=136

 Score =   160 bits (405),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 86/103 (83%), Gaps = 1/103 (1%)
 Frame = +2

Query  332  AEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHT  511
            AEAKRQLI A F+ LNEN+EW+L+PGG YF TRNMSSL+A A+ ++Y +G+GFH+IAA  
Sbjct  9    AEAKRQLIDAEFYFLNENDEWNLRPGGHYF-TRNMSSLIALAVEERYDVGSGFHVIAAQA  67

Query  512  DSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            DSPC+KLKP+SAS K  Y+ VNVQTYGG LWHTWFDRD +V G
Sbjct  68   DSPCLKLKPKSASTKFNYVTVNVQTYGGDLWHTWFDRDRSVGG  110



>ref|XP_005849269.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
 gb|EFN57167.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
Length=497

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWD-LKPGGRYFFTRNMSSLVA  451
            I  D+LD+LN   T+FHA   A ++L  AGF  L+E +EWD L PGGRYFFTRN S+LVA
Sbjct  11   IAADMLDFLNVGVTEFHAVDAAVQRLKKAGFTELSERQEWDGLGPGGRYFFTRNASTLVA  70

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FA+G+KY  GNGF ++ AHTDSPC KLKP S S KSGY MVNV+ YGG L HTWFDRDLT
Sbjct  71   FAVGQKYEPGNGFMMVGAHTDSPCFKLKPVSKSIKSGYGMVNVEPYGGLLHHTWFDRDLT  130

Query  632  VAG  640
            VAG
Sbjct  131  VAG  133



>sp|B9RAJ0.2|DNPEP_RICCO RecName: Full=Probable aspartyl aminopeptidase [Ricinus communis]
Length=491

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            I  DL+++LN S T FHA  EAK++L  +G+  ++E ++W L+ G RYFFTRN S++VAF
Sbjct  13   IDSDLINFLNASPTAFHAIDEAKKRLKHSGYVQVSERDDWKLELGKRYFFTRNHSTIVAF  72

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGF+++ AHTDSPC+KLKP S   KSGYL V VQ YGGGLWHTWFDRDL V
Sbjct  73   AIGKKYVAGNGFYVVGAHTDSPCIKLKPVSKVTKSGYLEVGVQPYGGGLWHTWFDRDLAV  132

Query  635  AG  640
            AG
Sbjct  133  AG  134



>ref|XP_008392833.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+ +LN + T FHA  EAK+ L +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLISFLNAAPTAFHAVDEAKKLLRSAGYEQVLEREDWKLEXGKKYFFTRNYSTIVAF  68

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AI KKY  GNGFH + AHTDSPC+KLKP S   K G+L V VQTYG GLWHTWFDRDLT+
Sbjct  69   AIXKKYVAGNGFHXVGAHTDSPCLKLKPVSKVAKGGFLEVGVQTYGSGLWHTWFDRDLTI  128

Query  635  AG  640
            AG
Sbjct  129  AG  130



>ref|XP_002963681.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
 gb|EFJ35552.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
Length=475

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            DL+ +LN + T FHA AEAKR+L AAGF  L+E + W L PGG Y+FTRN S++VAFAIG
Sbjct  14   DLISFLNAAPTPFHAVAEAKRRLEAAGFTQLSERDSWALLPGGTYYFTRNFSTIVAFAIG  73

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            K++  G GF I+ AHTDSPC KLKPRS   K G+L + VQTYG GLWHTWFDRDLTVAG
Sbjct  74   KRFYPGCGFAIVGAHTDSPCPKLKPRSKIVKGGFLELGVQTYGSGLWHTWFDRDLTVAG  132



>ref|XP_008394651.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Poecilia reticulata]
 ref|XP_008394656.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Poecilia reticulata]
 ref|XP_008394657.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Poecilia reticulata]
Length=160

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N+  + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  12   EFLQFVNKGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  71

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLTVAG
Sbjct  72   GKYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAG  130



>ref|XP_008394645.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Poecilia reticulata]
Length=165

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N+  + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  17   EFLQFVNKGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  76

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLTVAG
Sbjct  77   GKYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAG  135



>gb|EYU43065.1| hypothetical protein MIMGU_mgv1a005789mg [Erythranthe guttata]
Length=470

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            DL+++LN S T FHA  EAK +L +AG+  L+E ++W L+ G +YFFTRN S++VAFAIG
Sbjct  8    DLVEFLNASPTAFHAVDEAKNRLKSAGYGQLSERDDWKLEAGKKYFFTRNHSTIVAFAIG  67

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KKY  GNG +II AHTDSPC+KLKP S   K GYL V VQ YGGGLWHTWFDRDL +AG
Sbjct  68   KKYIAGNGIYIIGAHTDSPCIKLKPVSKVSKGGYLEVGVQPYGGGLWHTWFDRDLAIAG  126



>ref|XP_009025082.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
 gb|ESN96961.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
Length=468

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            D L ++N+S + FHA  E+K++L+ AGF  LNE E+W +KPG ++F TRN S+LVAFA+G
Sbjct  14   DFLKFINKSPSPFHAVEESKKRLLEAGFKELNEAEKWSVKPGDKFFLTRNHSTLVAFAVG  73

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             K+  GNGF II  HTDSPC+K+KP S   K+GYL V VQ YGGG+WHTWFDRDL +AG
Sbjct  74   GKFQPGNGFSIIGTHTDSPCLKIKPTSKIVKNGYLQVGVQLYGGGIWHTWFDRDLKLAG  132



>ref|XP_001756754.1| predicted protein [Physcomitrella patens]
 gb|EDQ78351.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +  +L+D+LN S T FHA  E+K +L+ AG+  L+E   W L+ GGRYFFTRN S++VAF
Sbjct  5    VAQELVDFLNASPTPFHAVQESKNRLLKAGYQQLSERASWTLEAGGRYFFTRNYSTIVAF  64

Query  455  AIGKK---YSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRD  625
            A+GKK   Y  GNGF II AHTDSPC KLKP +   KSG+L V V TYGGGLWHTWFDRD
Sbjct  65   AVGKKQVLYVPGNGFLIIGAHTDSPCPKLKPTTKVIKSGFLEVGVSTYGGGLWHTWFDRD  124

Query  626  LTVAG  640
            LTVAG
Sbjct  125  LTVAG  129



>emb|CEF99925.1| Peptidase M18 [Ostreococcus tauri]
Length=549

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +2

Query  287  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVAFAIG  463
            L+DYLN+SWT + AT  + + L AAG+  ++E+ EW DL+ GG+Y+ TRN S+LVAFA+G
Sbjct  97   LIDYLNDSWTAWEATESSVKILEAAGYVRISEHAEWSDLRAGGKYYVTRNQSALVAFAVG  156

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY+ GNGF++IAAHTDSPC KLKP +   K G++ V VQTYGGGLWHTWFDRDL+VAG
Sbjct  157  GKYAPGNGFNVIAAHTDSPCPKLKPVTKIKKGGFMQVGVQTYGGGLWHTWFDRDLSVAG  215



>ref|XP_003082377.1| aspartyl aminopeptidase (ISS) [Ostreococcus tauri]
Length=486

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +2

Query  287  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVAFAIG  463
            L+DYLN+SWT + AT  + + L AAG+  ++E+ EW DL+ GG+Y+ TRN S+LVAFA+G
Sbjct  34   LIDYLNDSWTAWEATESSVKILEAAGYVRISEHAEWSDLRAGGKYYVTRNQSALVAFAVG  93

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY+ GNGF++IAAHTDSPC KLKP +   K G++ V VQTYGGGLWHTWFDRDL+VAG
Sbjct  94   GKYAPGNGFNVIAAHTDSPCPKLKPVTKIKKGGFMQVGVQTYGGGLWHTWFDRDLSVAG  152



>ref|XP_001420830.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99123.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=465

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  451
            +  DL+D+LN+SWT  HAT  + + L AAG+  ++E+ EW DLK  G+Y+ TRN S+LVA
Sbjct  6    VANDLVDFLNDSWTAHHATEASVKLLEAAGYSKISESVEWGDLKRNGKYYVTRNQSALVA  65

Query  452  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  631
            FA+G  Y  GNGF+++AAHTDSPC KLKP S   K G++ V VQTYGGGLWHTWFDRDL+
Sbjct  66   FAVGGAYEPGNGFNVVAAHTDSPCPKLKPVSKIKKGGFMQVGVQTYGGGLWHTWFDRDLS  125

Query  632  VAG  640
            VAG
Sbjct  126  VAG  128



>ref|XP_011463290.1| PREDICTED: probable aspartyl aminopeptidase, partial [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  320  FHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHII  499
            F  T EAK++L +AG+  + E E+W+L+ G +YFFTRN S++VAFAIGKKY  GNGFH+I
Sbjct  5    FGVTDEAKKRLQSAGYEQVLEREDWNLEAGKKYFFTRNYSTIVAFAIGKKYVAGNGFHVI  64

Query  500  AAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLT+AG
Sbjct  65   GAHTDSPCLKLKPVSKVTKGGFLEVGVQTYGGGLWHTWFDRDLTIAG  111



>ref|XP_010102886.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB94323.1| Aspartyl aminopeptidase [Morus notabilis]
Length=507

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 96/143 (67%), Gaps = 21/143 (15%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V DL+D+LN S T FHA   AK+ L +AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  10   VVSDLMDFLNSSPTAFHAVDVAKKLLRSAGYEQVSEREDWKLEAGKKYFFTRNHSTIVAF  69

Query  455  AIGK---------------------KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLM  571
            AIGK                     +Y  GNGF+I+ AHTDSPC+KLKP +   K GYL 
Sbjct  70   AIGKSIEIDYTIYMTLFANGLELMSRYVAGNGFYIVGAHTDSPCLKLKPVTKVTKGGYLE  129

Query  572  VNVQTYGGGLWHTWFDRDLTVAG  640
            V VQTYGGGLWHTWFDRDLT+AG
Sbjct  130  VGVQTYGGGLWHTWFDRDLTLAG  152



>ref|XP_005814088.1| PREDICTED: aspartyl aminopeptidase-like [Xiphophorus maculatus]
Length=470

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  17   EFLQFVNRGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  76

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY  GNGF +I AHTDSPC+K+KPRS   K G L V V+ YGGG+W+TWFDRDLTVAG
Sbjct  77   GKYLPGNGFSMIGAHTDSPCLKVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAG  135



>ref|XP_007575368.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Poecilia formosa]
Length=472

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  17   EFLQFVNRGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  76

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLTVAG
Sbjct  77   GKYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAG  135



>ref|XP_007575369.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Poecilia formosa]
Length=467

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  12   EFLQFVNRGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  71

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLTVAG
Sbjct  72   GKYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAG  130



>gb|EIE78284.1| hypothetical protein RO3G_02988 [Rhizopus delemar RA 99-880]
Length=469

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + ++++N S + FHAT EA + LIAAGF  + E E W ++  G+YFFTRN S++VAF +G
Sbjct  15   EFIEFVNNSPSPFHATHEASQLLIAAGFKEIKERESWKIERKGKYFFTRNGSAIVAFVVG  74

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF I+ AHTDSPC+KLKP S   KSGYL V VQ YGGG+WH+WFDRDL+VAG
Sbjct  75   GQYKPGNGFSIVGAHTDSPCLKLKPISKKEKSGYLEVGVQLYGGGIWHSWFDRDLSVAG  133



>ref|XP_002592514.1| hypothetical protein BRAFLDRAFT_69005 [Branchiostoma floridae]
 gb|EEN48525.1| hypothetical protein BRAFLDRAFT_69005 [Branchiostoma floridae]
Length=473

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +2

Query  287  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGK  466
             +D++N+  + FH   E +  L AAGF  L E ++WD+KP  +YF TRN S++VAFA+G 
Sbjct  20   FVDFVNKCQSPFHVVEECRTILRAAGFSELREADQWDIKPNNKYFVTRNQSTVVAFAVGG  79

Query  467  KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            KY  GNGF I+ AHTDSPC+K+KP S   KSGY  V V+ YGGG+WHTWFDRDLTVAG
Sbjct  80   KYKPGNGFTIVGAHTDSPCLKVKPLSNKLKSGYQCVGVECYGGGIWHTWFDRDLTVAG  137



>gb|EFB19842.1| hypothetical protein PANDA_014251 [Ailuropoda melanoleuca]
Length=391

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  8    ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  67

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  68   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  126



>ref|XP_004662959.1| PREDICTED: aspartyl aminopeptidase [Jaculus jaculus]
Length=471

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN SS++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSSIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K +S   + GY  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQMGYQQVGVETYGGGIWSTWFDRDLTLAG  134



>ref|XP_003446617.1| PREDICTED: aspartyl aminopeptidase-like isoform X1 [Oreochromis 
niloticus]
Length=474

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLQFVNRGVSPYHVVEECRRHLLEAGFIELKETEQWDIKPASKYFVTRNFSSLIAFAVG  78

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AG
Sbjct  79   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAG  137



>ref|XP_004563349.1| PREDICTED: aspartyl aminopeptidase-like isoform X1 [Maylandia 
zebra]
 ref|XP_005738687.1| PREDICTED: aspartyl aminopeptidase-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005919953.1| PREDICTED: aspartyl aminopeptidase-like isoform X1 [Haplochromis 
burtoni]
Length=474

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLQFVNRGVSPYHVVEECRRHLLEAGFIELKETEQWDIKPASKYFVTRNFSSLIAFAVG  78

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AG
Sbjct  79   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAG  137



>ref|XP_004563350.1| PREDICTED: aspartyl aminopeptidase-like isoform X2 [Maylandia 
zebra]
 ref|XP_005738688.1| PREDICTED: aspartyl aminopeptidase-like isoform X2 [Pundamilia 
nyererei]
 ref|XP_005919954.1| PREDICTED: aspartyl aminopeptidase-like isoform X2 [Haplochromis 
burtoni]
Length=469

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLQFVNRGVSPYHVVEECRRHLLEAGFIELKETEQWDIKPASKYFVTRNFSSLIAFAVG  73

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AG
Sbjct  74   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAG  132



>ref|XP_005452349.1| PREDICTED: aspartyl aminopeptidase-like isoform X2 [Oreochromis 
niloticus]
 ref|XP_005452350.1| PREDICTED: aspartyl aminopeptidase-like isoform X3 [Oreochromis 
niloticus]
Length=469

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLQFVNRGVSPYHVVEECRRHLLEAGFIELKETEQWDIKPASKYFVTRNFSSLIAFAVG  73

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AG
Sbjct  74   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAG  132



>ref|XP_010859552.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Bison bison bison]
Length=430

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_008323213.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Cynoglossus semilaevis]
 ref|XP_008323214.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Cynoglossus semilaevis]
Length=475

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N+  + +H   E +R+L  AGF  LNE E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLQFVNKGASPYHVVDECRRRLREAGFIELNETEQWDIKPASKYFVTRNFSSLIAFAVG  73

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY  GNGF +I AHTDSPC+K+K RS   K G L V V+ YGGG+W+TWFDRDLTVAG
Sbjct  74   GKYLPGNGFSMIGAHTDSPCLKVKTRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTVAG  132



>ref|XP_008323211.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Cynoglossus semilaevis]
Length=493

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N+  + +H   E +R+L  AGF  LNE E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  32   EFLQFVNKGASPYHVVDECRRRLREAGFIELNETEQWDIKPASKYFVTRNFSSLIAFAVG  91

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY  GNGF +I AHTDSPC+K+K RS   K G L V V+ YGGG+W+TWFDRDLTVAG
Sbjct  92   GKYLPGNGFSMIGAHTDSPCLKVKTRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTVAG  150



>gb|ACC64563.1| aspartyl aminopeptidase (predicted) [Rhinolophus ferrumequinum]
Length=475

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FH  AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHVVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+L V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFLQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_008323212.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Cynoglossus semilaevis]
Length=480

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N+  + +H   E +R+L  AGF  LNE E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLQFVNKGASPYHVVDECRRRLREAGFIELNETEQWDIKPASKYFVTRNFSSLIAFAVG  78

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             KY  GNGF +I AHTDSPC+K+K RS   K G L V V+ YGGG+W+TWFDRDLTVAG
Sbjct  79   GKYLPGNGFSMIGAHTDSPCLKVKTRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTVAG  137



>ref|XP_004262732.1| PREDICTED: aspartyl aminopeptidase isoform 2 [Orcinus orca]
Length=475

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>gb|EWM25484.1| aspartyl aminopeptidase [Nannochloropsis gaditana]
Length=553

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 92/129 (71%), Gaps = 7/129 (5%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            IV  L+ +LNE+WT FHA   A  +L  AGF  L E + W LK GG+Y+FTRNM++L+AF
Sbjct  14   IVDGLITFLNEAWTPFHAVQAAASRLRDAGFKELREGDAWGLKAGGKYYFTRNMTTLIAF  73

Query  455  AIGKKYSI-------GNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  613
            A+G K+ I       G+GF II AHTDSPC KLKP S   KSGYL ++V  YGGGLWHTW
Sbjct  74   AVGNKFQICQHSGQGGSGFTIIGAHTDSPCPKLKPVSKLTKSGYLSLSVVGYGGGLWHTW  133

Query  614  FDRDLTVAG  640
            FDRDL++AG
Sbjct  134  FDRDLSLAG  142



>gb|KFH62765.1| aspartyl aminopeptidase [Mortierella verticillata NRRL 6337]
Length=357

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWD--LKPGGRYFFTRNMSSLVAFA  457
            D LD++N++ + FHAT +A  +L  AGF  + E + W+  LK  G+Y+FTRN S+++AFA
Sbjct  13   DFLDFVNQAQSPFHATEQAVLRLRKAGFQEIKEKDNWNNTLKRNGKYYFTRNRSAVIAFA  72

Query  458  IGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVA  637
            +G KY  GNGF  I AHTDSPC+K+KP S   K GYL V VQ YGGGLWHTWFDRDL+VA
Sbjct  73   VGGKYKPGNGFSAIGAHTDSPCLKIKPVSKKEKLGYLQVGVQLYGGGLWHTWFDRDLSVA  132

Query  638  G  640
            G
Sbjct  133  G  133



>ref|XP_004262731.1| PREDICTED: aspartyl aminopeptidase isoform 1 [Orcinus orca]
Length=481

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_004325560.1| PREDICTED: aspartyl aminopeptidase isoform 3 [Tursiops truncatus]
Length=475

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_004325559.1| PREDICTED: aspartyl aminopeptidase isoform 2 [Tursiops truncatus]
Length=481

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_007122487.1| PREDICTED: aspartyl aminopeptidase [Physeter catodon]
Length=471

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  134



>gb|ELR60782.1| Aspartyl aminopeptidase, partial [Bos mutus]
Length=485

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  30   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  89

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  90   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  148



>ref|XP_005202875.1| PREDICTED: aspartyl aminopeptidase isoform X5 [Bos taurus]
 ref|XP_005889752.1| PREDICTED: aspartyl aminopeptidase [Bos mutus]
 ref|XP_006059032.1| PREDICTED: aspartyl aminopeptidase [Bubalus bubalis]
Length=475

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|NP_001039417.1| aspartyl aminopeptidase [Bos taurus]
 ref|XP_005202876.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Bos taurus]
 sp|Q2HJH1.1|DNPEP_BOVIN RecName: Full=Aspartyl aminopeptidase [Bos taurus]
 gb|AAI05403.1| Aspartyl aminopeptidase [Bos taurus]
 tpg|DAA32399.1| TPA: aspartyl aminopeptidase [Bos taurus]
Length=471

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  134



>gb|EPZ34400.1| Peptidase M18 2 domain-containing protein [Rozella allomycis 
CSF55]
Length=402

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDL-KPGGRYFFTRNMSSLVAFAI  460
            +LL ++ +S + FHA  E K++LIA GF  L+E + W + KP  +YFFTRN SS++AF I
Sbjct  9    NLLKFIEKSPSPFHAVEEVKQKLIAVGFKELSERKCWPVFKPSEKYFFTRNSSSIIAFHI  68

Query  461  GKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            G KY  GNGF IIAAHTDSPC+K+KP S      YL + VQTYGGGLWHTWFDRDL+VAG
Sbjct  69   GSKYKPGNGFSIIAAHTDSPCLKVKPISKIVTKNYLQIGVQTYGGGLWHTWFDRDLSVAG  128



>ref|XP_004762907.1| PREDICTED: aspartyl aminopeptidase isoform X6 [Mustela putorius 
furo]
 ref|XP_004807175.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Mustela putorius 
furo]
Length=475

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_004325558.1| PREDICTED: aspartyl aminopeptidase isoform 1 [Tursiops truncatus]
Length=496

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  41   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  100

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  101  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAG  159



>ref|XP_010859551.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Bison bison bison]
Length=475

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_007519740.1| PREDICTED: aspartyl aminopeptidase [Erinaceus europaeus]
Length=475

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL+++N S + FHA AE + +L+ AGFH L E E W LKP  +YF TRN S+++AFA+G
Sbjct  20   ELLNFVNRSPSPFHAVAECRNRLLQAGFHELKETETWTLKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W+TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWNTWFDRDLTLAG  138



>ref|XP_005676646.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Capra hircus]
 ref|XP_005676647.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Capra hircus]
Length=471

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  134



>ref|XP_004005000.1| PREDICTED: LOW QUALITY PROTEIN: aspartyl aminopeptidase [Ovis 
aries]
Length=471

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  134



>ref|XP_005676645.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Capra hircus]
Length=475

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_006906751.1| PREDICTED: aspartyl aminopeptidase [Pteropus alecto]
Length=475

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKEAESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W+TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQMGFQQVGVETYGGGIWNTWFDRDLTLAG  138



>ref|XP_003784969.1| PREDICTED: aspartyl aminopeptidase [Otolemur garnettii]
Length=485

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  30   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFMTRNSSTIIAFAVG  89

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  90   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  148



>ref|XP_006935664.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Felis catus]
Length=475

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_010748613.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Larimichthys crocea]
Length=474

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLHFVNRGVSPYHVVDECRRRLLEAGFIELKETEQWDIKPSSKYFVTRNYSSLIAFAVG  78

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AG
Sbjct  79   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAG  137



>ref|XP_010748612.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Larimichthys crocea]
Length=469

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLHFVNRGVSPYHVVDECRRRLLEAGFIELKETEQWDIKPSSKYFVTRNYSSLIAFAVG  73

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AG
Sbjct  74   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAG  132



>ref|XP_007445869.1| PREDICTED: aspartyl aminopeptidase [Lipotes vexillifer]
Length=474

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSAIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_006739743.1| PREDICTED: aspartyl aminopeptidase [Leptonychotes weddellii]
Length=475

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  138



>ref|XP_006935665.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Felis catus]
 ref|XP_006935666.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Felis catus]
Length=471

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  134



>ref|XP_006792993.1| PREDICTED: aspartyl aminopeptidase-like [Neolamprologus brichardi]
Length=459

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N   + +H   E ++ L+ AGF  L E E+WD+KP  +YF TRN SS++AFA+G
Sbjct  19   EFLQFVNRGVSPYHVVEECRQHLLEAGFIELKETEQWDIKPASKYFLTRNFSSIIAFAVG  78

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+K+KPRS   K G L V V+ YGGG+W+TWFDRDLT+AG
Sbjct  79   GRYLPGNGFSMIGAHTDSPCLKVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAG  137



>ref|XP_004762903.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Mustela putorius 
furo]
 ref|XP_004762904.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Mustela putorius 
furo]
 ref|XP_004762905.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Mustela putorius 
furo]
 ref|XP_004762906.1| PREDICTED: aspartyl aminopeptidase isoform X5 [Mustela putorius 
furo]
 ref|XP_004807176.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Mustela putorius 
furo]
 ref|XP_004807177.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Mustela putorius 
furo]
 ref|XP_004807178.1| PREDICTED: aspartyl aminopeptidase isoform X5 [Mustela putorius 
furo]
 ref|XP_004807179.1| PREDICTED: aspartyl aminopeptidase isoform X6 [Mustela putorius 
furo]
Length=471

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  134



>ref|XP_004402809.1| PREDICTED: aspartyl aminopeptidase isoform 2 [Odobenus rosmarus 
divergens]
Length=477

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  134



>ref|XP_010800626.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Bos taurus]
Length=490

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  35   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  94

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  95   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  153



>pdb|3VAR|A Chain A, Crystal Structure Of Dnpep, Znzn Form
 pdb|3VAT|A Chain A, Crystal Structure Of Dnpep, Znmg Form
Length=496

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  41   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  100

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  101  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  159



>ref|XP_010800625.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Bos taurus]
Length=500

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  45   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  104

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  105  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  163



>ref|XP_005956749.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Pantholops hodgsonii]
Length=493

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  38   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  97

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  98   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  156



>ref|XP_002712541.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Oryctolagus cuniculus]
 ref|XP_008257445.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Oryctolagus cuniculus]
Length=471

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FH  AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHVVAECRSRLLQAGFHELKETESWDIKPECKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + GY  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGYQQVGVETYGGGIWSTWFDRDLTLAG  134



>ref|XP_004427652.1| PREDICTED: aspartyl aminopeptidase [Ceratotherium simum simum]
Length=493

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  38   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETETWDIKPESKYFLTRNSSTIIAFAVG  97

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  98   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  156



>gb|ELK17177.1| Aspartyl aminopeptidase [Pteropus alecto]
Length=515

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  60   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKEAESWDIKPESKYFLTRNSSTIIAFAVG  119

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W+TWFDRDLT+AG
Sbjct  120  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQMGFQQVGVETYGGGIWNTWFDRDLTLAG  178



>ref|XP_004402808.1| PREDICTED: aspartyl aminopeptidase isoform 1 [Odobenus rosmarus 
divergens]
Length=493

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  38   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  97

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  98   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  156



>ref|XP_006890316.1| PREDICTED: aspartyl aminopeptidase [Elephantulus edwardii]
Length=471

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E + WDLKP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETDSWDLKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W+TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFHQVGVETYGGGIWNTWFDRDLTLAG  134



>ref|XP_005640751.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Canis lupus familiaris]
Length=493

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  38   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  97

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  98   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  156



>ref|XP_010765444.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Notothenia coriiceps]
 ref|XP_010765445.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Notothenia coriiceps]
Length=286

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N+  + +H   E KR+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLQFVNKGVSPYHVVEECKRRLLQAGFIELKEAEQWDIKPSSKYFVTRNYSSLIAFAVG  73

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
              +  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W TWFDRDLT+AG
Sbjct  74   GHFLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWSTWFDRDLTLAG  132



>ref|XP_005202874.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Bos taurus]
Length=509

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  54   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  113

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  114  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  172



>ref|XP_006402123.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
 gb|ESQ43576.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
Length=465

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 87/122 (71%), Gaps = 14/122 (11%)
 Frame = +2

Query  275  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  454
            +V D L +LN S T FHA              +++E ++W L+ G +YFFTRN S++VAF
Sbjct  8    LVSDFLAFLNASPTAFHA--------------VVSERDDWKLEAGKKYFFTRNYSTIVAF  53

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
            AIGKKY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLTV
Sbjct  54   AIGKKYVAGNGFHIIGAHTDSPCLKLKPVSKVSKGGYLEVGVQTYGGGLWYTWFDRDLTV  113

Query  635  AG  640
            AG
Sbjct  114  AG  115



>ref|XP_010765443.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Notothenia coriiceps]
Length=291

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            + L ++N+  + +H   E KR+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLQFVNKGVSPYHVVEECKRRLLQAGFIELKEAEQWDIKPSSKYFVTRNYSSLIAFAVG  78

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
              +  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W TWFDRDLT+AG
Sbjct  79   GHFLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWSTWFDRDLTLAG  137



>ref|XP_004762902.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Mustela putorius 
furo]
 ref|XP_004807174.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Mustela putorius 
furo]
Length=509

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  54   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  113

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  114  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  172



>ref|XP_005956748.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Pantholops hodgsonii]
Length=509

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  54   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  113

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  114  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  172



>ref|XP_006935663.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Felis catus]
Length=509

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  54   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  113

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  114  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  172



>ref|XP_008257444.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Oryctolagus cuniculus]
Length=491

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FH  AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  36   ELLKFVNRSPSPFHVVAECRSRLLQAGFHELKETESWDIKPECKYFLTRNSSTIIAFAVG  95

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + GY  V V+TYGGG+W TWFDRDLT+AG
Sbjct  96   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGYQQVGVETYGGGIWSTWFDRDLTLAG  154



>ref|XP_007956515.1| PREDICTED: aspartyl aminopeptidase [Orycteropus afer afer]
Length=473

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E + WD+KP  +YF TRN S+++AFA+G
Sbjct  18   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETDSWDIKPESKYFLTRNSSTIIAFAVG  77

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K +S   + G+L V V+TYGGG+W TWFDRDLT+AG
Sbjct  78   GQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGFLQVGVETYGGGIWGTWFDRDLTLAG  136



>ref|XP_011404738.1| PREDICTED: aspartyl aminopeptidase-like [Amphimedon queenslandica]
Length=465

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +2

Query  287  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGK  466
            L+D++N+  + +H   E KRQL+   F  L E E W++KP G YF   N S+++AFA+G 
Sbjct  17   LIDFVNKGPSPYHVVEECKRQLMERNFTELKEKESWEIKPNGLYFVVNNFSTIIAFAVGG  76

Query  467  KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
            +Y  GNGF+ + AHTDSPC+K+KPRS   + GYL V V+ YGGG+WHTWFDRDLTVAG
Sbjct  77   QYKPGNGFNAVGAHTDSPCLKVKPRSNRSRCGYLQVGVECYGGGIWHTWFDRDLTVAG  134



>ref|XP_011230094.1| PREDICTED: aspartyl aminopeptidase [Ailuropoda melanoleuca]
Length=511

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  35   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  94

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AG
Sbjct  95   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAG  153



>emb|CEP14293.1| hypothetical protein [Parasitella parasitica]
Length=475

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWD---LKPGGRYFFTRNMSSLVAF  454
            D ++++N+S + FHAT EA   L AAGF  + E + W+   ++  G+YFFTRN S+LVAF
Sbjct  13   DFIEFVNKSPSPFHATFEASEILRAAGFKEIKERDSWNDGLIERKGKYFFTRNGSALVAF  72

Query  455  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  634
             +G KY+ GNGF II AHTDSPC+K+KP S   KSGYL V VQ YGGG+WHTWFDRDL+V
Sbjct  73   EVGGKYNPGNGFSIIGAHTDSPCLKIKPISKKEKSGYLEVGVQLYGGGIWHTWFDRDLSV  132

Query  635  AG  640
            AG
Sbjct  133  AG  134



>ref|XP_004576859.1| PREDICTED: aspartyl aminopeptidase [Ochotona princeps]
Length=471

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  463
            +LL ++N S + +H  AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPYHVVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  464  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  640
             +Y  GNGF +I AHTDSPC+++K RS   + GY  V V+TYGGG+W TWFDRDLT+AG
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAG  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750