BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039L02

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003516943.1|  PREDICTED: uncharacterized protein LOC100780899    181   6e-50   Glycine max [soybeans]
ref|XP_009787548.1|  PREDICTED: uncharacterized protein LOC104235470    177   1e-48   Nicotiana sylvestris
ref|XP_009593272.1|  PREDICTED: uncharacterized protein LOC104089...    177   1e-48   Nicotiana tomentosiformis
ref|XP_003520926.1|  PREDICTED: uncharacterized protein LOC100803792    175   9e-48   Glycine max [soybeans]
ref|XP_004249580.1|  PREDICTED: uncharacterized protein LOC101249508    174   1e-47   Solanum lycopersicum
gb|KJB17034.1|  hypothetical protein B456_002G261700                    168   1e-46   Gossypium raimondii
ref|XP_010678109.1|  PREDICTED: uncharacterized protein LOC104893676    171   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006338993.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    171   2e-46   Solanum tuberosum [potatoes]
ref|XP_009587153.1|  PREDICTED: uncharacterized protein LOC104084897    171   2e-46   Nicotiana tomentosiformis
gb|KHN46311.1|  GDP-mannose-dependent alpha-mannosyltransferase         169   4e-46   Glycine soja [wild soybean]
ref|XP_006848130.1|  hypothetical protein AMTR_s00029p00223030          165   4e-46   
gb|KHN31576.1|  GDP-mannose-dependent alpha-mannosyltransferase         169   5e-46   Glycine soja [wild soybean]
ref|XP_011094980.1|  PREDICTED: uncharacterized protein LOC105174543    170   5e-46   Sesamum indicum [beniseed]
ref|XP_006363049.1|  PREDICTED: uncharacterized protein LOC102604925    170   6e-46   Solanum tuberosum [potatoes]
emb|CBI30420.3|  unnamed protein product                                168   9e-46   Vitis vinifera
gb|KDP24481.1|  hypothetical protein JCGZ_25045                         168   1e-45   Jatropha curcas
emb|CDY10486.1|  BnaCnng03870D                                          167   1e-45   Brassica napus [oilseed rape]
gb|KJB17032.1|  hypothetical protein B456_002G261700                    169   1e-45   Gossypium raimondii
ref|XP_008442461.1|  PREDICTED: uncharacterized protein LOC103486318    169   1e-45   Cucumis melo [Oriental melon]
ref|XP_011019147.1|  PREDICTED: uncharacterized protein LOC105121959    169   1e-45   Populus euphratica
gb|KHG08972.1|  GDP-mannose-dependent alpha-mannosyltransferase         169   2e-45   Gossypium arboreum [tree cotton]
ref|XP_002309122.2|  hypothetical protein POPTR_0006s09880g             169   2e-45   
gb|KJB17030.1|  hypothetical protein B456_002G261700                    169   2e-45   Gossypium raimondii
ref|XP_002531354.1|  glycosyltransferase, putative                      167   2e-45   
ref|NP_001266888.1|  uncharacterized protein LOC101027242               161   2e-45   
ref|XP_007133940.1|  hypothetical protein PHAVU_010G005100g             169   2e-45   Phaseolus vulgaris [French bean]
emb|CDX97820.1|  BnaC04g41190D                                          167   2e-45   
ref|XP_006398643.1|  hypothetical protein EUTSA_v10013276mg             168   2e-45   Eutrema salsugineum [saltwater cress]
ref|XP_002278868.2|  PREDICTED: uncharacterized protein LOC100259616    168   3e-45   Vitis vinifera
ref|XP_006429312.1|  hypothetical protein CICLE_v10011473mg             168   3e-45   Citrus clementina [clementine]
ref|XP_006480973.1|  PREDICTED: uncharacterized protein LOC102615235    168   3e-45   Citrus sinensis [apfelsine]
ref|XP_009358856.1|  PREDICTED: uncharacterized protein LOC103949460    168   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_007205049.1|  hypothetical protein PRUPE_ppa004263mg             168   3e-45   Prunus persica
emb|CDP06508.1|  unnamed protein product                                166   5e-45   Coffea canephora [robusta coffee]
emb|CAN62120.1|  hypothetical protein VITISV_037025                     167   5e-45   Vitis vinifera
emb|CDY40312.1|  BnaA10g27560D                                          167   5e-45   Brassica napus [oilseed rape]
gb|EYU41861.1|  hypothetical protein MIMGU_mgv1a004551mg                167   9e-45   Erythranthe guttata [common monkey flower]
ref|XP_011077579.1|  PREDICTED: uncharacterized protein LOC105161555    167   1e-44   Sesamum indicum [beniseed]
ref|XP_004246336.1|  PREDICTED: uncharacterized protein LOC101252422    166   1e-44   Solanum lycopersicum
ref|XP_009781169.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    166   1e-44   Nicotiana sylvestris
ref|XP_007026774.1|  Sulfoquinovosyldiacylglycerol 2                    166   2e-44   
ref|XP_004302644.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    166   2e-44   Fragaria vesca subsp. vesca
emb|CDX80782.1|  BnaC03g00360D                                          164   2e-44   
ref|XP_010553086.1|  PREDICTED: uncharacterized protein LOC104823284    165   3e-44   Tarenaya hassleriana [spider flower]
gb|AAK76635.1|  unknown protein                                         164   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870938.1|  predicted protein                                  165   4e-44   Arabidopsis lyrata subsp. lyrata
emb|CAB69850.1|  putative protein                                       164   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002323560.1|  SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein     163   4e-44   
ref|XP_010256624.1|  PREDICTED: uncharacterized protein LOC104596978    164   7e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004137727.1|  PREDICTED: GDP-mannose-dependent alpha-manno...    164   7e-44   Cucumis sativus [cucumbers]
gb|EPS61329.1|  hypothetical protein M569_13468                         157   8e-44   Genlisea aurea
ref|XP_009130666.1|  PREDICTED: uncharacterized protein LOC103855432    164   1e-43   Brassica rapa
ref|XP_010490595.1|  PREDICTED: uncharacterized protein LOC104768346    164   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009370203.1|  PREDICTED: uncharacterized protein LOC103959579    164   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_010909645.1|  PREDICTED: uncharacterized protein LOC105035694    164   1e-43   Elaeis guineensis
gb|KJB76912.1|  hypothetical protein B456_012G112200                    162   1e-43   Gossypium raimondii
ref|XP_008239560.1|  PREDICTED: uncharacterized protein LOC103338145    164   1e-43   Prunus mume [ume]
ref|XP_010452011.1|  PREDICTED: uncharacterized protein LOC104734184    164   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011047417.1|  PREDICTED: uncharacterized protein LOC105141...    162   1e-43   Populus euphratica
ref|NP_568085.2|  sulfoquinovosyldiacylglycerol 2                       164   1e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11210.1|  BnaA03g00460D                                          164   1e-43   Brassica napus [oilseed rape]
ref|XP_008388188.1|  PREDICTED: uncharacterized protein LOC103450599    163   2e-43   
ref|XP_006287534.1|  hypothetical protein CARUB_v10000742mg             163   2e-43   Capsella rubella
ref|XP_006657378.1|  PREDICTED: uncharacterized protein LOC102710508    162   2e-43   
gb|ABA55726.1|  sulfoquinovosyldiacylglycerol synthase type 2           163   2e-43   Vigna unguiculata
ref|XP_003604630.1|  Glycogen synthase                                  162   3e-43   Medicago truncatula
ref|XP_008650830.1|  PREDICTED: uncharacterized protein LOC100192...    162   3e-43   
ref|XP_004506782.1|  PREDICTED: GDP-mannose-dependent alpha-manno...    162   3e-43   Cicer arietinum [garbanzo]
ref|XP_010424824.1|  PREDICTED: uncharacterized protein LOC104709996    164   3e-43   
ref|XP_009407545.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    162   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004987290.1|  PREDICTED: uncharacterized protein LOC101765158    162   4e-43   Setaria italica
gb|EYU26645.1|  hypothetical protein MIMGU_mgv1a004620mg                162   4e-43   Erythranthe guttata [common monkey flower]
ref|XP_002459190.1|  hypothetical protein SORBIDRAFT_02g000240          162   5e-43   Sorghum bicolor [broomcorn]
gb|EEE66415.1|  hypothetical protein OsJ_22761                          161   6e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800789.1|  PREDICTED: uncharacterized protein LOC103715059    162   6e-43   Phoenix dactylifera
ref|XP_003561543.1|  PREDICTED: uncharacterized protein LOC100842...    161   6e-43   Brachypodium distachyon [annual false brome]
gb|EMS55944.1|  GDP-mannose-dependent alpha-mannosyltransferase         161   7e-43   Triticum urartu
dbj|BAJ85864.1|  predicted protein                                      161   7e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT15547.1|  Putative glycosyltransferase                            161   1e-42   
ref|XP_010228495.1|  PREDICTED: uncharacterized protein LOC100842...    161   1e-42   Brachypodium distachyon [annual false brome]
dbj|BAD31817.1|  putative sulfolipid synthase                           160   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb|KFK44566.1|  hypothetical protein AALP_AA1G274200                    160   3e-42   Arabis alpina [alpine rockcress]
ref|XP_008650829.1|  PREDICTED: uncharacterized protein LOC100192...    158   1e-41   Zea mays [maize]
gb|KHN24299.1|  GDP-mannose-dependent alpha-mannosyltransferase         157   1e-41   Glycine soja [wild soybean]
ref|XP_003552228.1|  PREDICTED: uncharacterized protein LOC100807...    157   2e-41   Glycine max [soybeans]
ref|XP_006602643.1|  PREDICTED: uncharacterized protein LOC100807...    157   3e-41   Glycine max [soybeans]
ref|XP_010558362.1|  PREDICTED: uncharacterized protein LOC104827042    157   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_009409491.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    155   5e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007140380.1|  hypothetical protein PHAVU_008G106900g             156   8e-41   Phaseolus vulgaris [French bean]
ref|XP_004968167.1|  PREDICTED: uncharacterized protein LOC101764078    153   3e-40   
gb|AES79437.2|  group 1 family glycosyltransferase                      154   4e-40   Medicago truncatula
ref|XP_003623219.1|  Phosphatidylinositol N-acetylglucosaminyltra...    154   6e-40   
gb|EAY72486.1|  hypothetical protein OsI_00342                          152   6e-40   Oryza sativa Indica Group [Indian rice]
gb|EMT15719.1|  Putative glycosyltransferase                            152   6e-40   
ref|NP_001041991.1|  Os01g0142300                                       152   6e-40   
ref|XP_006643739.1|  PREDICTED: uncharacterized protein LOC102711739    152   6e-40   Oryza brachyantha
emb|CDM81044.1|  unnamed protein product                                152   7e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003568443.1|  PREDICTED: uncharacterized protein LOC100832140    152   7e-40   Brachypodium distachyon [annual false brome]
gb|EMS60261.1|  GDP-mannose-dependent alpha-mannosyltransferase         154   8e-40   Triticum urartu
ref|XP_002457385.1|  hypothetical protein SORBIDRAFT_03g006480          152   9e-40   Sorghum bicolor [broomcorn]
ref|NP_001144658.1|  uncharacterized protein LOC100277683               152   1e-39   Zea mays [maize]
ref|XP_008653982.1|  PREDICTED: uncharacterized protein LOC103634168    151   2e-39   Zea mays [maize]
ref|XP_002468134.1|  hypothetical protein SORBIDRAFT_01g040150          151   2e-39   Sorghum bicolor [broomcorn]
gb|ACN34235.1|  unknown                                                 150   2e-39   Zea mays [maize]
gb|ACG31912.1|  glycosyl transferase, group 1 family protein            150   2e-39   Zea mays [maize]
ref|NP_001150015.1|  glycosyl transferase, group 1 family protein       150   2e-39   Zea mays [maize]
ref|XP_002968644.1|  UDP-sulfoquinovose: alpha-diacylglycerol-sul...    152   3e-39   Selaginella moellendorffii
tpg|DAA44536.1|  TPA: hypothetical protein ZEAMMB73_879639              149   5e-39   
ref|XP_004984689.1|  PREDICTED: uncharacterized protein LOC101779471    149   5e-39   Setaria italica
ref|XP_009122830.1|  PREDICTED: uncharacterized protein LOC103847496    149   2e-38   Brassica rapa
ref|XP_003558286.1|  PREDICTED: uncharacterized protein LOC100846446    148   3e-38   Brachypodium distachyon [annual false brome]
ref|XP_006649799.1|  PREDICTED: uncharacterized protein LOC102700221    147   4e-38   Oryza brachyantha
dbj|BAJ91585.1|  predicted protein                                      147   4e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY89357.1|  hypothetical protein OsI_10861                          145   2e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_001766232.1|  predicted protein                                  145   4e-37   
ref|NP_001049645.1|  Os03g0265100                                       144   6e-37   
ref|XP_001756850.1|  predicted protein                                  144   1e-36   
gb|KCW88121.1|  hypothetical protein EUGRSUZ_A00516                     142   5e-36   Eucalyptus grandis [rose gum]
ref|XP_008370134.1|  PREDICTED: uncharacterized protein LOC103433646    135   2e-33   
emb|CDY21645.1|  BnaC09g46470D                                          130   3e-33   Brassica napus [oilseed rape]
gb|EMT15626.1|  Lipopolysaccharide core biosynthesis glycosyltran...    132   1e-32   
emb|CDX82174.1|  BnaC02g21160D                                          124   1e-30   
tpg|DAA59318.1|  TPA: hypothetical protein ZEAMMB73_291487              120   4e-30   
ref|XP_002953985.1|  hypothetical protein VOLCADRAFT_82536              105   1e-22   Volvox carteri f. nagariensis
ref|XP_010031046.1|  PREDICTED: uncharacterized protein LOC104420932    103   1e-22   Eucalyptus grandis [rose gum]
gb|KDO53238.1|  hypothetical protein CISIN_1g009759mg                   103   2e-22   Citrus sinensis [apfelsine]
ref|XP_009593273.1|  PREDICTED: uncharacterized protein LOC104089...    100   1e-21   
ref|XP_011047421.1|  PREDICTED: uncharacterized protein LOC105141...  97.8    2e-20   Populus euphratica
gb|KEH28856.1|  group 1 family glycosyltransferase                    96.3    5e-20   Medicago truncatula
ref|XP_011396666.1|  GDP-mannose-dependent alpha-mannosyltransferase  96.3    9e-20   Auxenochlorella protothecoides
gb|ABC24951.1|  plastid sulfolipid synthase                           91.7    4e-19   Prototheca wickerhamii
gb|KJB17031.1|  hypothetical protein B456_002G261700                  91.7    2e-18   Gossypium raimondii
gb|KIY98280.1|  sulfoquinovosyltransferase                            91.3    1e-17   Monoraphidium neglectum
ref|XP_011047420.1|  PREDICTED: uncharacterized protein LOC105141...  89.4    2e-17   Populus euphratica
ref|XP_001421416.1|  predicted protein                                86.3    4e-16   Ostreococcus lucimarinus CCE9901
ref|XP_003083256.1|  sulfolipid synthase (ISS)                        86.3    7e-16   
ref|XP_006583630.1|  PREDICTED: uncharacterized protein LOC100804237  84.3    7e-16   
emb|CDX75469.1|  BnaA01g02330D                                        79.7    1e-15   
emb|CEG01736.1|  Glycosyl transferase, family 1                       85.9    1e-15   Ostreococcus tauri
ref|XP_003057606.1|  glycosyltransferase family 4 protein             83.2    1e-14   Micromonas pusilla CCMP1545
ref|XP_005644605.1|  UDP-Glycosyltransferase/glycogen phosphorylase   80.5    4e-14   Coccomyxa subellipsoidea C-169
gb|KIZ01145.1|  hypothetical protein MNEG_6812                        75.5    5e-14   Monoraphidium neglectum
ref|XP_010101801.1|  GDP-mannose-dependent alpha-mannosyltransferase  78.6    8e-14   
ref|XP_005843576.1|  hypothetical protein CHLNCDRAFT_33086            79.0    1e-13   Chlorella variabilis
ref|XP_001699258.1|  sulfolipid synthase                              78.2    2e-13   Chlamydomonas reinhardtii
ref|XP_007514956.1|  SqdX                                             78.2    4e-13   Bathycoccus prasinos
ref|XP_005715110.1|  unnamed protein product                          77.4    5e-13   Chondrus crispus [carageen]
gb|KIZ02980.1|  sulfoquinovosyltransferase                            76.6    8e-13   Monoraphidium neglectum
ref|XP_002501927.1|  glycosyltransferase family 4 protein             75.5    3e-12   Micromonas commoda
ref|XP_005538341.1|  sulfoquinovosyldiacylglycerol biosynthesis p...  70.9    8e-11   Cyanidioschyzon merolae strain 10D
gb|EJK62906.1|  hypothetical protein THAOC_16464                      70.5    9e-11   Thalassiosira oceanica
ref|XP_005705641.1|  UDP-sulfoquinovose:DAG sulfoquinovosyltransf...  69.7    2e-10   Galdieria sulphuraria
ref|XP_002185276.1|  glycosyl transferase, group 1                    64.3    1e-08   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009034698.1|  hypothetical protein AURANDRAFT_52616            63.2    2e-08   Aureococcus anophagefferens
ref|XP_009035363.1|  hypothetical protein AURANDRAFT_2613             63.2    2e-08   Aureococcus anophagefferens
gb|EWM27152.1|  gdp-mannose-dependent alpha-mannosyltransferase       62.8    3e-08   Nannochloropsis gaditana
ref|XP_005767468.1|  SQDG synthase                                    61.6    1e-07   Emiliania huxleyi CCMP1516
emb|CBJ27895.1|  UDP-sulfoquinovose: diacylglycerol alpha-sulfoqu...  58.9    1e-07   Ectocarpus siliculosus
ref|XP_001689662.1|  sulfolipid synthase                              59.7    3e-07   Chlamydomonas reinhardtii
ref|XP_005706721.1|  sulfoquinovosyltransferase                       60.1    3e-07   Galdieria sulphuraria
ref|XP_002295162.1|  predicted protein                                58.9    6e-07   Thalassiosira pseudonana CCMP1335
ref|XP_005791415.1|  hypothetical protein EMIHUDRAFT_223825           55.1    6e-06   Emiliania huxleyi CCMP1516
ref|XP_005789854.1|  hypothetical protein EMIHUDRAFT_225608           55.1    1e-05   Emiliania huxleyi CCMP1516
gb|KJB17033.1|  hypothetical protein B456_002G261700                  53.9    3e-05   Gossypium raimondii
ref|XP_005834049.1|  hypothetical protein GUITHDRAFT_45198            52.4    9e-05   Guillardia theta CCMP2712
emb|CAE20224.1|  SqdX                                                 51.6    2e-04   Prochlorococcus marinus str. MIT 9313
ref|WP_006042635.1|  glycosyl transferase                             51.2    2e-04   Synechococcus sp. WH 7805
ref|WP_011931986.1|  glycosyl transferase                             50.1    5e-04   Synechococcus sp. WH 7803
ref|WP_011363092.1|  glycosyl transferase                             49.7    7e-04   Synechococcus sp. CC9605
gb|AHF62481.1|  SqdX                                                  49.7    8e-04   Synechococcus sp. WH 8109
ref|WP_038551862.1|  glycosyl transferase                             49.7    8e-04   Synechococcus sp. KORDI-52
ref|WP_028953281.1|  glycosyl transferase                             49.3    0.001   Synechococcus sp. CC9616
ref|WP_009788501.1|  glycosyl transferase                             49.3    0.001   Synechococcus sp. BL107



>ref|XP_003516943.1| PREDICTED: uncharacterized protein LOC100780899 [Glycine max]
Length=523

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 116/160 (73%), Gaps = 15/160 (9%)
 Frame = +1

Query  223  PTHSLKFSCFSASRAK---PFCIKS------GSLKNRQRPFFVAASSNMtiteyreeeee  375
            P +SL+FSCF + R K   PFC K+      GS   + R   V  ++NMTI E    +  
Sbjct  35   PQNSLRFSCFQSFRPKPINPFCRKARLCSLQGSTSVKSRKSLVLCATNMTIAEDSLLQVV  94

Query  376  spp------pviesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT  537
                      +++ E  S+PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT
Sbjct  95   EEEEGPPDFALLDPEDNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT  154

Query  538  THEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            THEGVP+EFYGAKLIGSRSFPCPWY KVPLSLALSPRIIS
Sbjct  155  THEGVPKEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIIS  194



>ref|XP_009787548.1| PREDICTED: uncharacterized protein LOC104235470 [Nicotiana sylvestris]
Length=506

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 110/155 (71%), Gaps = 13/155 (8%)
 Frame = +1

Query  223  PTHSLKFSCFSASRAKPF---CIKSGSLK-------NRQRPFFVAASSNMtiteyreeee  372
            PT    FSCF  SR KP    C K   L+        ++RP   A++SNMTI E  EE  
Sbjct  28   PTAFHDFSCFCTSRTKPINLICTKVNFLQPKIRERHLKKRPLIAASNSNMTIREEEEEGP  87

Query  373  espppviesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV  552
                    S    KPRRIA+FVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGV
Sbjct  88   PPLLESEISS---KPRRIAIFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGV  144

Query  553  PEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            P+EFYGAKLIGS SFPCPWY KVPLSLALSPRIIS
Sbjct  145  PQEFYGAKLIGSLSFPCPWYQKVPLSLALSPRIIS  179



>ref|XP_009593272.1| PREDICTED: uncharacterized protein LOC104089958 isoform X1 [Nicotiana 
tomentosiformis]
Length=505

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 111/155 (72%), Gaps = 13/155 (8%)
 Frame = +1

Query  223  PTHSLKFSCFSASRAKPF---CIKSGSLKNR-------QRPFFVAASSNMtiteyreeee  372
            PT+   FSCF  SR KP    C K   L+ +       +RP   A++SNMTI E  EE  
Sbjct  27   PTNFHDFSCFCTSRTKPINLICTKVNFLQPKIRERLLKKRPLIAASNSNMTIREEEEEGP  86

Query  373  espppviesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV  552
                    +    KPRRIA+FVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGV
Sbjct  87   PPFLESEITS---KPRRIAIFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGV  143

Query  553  PEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            P+EFYGAKLIGS SFPCPWY KVPLSLALSPRIIS
Sbjct  144  PQEFYGAKLIGSLSFPCPWYQKVPLSLALSPRIIS  178



>ref|XP_003520926.1| PREDICTED: uncharacterized protein LOC100803792 [Glycine max]
Length=517

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 111/160 (69%), Gaps = 15/160 (9%)
 Frame = +1

Query  223  PTHSLKFSC---FSASRAKPFCIKS------GSLKNRQRPFFVAASSNMtiteyreeeee  375
            P +SL+FSC   F      PFC K+      GS   + R   V  + NMTI      +  
Sbjct  29   PQNSLRFSCSQSFGPKAINPFCRKARFCSLQGSTSVKSRKSLVLCAINMTIATDSLLQVV  88

Query  376  spp------pviesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT  537
                      +++ E  S+PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT
Sbjct  89   EEEEGPPDFALLDPEDNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT  148

Query  538  THEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            THEGVP+EFYGAKLIGSRSFPCPWY KVPLSLALSPRIIS
Sbjct  149  THEGVPKEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIIS  188



>ref|XP_004249580.1| PREDICTED: uncharacterized protein LOC101249508 [Solanum lycopersicum]
Length=504

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 123/156 (79%), Gaps = 10/156 (6%)
 Frame = +1

Query  220  IPTHSLKFSCFSASRAKPF---CIKSGSLKN----RQRPFF---VAASSNMtiteyreee  369
            +PT    FS FS SR  P    C K   L+     R+RPF    + A+SNM   EYREEE
Sbjct  23   VPTSFHDFSHFSTSRTNPISLICTKDNFLQCERRFRERPFKKRPLIAASNMKGKEYREEE  82

Query  370  eespppviesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEG  549
            EE PPP++ESE TSKPRRIA+FVEPSPF+YVSGYKNRFQNFI+YLREMGDEVMVVTTHEG
Sbjct  83   EEGPPPLVESETTSKPRRIAIFVEPSPFSYVSGYKNRFQNFIRYLREMGDEVMVVTTHEG  142

Query  550  VPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            VP+EFYGAKLIGSRSFPCP Y KVPLSLALSPRIIS
Sbjct  143  VPQEFYGAKLIGSRSFPCPLYEKVPLSLALSPRIIS  178



>gb|KJB17034.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=352

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP EFYGAKLIGSR
Sbjct  107  KPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPTEFYGAKLIGSR  166

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  167  SFPCPWYQKVPLSLALSPRIIS  188



>ref|XP_010678109.1| PREDICTED: uncharacterized protein LOC104893676 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/82 (98%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR
Sbjct  94   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  153

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  154  SFPCPWYQKVPLSLALSPRIIS  175



>ref|XP_006338993.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Solanum tuberosum]
Length=503

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 122/150 (81%), Gaps = 10/150 (7%)
 Frame = +1

Query  238  KFSCFSASRAKPF---CIKSGSLKN----RQRPFF---VAASSNMtiteyreeeeesppp  387
            +FS FS SR  P    C K   L+     R+RPF    + A+SNM + EYREEEEE PPP
Sbjct  28   EFSYFSTSRTNPISLICTKVNFLQCERRFRERPFKKRPLIAASNMKVKEYREEEEEGPPP  87

Query  388  viesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFY  567
             IESE++SKPRRIA+FVEPSPF+YVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFY
Sbjct  88   SIESEMSSKPRRIAIFVEPSPFSYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFY  147

Query  568  GAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            GAKLIGSRSFPCP Y KVPLSLALSPRIIS
Sbjct  148  GAKLIGSRSFPCPLYQKVPLSLALSPRIIS  177



>ref|XP_009587153.1| PREDICTED: uncharacterized protein LOC104084897 [Nicotiana tomentosiformis]
Length=509

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 13/153 (8%)
 Frame = +1

Query  238  KFSCFSASRAKPF---CIKSGSLKNRQ----RPF----FVAA--SSNMtiteyreeeees  378
            K SCFS SR  P    C K   L+ ++    RPF     +AA  S+ MTITEYR+EEEE+
Sbjct  29   KVSCFSTSRTYPISLICKKINFLQCKKSFNKRPFKKRSLIAAKASNKMTITEYRDEEEEN  88

Query  379  pppviesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPE  558
            PPP++ SE++S PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+
Sbjct  89   PPPLLVSEMSSTPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPQ  148

Query  559  EFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            EFYGAKLIGS+SFPCPWY KVPLSLALSPRIIS
Sbjct  149  EFYGAKLIGSQSFPCPWYRKVPLSLALSPRIIS  181



>gb|KHN46311.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=441

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  31   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPKEFYGAKLIGSR  90

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  91   SFPCPWYQKVPLSLALSPRIIS  112



>ref|XP_006848130.1| hypothetical protein AMTR_s00029p00223030 [Amborella trichopoda]
 gb|ERN09711.1| hypothetical protein AMTR_s00029p00223030 [Amborella trichopoda]
Length=274

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EFYGAKLIGS 
Sbjct  29   KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFYGAKLIGSW  88

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  89   SFPCPWYQKVPLSLALSPRIIS  110



>gb|KHN31576.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=441

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  31   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPKEFYGAKLIGSR  90

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  91   SFPCPWYQKVPLSLALSPRIIS  112



>ref|XP_011094980.1| PREDICTED: uncharacterized protein LOC105174543 [Sesamum indicum]
Length=526

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/82 (98%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR
Sbjct  118  RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  177

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  178  SFPCPWYQKVPLSLALSPRIIS  199



>ref|XP_006363049.1| PREDICTED: uncharacterized protein LOC102604925 [Solanum tuberosum]
Length=506

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 115/149 (77%), Gaps = 9/149 (6%)
 Frame = +1

Query  238  KFSCFSASRAKPFCIKSGSLKN-------RQRPFFVAA--SSNMtiteyreeeeespppv  390
            K SCFS SR  P  + S  +         R++PF   A  SS MTITEYR+EEEE  PP+
Sbjct  30   KVSCFSTSRTNPIRLISKKITFLQCEKSFRRKPFKKRALISSKMTITEYRDEEEEEYPPL  89

Query  391  iesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYG  570
            +      +PRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYG
Sbjct  90   LLESEMKEPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYG  149

Query  571  AKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            AKLIGSRSFPCP Y KVPLSLALSPRIIS
Sbjct  150  AKLIGSRSFPCPCYAKVPLSLALSPRIIS  178



>emb|CBI30420.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  27   RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  86

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  87   SFPCPWYRKVPLSLALSPRIIS  108



>gb|KDP24481.1| hypothetical protein JCGZ_25045 [Jatropha curcas]
Length=437

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  28   RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  87

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  88   SFPCPWYQKVPLSLALSPRIIS  109



>emb|CDY10486.1| BnaCnng03870D [Brassica napus]
Length=417

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGAK+IGS+
Sbjct  24   KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGAKVIGSK  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  84   SFPCPWYQKVPLSLALSPRIIS  105



>gb|KJB17032.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=490

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP EFYGAKLIGSR
Sbjct  107  KPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPTEFYGAKLIGSR  166

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  167  SFPCPWYQKVPLSLALSPRIIS  188



>ref|XP_008442461.1| PREDICTED: uncharacterized protein LOC103486318 [Cucumis melo]
Length=514

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  105  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPKEFYGAKLIGSR  164

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  165  SFPCPWYQKVPLSLALSPRIIS  186



>ref|XP_011019147.1| PREDICTED: uncharacterized protein LOC105121959 [Populus euphratica]
Length=520

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  114  RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  173

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  174  SFPCPWYQKVPLSLALSPRIIS  195



>gb|KHG08972.1| GDP-mannose-dependent alpha-mannosyltransferase [Gossypium arboreum]
Length=516

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  107  KPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPKEFYGAKLIGSR  166

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  167  SFPCPWYQKVPLSLALSPRIIS  188



>ref|XP_002309122.2| hypothetical protein POPTR_0006s09880g [Populus trichocarpa]
 gb|EEE92645.2| hypothetical protein POPTR_0006s09880g [Populus trichocarpa]
Length=520

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  114  RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  173

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  174  SFPCPWYQKVPLSLALSPRIIS  195



>gb|KJB17030.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=516

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP EFYGAKLIGSR
Sbjct  107  KPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPTEFYGAKLIGSR  166

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  167  SFPCPWYQKVPLSLALSPRIIS  188



>ref|XP_002531354.1| glycosyltransferase, putative [Ricinus communis]
 gb|EEF31038.1| glycosyltransferase, putative [Ricinus communis]
Length=452

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  28   RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  87

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  88   SFPCPWYQKVPLSLALSPRIIS  109



>ref|NP_001266888.1| uncharacterized protein LOC101027242 [Zea mays]
 gb|ACR37973.1| unknown [Zea mays]
 tpg|DAA59316.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=206

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKLIGS 
Sbjct  82   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGSW  141

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII+
Sbjct  142  SFPCPWYQKVPLSLALSPRIIA  163



>ref|XP_007133940.1| hypothetical protein PHAVU_010G005100g [Phaseolus vulgaris]
 gb|ESW05934.1| hypothetical protein PHAVU_010G005100g [Phaseolus vulgaris]
Length=529

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 111/161 (69%), Gaps = 16/161 (10%)
 Frame = +1

Query  223  PTHSLKFSCFSASRAKP---------FCIKSGSLKNRQRPFFVAASSNMtiteyreeeee  375
            P +SL+F+   + R KP         FC   GS   + R      +++MTI E    E  
Sbjct  36   PHNSLRFAYIQSFRPKPIAPFCRKTRFCSLQGSSSAKSRKSLALGTTHMTIAEDSLLEVV  95

Query  376  spp-------pviesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVV  534
                       +++ E  S+PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVV
Sbjct  96   EEDEESPPDFSLLDPESNSRPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVV  155

Query  535  TTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            TTHEGVP+EF+GAKLIGSRSFPCPWY KVPLSLALSPRIIS
Sbjct  156  TTHEGVPKEFHGAKLIGSRSFPCPWYQKVPLSLALSPRIIS  196



>emb|CDX97820.1| BnaC04g41190D [Brassica napus]
Length=441

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGAK+IGS+
Sbjct  24   KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGAKVIGSK  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  84   SFPCPWYQKVPLSLALSPRIIS  105



>ref|XP_006398643.1| hypothetical protein EUTSA_v10013276mg [Eutrema salsugineum]
 gb|ESQ40096.1| hypothetical protein EUTSA_v10013276mg [Eutrema salsugineum]
Length=516

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGAK+IGSR
Sbjct  108  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGAKVIGSR  167

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  168  SFPCPWYQKVPLSLALSPRIIS  189



>ref|XP_002278868.2| PREDICTED: uncharacterized protein LOC100259616 [Vitis vinifera]
Length=519

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  110  RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  169

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  170  SFPCPWYRKVPLSLALSPRIIS  191



>ref|XP_006429312.1| hypothetical protein CICLE_v10011473mg [Citrus clementina]
 gb|ESR42552.1| hypothetical protein CICLE_v10011473mg [Citrus clementina]
 gb|KDO53237.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=526

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  117  RPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  176

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  177  SFPCPWYQKVPLSLALSPRIIS  198



>ref|XP_006480973.1| PREDICTED: uncharacterized protein LOC102615235 [Citrus sinensis]
Length=526

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  117  RPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  176

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  177  SFPCPWYQKVPLSLALSPRIIS  198



>ref|XP_009358856.1| PREDICTED: uncharacterized protein LOC103949460 [Pyrus x bretschneideri]
Length=514

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  103  RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPDEFYGAKLIGSR  162

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  163  SFPCPWYQKVPLSLALSPRIIS  184



>ref|XP_007205049.1| hypothetical protein PRUPE_ppa004263mg [Prunus persica]
 gb|EMJ06248.1| hypothetical protein PRUPE_ppa004263mg [Prunus persica]
Length=519

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  108  RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPDEFYGAKLIGSR  167

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  168  SFPCPWYQKVPLSLALSPRIIS  189



>emb|CDP06508.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALF+EPSPF+YVSGYKNRFQNFIKYLRE+GDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  25   RPRRIALFIEPSPFSYVSGYKNRFQNFIKYLRELGDEVMVVTTHEGVPQEFYGAKLIGSR  84

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  85   SFPCPWYKKVPLSLALSPRIIS  106



>emb|CAN62120.1| hypothetical protein VITISV_037025 [Vitis vinifera]
Length=497

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  27   RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  86

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  87   SFPCPWYRKVPLSLALSPRIIS  108



>emb|CDY40312.1| BnaA10g27560D [Brassica napus]
Length=514

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVP+EFYGAK+IGSR
Sbjct  102  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPQEFYGAKVIGSR  161

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  162  SFPCPWYQKVPLSLALSPRIIS  183



>gb|EYU41861.1| hypothetical protein MIMGU_mgv1a004551mg [Erythranthe guttata]
Length=521

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGA+LIGSR
Sbjct  111  RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAQLIGSR  170

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  171  SFPCPWYQKVPLSLALSPRIIS  192



>ref|XP_011077579.1| PREDICTED: uncharacterized protein LOC105161555 [Sesamum indicum]
Length=520

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/81 (95%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRS  594
            PRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGA+LIGSRS
Sbjct  111  PRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPQEFYGAQLIGSRS  170

Query  595  FPCPWYNKVPLSLALSPRIIS  657
            FPCPWY KVPLSLALSPRIIS
Sbjct  171  FPCPWYQKVPLSLALSPRIIS  191



>ref|XP_004246336.1| PREDICTED: uncharacterized protein LOC101252422 [Solanum lycopersicum]
Length=506

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 116/154 (75%), Gaps = 10/154 (6%)
 Frame = +1

Query  226  THSL-KFSCFSASRAKPFCIKSGSLKN-------RQRPFFVAA--SSNMtiteyreeeee  375
            T SL K SCFS SR  P  + S  +         R+ P    A  SS MTITEYR+EEEE
Sbjct  25   TSSLYKVSCFSTSRTNPIRLISKKITFLLCEKSFRREPINKRALISSKMTITEYRDEEEE  84

Query  376  spppviesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP  555
              PP++      +PRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP
Sbjct  85   EYPPLLLESEMKEPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP  144

Query  556  EEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            EEFYGAKLIGSRSFPCP Y KVPLSLALSPRIIS
Sbjct  145  EEFYGAKLIGSRSFPCPCYAKVPLSLALSPRIIS  178



>ref|XP_009781169.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Nicotiana sylvestris]
Length=508

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLRE+GDEVMVVTTHEGVP+EFYGAKLIGS+
Sbjct  99   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLRELGDEVMVVTTHEGVPQEFYGAKLIGSQ  158

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  159  SFPCPWYRKVPLSLALSPRIIS  180



>ref|XP_007026774.1| Sulfoquinovosyldiacylglycerol 2 [Theobroma cacao]
 gb|EOY07276.1| Sulfoquinovosyldiacylglycerol 2 [Theobroma cacao]
Length=518

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/81 (95%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRS  594
            PRRIALFVEPSPF+YVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSRS
Sbjct  110  PRRIALFVEPSPFSYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLIGSRS  169

Query  595  FPCPWYNKVPLSLALSPRIIS  657
            FPCPWY KVPLSLALSPRIIS
Sbjct  170  FPCPWYQKVPLSLALSPRIIS  190



>ref|XP_004302644.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit [Fragaria vesca subsp. vesca]
Length=505

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVPEEFYGAK IGSR
Sbjct  94   RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPEEFYGAKCIGSR  153

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY  VPLSLALSPRIIS
Sbjct  154  SFPCPWYQNVPLSLALSPRIIS  175



>emb|CDX80782.1| BnaC03g00360D [Brassica napus]
Length=426

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGAK+IGSR
Sbjct  27   KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGAKVIGSR  86

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  87   SFPCPYYQKVPLSLALSPRIIS  108



>ref|XP_010553086.1| PREDICTED: uncharacterized protein LOC104823284 [Tarenaya hassleriana]
Length=518

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EFYGAK+IGSR
Sbjct  110  RPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFYGAKVIGSR  169

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  170  SFPCPWYQKVPLSLALSPRIIS  191



>gb|AAK76635.1| unknown protein [Arabidopsis thaliana]
Length=434

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGA++IGSR
Sbjct  26   KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGARVIGSR  85

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  86   SFPCPYYQKVPLSLALSPRIIS  107



>ref|XP_002870938.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47197.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGAK+IGSR
Sbjct  110  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGAKVIGSR  169

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  170  SFPCPYYQKVPLSLALSPRIIS  191



>emb|CAB69850.1| putative protein [Arabidopsis thaliana]
Length=470

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGA++IGSR
Sbjct  102  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGARVIGSR  161

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  162  SFPCPYYQKVPLSLALSPRIIS  183



>ref|XP_002323560.1| SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein [Populus trichocarpa]
 gb|EEF05321.1| SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein [Populus trichocarpa]
Length=429

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIK+LREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  23   RPRRIALFVEPSPFAYVSGYKNRFQNFIKFLREMGDEVMVVTTHEGVPQEFYGAKLIGSR  82

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFP PWY KVPLSLALSPRIIS
Sbjct  83   SFPFPWYQKVPLSLALSPRIIS  104



>ref|XP_010256624.1| PREDICTED: uncharacterized protein LOC104596978 [Nelumbo nucifera]
Length=509

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/81 (95%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRI LFVEPSPFAYVSGYKNRFQNFIK+LREMGDEVMVVTTHEGVP EFYGAKLIGSR
Sbjct  100  KPRRIVLFVEPSPFAYVSGYKNRFQNFIKHLREMGDEVMVVTTHEGVPREFYGAKLIGSR  159

Query  592  SFPCPWYNKVPLSLALSPRII  654
            SFPCPWY KVPLSLALSPRII
Sbjct  160  SFPCPWYQKVPLSLALSPRII  180



>ref|XP_004137727.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cucumis sativus]
 ref|XP_004156597.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cucumis sativus]
 gb|KGN58788.1| hypothetical protein Csa_3G732460 [Cucumis sativus]
Length=515

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  106  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPKEFYGAKLIGSR  165

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  166  SFPCPLYQKVPLSLALSPRIIS  187



>gb|EPS61329.1| hypothetical protein M569_13468, partial [Genlisea aurea]
Length=204

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            RIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVM VTTHEG+PEEFYGA+L+GSRSFP
Sbjct  7    RIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMAVTTHEGLPEEFYGAQLMGSRSFP  66

Query  601  CPWYNKVPLSLALSPRIIS  657
            CPWY  VPLSLALSPRIIS
Sbjct  67   CPWYQSVPLSLALSPRIIS  85



>ref|XP_009130666.1| PREDICTED: uncharacterized protein LOC103855432 [Brassica rapa]
Length=525

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGAK+IGSR
Sbjct  116  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGAKVIGSR  175

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  176  SFPCPYYQKVPLSLALSPRIIS  197



>ref|XP_010490595.1| PREDICTED: uncharacterized protein LOC104768346 [Camelina sativa]
Length=511

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVP+EFYGAK+IGSR
Sbjct  103  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPDEFYGAKVIGSR  162

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  163  SFPCPYYQKVPLSLALSPRIIS  184



>ref|XP_009370203.1| PREDICTED: uncharacterized protein LOC103959579 [Pyrus x bretschneideri]
Length=512

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  101  RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPDEFYGAKLIGSR  160

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  161  SFPCPLYQKVPLSLALSPRIIS  182



>ref|XP_010909645.1| PREDICTED: uncharacterized protein LOC105035694 [Elaeis guineensis]
Length=544

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKLIGS 
Sbjct  135  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGSW  194

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  195  SFPCPWYQKVPLSLALSPRIIS  216



>gb|KJB76912.1| hypothetical protein B456_012G112200 [Gossypium raimondii]
Length=403

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            K RRIALFVEPSPF+YVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKL+GSR
Sbjct  22   KHRRIALFVEPSPFSYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKLVGSR  81

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY  VPLSLALSPRIIS
Sbjct  82   SFPCPWYQNVPLSLALSPRIIS  103



>ref|XP_008239560.1| PREDICTED: uncharacterized protein LOC103338145 [Prunus mume]
Length=519

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  108  RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPDEFYGAKLIGSR  167

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFP PWY KVPLSLALSPRIIS
Sbjct  168  SFPFPWYQKVPLSLALSPRIIS  189



>ref|XP_010452011.1| PREDICTED: uncharacterized protein LOC104734184 [Camelina sativa]
Length=517

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVP+EFYGAK+IGSR
Sbjct  109  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPDEFYGAKVIGSR  168

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  169  SFPCPYYQKVPLSLALSPRIIS  190



>ref|XP_011047417.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
 ref|XP_011047418.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
 ref|XP_011047419.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
Length=429

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIK+LREMGDEV+VVTTHEGVP+EFYGAKLIGSR
Sbjct  23   RPRRIALFVEPSPFAYVSGYKNRFQNFIKFLREMGDEVLVVTTHEGVPQEFYGAKLIGSR  82

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFP PWY KVPLSLALSPRIIS
Sbjct  83   SFPFPWYQKVPLSLALSPRIIS  104



>ref|NP_568085.2| sulfoquinovosyldiacylglycerol 2 [Arabidopsis thaliana]
 gb|AAM18913.1|AF454354_1 sulfolipid synthase [Arabidopsis thaliana]
 gb|AAO64198.1| unknown protein [Arabidopsis thaliana]
 gb|AED90311.1| sulfoquinovosyldiacylglycerol 2 [Arabidopsis thaliana]
 gb|AHL38652.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=510

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGA++IGSR
Sbjct  102  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGARVIGSR  161

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  162  SFPCPYYQKVPLSLALSPRIIS  183



>emb|CDY11210.1| BnaA03g00460D [Brassica napus]
Length=534

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVPEEFYGAK+IGSR
Sbjct  116  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGAKVIGSR  175

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  176  SFPCPYYQKVPLSLALSPRIIS  197



>ref|XP_008388188.1| PREDICTED: uncharacterized protein LOC103450599 [Malus domestica]
Length=514

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSR
Sbjct  103  RPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPDEFYGAKLIGSR  162

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFP PWY KVPLSLALSPRIIS
Sbjct  163  SFPFPWYQKVPLSLALSPRIIS  184



>ref|XP_006287534.1| hypothetical protein CARUB_v10000742mg [Capsella rubella]
 gb|EOA20432.1| hypothetical protein CARUB_v10000742mg [Capsella rubella]
Length=514

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVP+EFYGAK+IGSR
Sbjct  106  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPDEFYGAKVIGSR  165

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  166  SFPCPYYQKVPLSLALSPRIIS  187



>ref|XP_006657378.1| PREDICTED: uncharacterized protein LOC102710508 [Oryza brachyantha]
Length=471

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+V+TTHEGVP+EFYGAKLIGS 
Sbjct  58   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVITTHEGVPQEFYGAKLIGSW  117

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII 
Sbjct  118  SFPCPWYQKVPLSLALSPRIIG  139



>gb|ABA55726.1| sulfoquinovosyldiacylglycerol synthase type 2 [Vigna unguiculata]
Length=523

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQN IKYLREMGDEVMVVTTHEG P+EF+GAKLIGSR
Sbjct  114  RPRRIALFVEPSPFAYVSGYKNRFQNSIKYLREMGDEVMVVTTHEGAPKEFHGAKLIGSR  173

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  174  SFPCPWYQKVPLSLALSPRIIS  195



>ref|XP_003604630.1| Glycogen synthase [Medicago truncatula]
 gb|AES86827.1| group 1 family glycosyltransferase [Medicago truncatula]
Length=510

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGA+LIGS+
Sbjct  103  KPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPKEFYGAQLIGSK  162

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFP PWY KVPLSLALSPRIIS
Sbjct  163  SFPFPWYQKVPLSLALSPRIIS  184



>ref|XP_008650830.1| PREDICTED: uncharacterized protein LOC100192061 isoform X2 [Zea 
mays]
 gb|ACN35313.1| unknown [Zea mays]
 tpg|DAA59317.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=497

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKLIGS 
Sbjct  82   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGSW  141

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII+
Sbjct  142  SFPCPWYQKVPLSLALSPRIIA  163



>ref|XP_004506782.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cicer arietinum]
Length=512

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 106/154 (69%), Gaps = 13/154 (8%)
 Frame = +1

Query  235  LKFSCFSASRAKPFCIKSGSLKN-------RQRPFFVAASSNMtiteyreeeeesppp--  387
            ++F  F      PFC K   L +       R++ F + AS+ MTI +             
Sbjct  33   IRFGTFREQPITPFCKKVQILSSERLNSVKRRKSFVLEASTKMTIDDDSLLNSRDEEECP  92

Query  388  ----viesevtsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP  555
                + ++E  S+PRRIALFVEPSPF+YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP
Sbjct  93   PDSVLYDTENNSRPRRIALFVEPSPFSYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP  152

Query  556  EEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            +EFYGA LIGS+SFP PWY KVPLSLALSPRIIS
Sbjct  153  KEFYGAHLIGSKSFPFPWYQKVPLSLALSPRIIS  186



>ref|XP_010424824.1| PREDICTED: uncharacterized protein LOC104709996 [Camelina sativa]
Length=666

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTTHEGVP+EFYGAK+IGSR
Sbjct  118  KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPDEFYGAKVIGSR  177

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  178  SFPCPYYQKVPLSLALSPRIIS  199



>ref|XP_009407545.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTHEGVP+EFYGAK+IGS 
Sbjct  98   KPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTTHEGVPQEFYGAKVIGSW  157

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  158  SFPCPWYQKVPLSLALSPRIIS  179



>ref|XP_004987290.1| PREDICTED: uncharacterized protein LOC101765158 [Setaria italica]
Length=486

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKLIGS 
Sbjct  72   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGSW  131

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII 
Sbjct  132  SFPCPWYQKVPLSLALSPRIIG  153



>gb|EYU26645.1| hypothetical protein MIMGU_mgv1a004620mg [Erythranthe guttata]
Length=518

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EF+GA++IGSR
Sbjct  108  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPQEFHGAQIIGSR  167

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  168  SFPCPLYEKVPLSLALSPRIIS  189



>ref|XP_002459190.1| hypothetical protein SORBIDRAFT_02g000240 [Sorghum bicolor]
 gb|EER95711.1| hypothetical protein SORBIDRAFT_02g000240 [Sorghum bicolor]
Length=500

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKLIGS 
Sbjct  83   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGSW  142

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII 
Sbjct  143  SFPCPWYQKVPLSLALSPRIIG  164



>gb|EEE66415.1| hypothetical protein OsJ_22761 [Oryza sativa Japonica Group]
Length=443

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRF NFIKYLREMGDEV+V+TTHEGVP+EFYGAKLIGS 
Sbjct  66   RPRRIALFVEPSPFAYVSGYKNRFLNFIKYLREMGDEVIVITTHEGVPQEFYGAKLIGSW  125

Query  592  SFPCPWYNKVPLSLALSPRII  654
            SFPCPWY KVPLSLALSPRII
Sbjct  126  SFPCPWYQKVPLSLALSPRII  146



>ref|XP_008800789.1| PREDICTED: uncharacterized protein LOC103715059 [Phoenix dactylifera]
Length=503

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTH+GVP+EF+GAKLIGS 
Sbjct  94   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHKGVPQEFHGAKLIGSW  153

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  154  SFPCPWYQKVPLSLALSPRIIS  175



>ref|XP_003561543.1| PREDICTED: uncharacterized protein LOC100842407 isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP EF+GAKL+GS 
Sbjct  73   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPAEFHGAKLVGSW  132

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWYNKVPLSLALSPRII 
Sbjct  133  SFPCPWYNKVPLSLALSPRIIG  154



>gb|EMS55944.1| GDP-mannose-dependent alpha-mannosyltransferase [Triticum urartu]
Length=493

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+V+TTHEGVP+EF+GAKLIGS 
Sbjct  84   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVITTHEGVPDEFHGAKLIGSW  143

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII 
Sbjct  144  SFPCPWYQKVPLSLALSPRIIG  165



>dbj|BAJ85864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+V+TTHEGVP+EF+GAKLIGS 
Sbjct  84   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVITTHEGVPDEFHGAKLIGSW  143

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII 
Sbjct  144  SFPCPWYQKVPLSLALSPRIIG  165



>gb|EMT15547.1| Putative glycosyltransferase [Aegilops tauschii]
Length=509

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+V+TTHEGVP+EF+GAKLIGS 
Sbjct  82   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVITTHEGVPDEFHGAKLIGSW  141

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII 
Sbjct  142  SFPCPWYQKVPLSLALSPRIIG  163



>ref|XP_010228495.1| PREDICTED: uncharacterized protein LOC100842407 isoform X1 [Brachypodium 
distachyon]
Length=507

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP EF+GAKL+GS 
Sbjct  73   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPAEFHGAKLVGSW  132

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWYNKVPLSLALSPRII 
Sbjct  133  SFPCPWYNKVPLSLALSPRIIG  154



>dbj|BAD31817.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 dbj|BAE79759.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 dbj|BAG89787.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRF NFIKYLREMGDEV+V+TTHEGVP+EFYGAKLIGS 
Sbjct  66   RPRRIALFVEPSPFAYVSGYKNRFLNFIKYLREMGDEVIVITTHEGVPQEFYGAKLIGSW  125

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRII 
Sbjct  126  SFPCPWYQKVPLSLALSPRIIG  147



>gb|KFK44566.1| hypothetical protein AALP_AA1G274200 [Arabis alpina]
Length=507

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+VVTT EGVPEEFYGAK+IGS+
Sbjct  99   KPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTQEGVPEEFYGAKVIGSK  158

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP+Y KVPLSLALSPRIIS
Sbjct  159  SFPCPFYQKVPLSLALSPRIIS  180



>ref|XP_008650829.1| PREDICTED: uncharacterized protein LOC100192061 isoform X1 [Zea 
mays]
Length=498

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 80/83 (96%), Gaps = 1/83 (1%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGS-  588
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKLIGS 
Sbjct  82   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGSW  141

Query  589  RSFPCPWYNKVPLSLALSPRIIS  657
             SFPCPWY KVPLSLALSPRII+
Sbjct  142  SSFPCPWYQKVPLSLALSPRIIA  164



>gb|KHN24299.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=437

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+ LREMGDEVMVVTTHEGVP+EFYGAKLIGS 
Sbjct  28   RPRRIALFVEPSPFAYVSGYKNRFQNFIRCLREMGDEVMVVTTHEGVPQEFYGAKLIGSW  87

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  88   SFPCPLYQKVPLSLALSPRIIS  109



>ref|XP_003552228.1| PREDICTED: uncharacterized protein LOC100807850 isoform X1 [Glycine 
max]
Length=515

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 100/144 (69%), Gaps = 7/144 (5%)
 Frame = +1

Query  235  LKFSCFSASRAKPFCIKSGSLKNRQRPFFVAASSNMtiteyreeeees---pppviesev  405
            +  SC    R    C   GS     R  FV  + NMT+ E    EE          E+E 
Sbjct  48   ISLSC----RGTRLCFLKGSKTLWGRKSFVLGAGNMTMAEVDSHEEGENEGALVGSENEN  103

Query  406  tsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIG  585
             S+PRRIALFVEPSPFAYVSGYKNRFQNFI+ LREMGDEVMVVTTHEGVP+EFYGAKLIG
Sbjct  104  NSRPRRIALFVEPSPFAYVSGYKNRFQNFIRCLREMGDEVMVVTTHEGVPQEFYGAKLIG  163

Query  586  SRSFPCPWYNKVPLSLALSPRIIS  657
            S SFPCP Y KVPLSLALSPRIIS
Sbjct  164  SWSFPCPLYQKVPLSLALSPRIIS  187



>ref|XP_006602643.1| PREDICTED: uncharacterized protein LOC100807850 isoform X2 [Glycine 
max]
Length=543

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 100/144 (69%), Gaps = 7/144 (5%)
 Frame = +1

Query  235  LKFSCFSASRAKPFCIKSGSLKNRQRPFFVAASSNMtiteyreeeees---pppviesev  405
            +  SC    R    C   GS     R  FV  + NMT+ E    EE          E+E 
Sbjct  48   ISLSC----RGTRLCFLKGSKTLWGRKSFVLGAGNMTMAEVDSHEEGENEGALVGSENEN  103

Query  406  tsKPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIG  585
             S+PRRIALFVEPSPFAYVSGYKNRFQNFI+ LREMGDEVMVVTTHEGVP+EFYGAKLIG
Sbjct  104  NSRPRRIALFVEPSPFAYVSGYKNRFQNFIRCLREMGDEVMVVTTHEGVPQEFYGAKLIG  163

Query  586  SRSFPCPWYNKVPLSLALSPRIIS  657
            S SFPCP Y KVPLSLALSPRIIS
Sbjct  164  SWSFPCPLYQKVPLSLALSPRIIS  187



>ref|XP_010558362.1| PREDICTED: uncharacterized protein LOC104827042 [Tarenaya hassleriana]
Length=518

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPF+Y+SGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAK+IGSR
Sbjct  110  RPRRIALFVEPSPFSYISGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKVIGSR  169

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRIIS
Sbjct  170  SFPCPLYQNVPLSLALSPRIIS  191



>ref|XP_009409491.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit [Musa acuminata subsp. malaccensis]
Length=438

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRS  594
            PRRIALFVEPSPFAYVSGYKNRFQNFIK LREMGDEV+VVT HEGVP+EF+GAK+IGS S
Sbjct  30   PRRIALFVEPSPFAYVSGYKNRFQNFIKNLREMGDEVIVVTNHEGVPQEFHGAKVIGSWS  89

Query  595  FPCPWYNKVPLSLALSPRIIS  657
            FPCPWY KVPLSLALSPRIIS
Sbjct  90   FPCPWYQKVPLSLALSPRIIS  110



>ref|XP_007140380.1| hypothetical protein PHAVU_008G106900g [Phaseolus vulgaris]
 gb|ESW12374.1| hypothetical protein PHAVU_008G106900g [Phaseolus vulgaris]
Length=504

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFI+ LREMGDEVMVVTTHEGVP+EF+GAKLIGS 
Sbjct  97   RPRRIALFVEPSPFAYVSGYKNRFQNFIRCLREMGDEVMVVTTHEGVPQEFHGAKLIGSW  156

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  157  SFPCPLYQKVPLSLALSPRIIS  178



>ref|XP_004968167.1| PREDICTED: uncharacterized protein LOC101764078 [Setaria italica]
Length=437

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVPEEF+GAK+IGS 
Sbjct  25   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPEEFHGAKVIGSW  84

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  85   SFPCPMYGKVPLSLALSPRIIS  106



>gb|AES79437.2| group 1 family glycosyltransferase [Medicago truncatula]
Length=515

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIK LREMGDEV+VVTTH+GVP+EFYGAKLIGS 
Sbjct  106  RPRRIALFVEPSPFAYVSGYKNRFQNFIKCLREMGDEVLVVTTHKGVPQEFYGAKLIGSW  165

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFP PWY  VPLSLALSPRIIS
Sbjct  166  SFPLPWYQNVPLSLALSPRIIS  187



>ref|XP_003623219.1| Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit 
[Medicago truncatula]
Length=539

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAYVSGYKNRFQNFIK LREMGDEV+VVTTH+GVP+EFYGAKLIGS 
Sbjct  106  RPRRIALFVEPSPFAYVSGYKNRFQNFIKCLREMGDEVLVVTTHKGVPQEFYGAKLIGSW  165

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFP PWY  VPLSLALSPRIIS
Sbjct  166  SFPLPWYQNVPLSLALSPRIIS  187



>gb|EAY72486.1| hypothetical protein OsI_00342 [Oryza sativa Indica Group]
Length=436

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  24   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  84   SFPCPMYGKVPLSLALSPRIIS  105



>gb|EMT15719.1| Putative glycosyltransferase [Aegilops tauschii]
Length=410

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  25   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  84

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  85   SFPCPLYGKVPLSLALSPRIIS  106



>ref|NP_001041991.1| Os01g0142300 [Oryza sativa Japonica Group]
 dbj|BAD61068.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61477.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF03905.1| Os01g0142300 [Oryza sativa Japonica Group]
 gb|EEE53847.1| hypothetical protein OsJ_00324 [Oryza sativa Japonica Group]
Length=436

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  24   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  84   SFPCPMYGKVPLSLALSPRIIS  105



>ref|XP_006643739.1| PREDICTED: uncharacterized protein LOC102711739 [Oryza brachyantha]
Length=437

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  25   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  84

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  85   SFPCPMYGKVPLSLALSPRIIS  106



>emb|CDM81044.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  26   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  85

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  86   SFPCPLYGKVPLSLALSPRIIS  107



>ref|XP_003568443.1| PREDICTED: uncharacterized protein LOC100832140 [Brachypodium 
distachyon]
Length=439

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  26   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  85

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  86   SFPCPLYGKVPLSLALSPRIIS  107



>gb|EMS60261.1| GDP-mannose-dependent alpha-mannosyltransferase [Triticum urartu]
Length=591

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  205  RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  264

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  265  SFPCPLYGKVPLSLALSPRIIS  286



>ref|XP_002457385.1| hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
 gb|EES02505.1| hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
Length=430

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  18   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  77

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  78   SFPCPMYGKVPLSLALSPRIIS  99



>ref|NP_001144658.1| uncharacterized protein LOC100277683 [Zea mays]
 gb|ACG42115.1| hypothetical protein [Zea mays]
Length=437

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRR+ALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVT HEGVP+EF+GAK+IGS 
Sbjct  25   RPRRVALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVIVVTNHEGVPQEFHGAKVIGSW  84

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y KVPLSLALSPRIIS
Sbjct  85   SFPCPMYGKVPLSLALSPRIIS  106



>ref|XP_008653982.1| PREDICTED: uncharacterized protein LOC103634168 [Zea mays]
 tpg|DAA44537.1| TPA: hypothetical protein ZEAMMB73_879639 [Zea mays]
Length=429

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  24   KPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  84   SFPCPLYQNVPLSLALSPRIFS  105



>ref|XP_002468134.1| hypothetical protein SORBIDRAFT_01g040150 [Sorghum bicolor]
 gb|EER95132.1| hypothetical protein SORBIDRAFT_01g040150 [Sorghum bicolor]
Length=414

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  24   KPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  84   SFPCPLYQNVPLSLALSPRIFS  105



>gb|ACN34235.1| unknown [Zea mays]
 gb|AFW88879.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  24   KPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  84   SFPCPLYQNVPLSLALSPRIFS  105



>gb|ACG31912.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  24   KPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  84   SFPCPLYQNVPLSLALSPRIFS  105



>ref|NP_001150015.1| glycosyl transferase, group 1 family protein [Zea mays]
 gb|ACG37508.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  24   KPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  84   SFPCPLYQNVPLSLALSPRIFS  105



>ref|XP_002968644.1| UDP-sulfoquinovose: alpha-diacylglycerol-sulfoquinovosyltransferase 
[Selaginella moellendorffii]
 gb|EFJ29760.1| UDP-sulfoquinovose: alpha-diacylglycerol-sulfoquinovosyltransferase 
[Selaginella moellendorffii]
Length=514

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRS  594
            PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDEV+++TTHEGVP EF+GAK+IGS S
Sbjct  102  PRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVLIITTHEGVPTEFHGAKVIGSWS  161

Query  595  FPCPWYNKVPLSLALSPRIIS  657
            FPCP+Y  VPLSLALSPRIIS
Sbjct  162  FPCPFYKLVPLSLALSPRIIS  182



>tpg|DAA44536.1| TPA: hypothetical protein ZEAMMB73_879639 [Zea mays]
Length=404

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  24   KPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  84   SFPCPLYQNVPLSLALSPRIFS  105



>ref|XP_004984689.1| PREDICTED: uncharacterized protein LOC101779471 [Setaria italica]
Length=413

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +PRRIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  24   RPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  83

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  84   SFPCPLYQNVPLSLALSPRIFS  105



>ref|XP_009122830.1| PREDICTED: uncharacterized protein LOC103847496 [Brassica rapa]
Length=539

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 80/110 (73%), Gaps = 28/110 (25%)
 Frame = +1

Query  412  KPRRIALFVEPSPF----------------------------AYVSGYKNRFQNFIKYLR  507
            KPRRIALFVEPSPF                             YVSGYKNRFQNFI+YLR
Sbjct  102  KPRRIALFVEPSPFFSIQTCLCLLCVRRNVSVIQCWAFDAEIYYVSGYKNRFQNFIRYLR  161

Query  508  EMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            EMGDEV+VVTTHEGVP+EFYGAK+IGSRSFPCPWY KVPLSLALSPRIIS
Sbjct  162  EMGDEVIVVTTHEGVPQEFYGAKVIGSRSFPCPWYQKVPLSLALSPRIIS  211



>ref|XP_003558286.1| PREDICTED: uncharacterized protein LOC100846446 [Brachypodium 
distachyon]
Length=420

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +P RIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  30   RPHRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  89

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  90   SFPCPLYQNVPLSLALSPRIFS  111



>ref|XP_006649799.1| PREDICTED: uncharacterized protein LOC102700221 [Oryza brachyantha]
Length=417

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +P RIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  27   RPHRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  86

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  87   SFPCPLYQNVPLSLALSPRIFS  108



>dbj|BAJ91585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +P RIALFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  25   RPHRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  84

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  85   SFPCPLYQNVPLSLALSPRIFS  106



>gb|EAY89357.1| hypothetical protein OsI_10861 [Oryza sativa Indica Group]
Length=415

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +P RI LFVEPSPFAY+SGYKNRFQNFIK+LREMGDEV+VVTTH+G PEEF+GAK+IGS 
Sbjct  25   RPHRIVLFVEPSPFAYISGYKNRFQNFIKHLREMGDEVLVVTTHKGAPEEFHGAKVIGSW  84

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  85   SFPCPLYQNVPLSLALSPRIFS  106



>ref|XP_001766232.1| predicted protein [Physcomitrella patens]
 gb|EDQ68864.1| predicted protein [Physcomitrella patens]
Length=457

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRR+ LFVEPSPF+Y+SGYKNR+QNFI+YLRE+GDEV+VVTTH GVP EFYGAK+IGS 
Sbjct  54   KPRRVVLFVEPSPFSYISGYKNRYQNFIRYLRELGDEVLVVTTHHGVPAEFYGAKVIGSW  113

Query  592  SFPCPWYNKVPLSLALSPRI  651
            SFP PWY  VP+SLALSPRI
Sbjct  114  SFPLPWYKAVPMSLALSPRI  133



>ref|NP_001049645.1| Os03g0265100 [Oryza sativa Japonica Group]
 gb|AAP06834.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 gb|ABF95130.1| glycosyl transferase, group 1 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11559.1| Os03g0265100 [Oryza sativa Japonica Group]
 gb|EAZ26361.1| hypothetical protein OsJ_10243 [Oryza sativa Japonica Group]
 dbj|BAG97169.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +P RI LFVEPSPFAY+SGYKNRFQNFIK+LREMGDE++VVTTH+G PEEF+GAK+IGS 
Sbjct  25   RPHRIVLFVEPSPFAYISGYKNRFQNFIKHLREMGDEMLVVTTHKGAPEEFHGAKVIGSW  84

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCP Y  VPLSLALSPRI S
Sbjct  85   SFPCPLYQNVPLSLALSPRIFS  106



>ref|XP_001756850.1| predicted protein [Physcomitrella patens]
 gb|EDQ78447.1| predicted protein [Physcomitrella patens]
Length=472

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 94/138 (68%), Gaps = 6/138 (4%)
 Frame = +1

Query  238  KFSCFSASRAKPFCIKSGSLKNRQRPFFVAASSNMtiteyreeeeespppviesevtsKP  417
            KF  FS   +  F +K   + N    F V+ASS         + + S       E   KP
Sbjct  17   KFGLFSTVNSS-FSLKGKQVANGN--FLVSASSE---AFVTTDVKSSEQEEFAKEWAHKP  70

Query  418  RRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSF  597
            RR+ LFVEPSPF+Y+SGYKNR+QNFI+YLR++GDEV+VVTTH GVP+EF+GAK+IGS SF
Sbjct  71   RRVVLFVEPSPFSYISGYKNRYQNFIRYLRQLGDEVLVVTTHHGVPDEFHGAKVIGSWSF  130

Query  598  PCPWYNKVPLSLALSPRI  651
            P PWY  VP+SLALSPRI
Sbjct  131  PLPWYKAVPMSLALSPRI  148



>gb|KCW88121.1| hypothetical protein EUGRSUZ_A00516 [Eucalyptus grandis]
Length=422

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/67 (97%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = +1

Query  457  YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLA  636
            YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVP+EFYGAKLIGSRSFPCPWY KVPLSLA
Sbjct  28   YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPWYQKVPLSLA  87

Query  637  LSPRIIS  657
            LSPRIIS
Sbjct  88   LSPRIIS  94



>ref|XP_008370134.1| PREDICTED: uncharacterized protein LOC103433646, partial [Malus 
domestica]
Length=422

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/67 (94%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  457  YVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLA  636
            YVSGYKNRFQNFI+YLREMGDEVMVVTTHEGVP+EFYGAKLIGSRSFPCP Y KVPLSLA
Sbjct  26   YVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPLYQKVPLSLA  85

Query  637  LSPRIIS  657
            LSPRIIS
Sbjct  86   LSPRIIS  92



>emb|CDY21645.1| BnaC09g46470D [Brassica napus]
Length=223

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  466  GYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSP  645
            GYKNRFQNFI+YL EMGDEV+VVTTHEGVPEEFYGAK+IGSRSFPCPWY KVPLSLALSP
Sbjct  78   GYKNRFQNFIRYLPEMGDEVIVVTTHEGVPEEFYGAKVIGSRSFPCPWYQKVPLSLALSP  137

Query  646  RIIS  657
            RIIS
Sbjct  138  RIIS  141



>gb|EMT15626.1| Lipopolysaccharide core biosynthesis glycosyltransferase lpsE 
[Aegilops tauschii]
Length=437

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 75/110 (68%), Gaps = 28/110 (25%)
 Frame = +1

Query  412  KPRRIALFVEPSPFA----------------------------YVSGYKNRFQNFIKYLR  507
            +P RIALFVEPSPFA                            Y+SGYKNRFQNFIK+LR
Sbjct  19   RPHRIALFVEPSPFASVSLLPPSLFLLLPTQVLKHKALAGLQYYISGYKNRFQNFIKHLR  78

Query  508  EMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            EMGDEV+VVTTH+G PEEF+GAK+IGS SFPCP Y  VPLSLALSPRI S
Sbjct  79   EMGDEVLVVTTHKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFS  128



>emb|CDX82174.1| BnaC02g21160D [Brassica napus]
Length=240

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  466  GYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSP  645
            GYKNRFQNFI+YL EMGD+V+VVTTHEGVPEEFYGAK+IGSRSFPCPWY KVP SLALSP
Sbjct  17   GYKNRFQNFIRYLPEMGDKVIVVTTHEGVPEEFYGAKVIGSRSFPCPWYQKVPPSLALSP  76

Query  646  RIIS  657
            RIIS
Sbjct  77   RIIS  80



>tpg|DAA59318.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=175

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGS  588
            +PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV+VVTTHEGVP+EF+GAKLIGS
Sbjct  82   RPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVIVVTTHEGVPQEFHGAKLIGS  140



>ref|XP_002953985.1| hypothetical protein VOLCADRAFT_82536 [Volvox carteri f. nagariensis]
 gb|EFJ45014.1| hypothetical protein VOLCADRAFT_82536 [Volvox carteri f. nagariensis]
Length=543

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 62/92 (67%), Gaps = 13/92 (14%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV-------------P  555
            PRR+ +FVEPSPF YVSGYKNRF   IKYL E G EV+VVTT +G              P
Sbjct  119  PRRVCIFVEPSPFTYVSGYKNRFTTMIKYLVEAGCEVLVVTTGKGFTLPSVDSSSFCDQP  178

Query  556  EEFYGAKLIGSRSFPCPWYNKVPLSLALSPRI  651
            E F GA+++ + SF CPWY +VPLS ALSPRI
Sbjct  179  ETFCGARVVSALSFGCPWYLQVPLSFALSPRI  210



>ref|XP_010031046.1| PREDICTED: uncharacterized protein LOC104420932 [Eucalyptus grandis]
Length=377

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  511  MGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            MGDEVMVVTTHEGVP+EFYGAKLIGSRSFPCPWY KVPLSLALSPRIIS
Sbjct  1    MGDEVMVVTTHEGVPDEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIIS  49



>gb|KDO53238.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=377

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  511  MGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            MGDEVMVVTTHEGVP+EFYGAKLIGSRSFPCPWY KVPLSLALSPRIIS
Sbjct  1    MGDEVMVVTTHEGVPQEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIIS  49



>ref|XP_009593273.1| PREDICTED: uncharacterized protein LOC104089958 isoform X2 [Nicotiana 
tomentosiformis]
Length=376

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  511  MGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            MGDEVMVVTTHEGVP+EFYGAKLIGS SFPCPWY KVPLSLALSPRIIS
Sbjct  1    MGDEVMVVTTHEGVPQEFYGAKLIGSLSFPCPWYQKVPLSLALSPRIIS  49



>ref|XP_011047421.1| PREDICTED: uncharacterized protein LOC105141768 isoform X3 [Populus 
euphratica]
Length=374

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  511  MGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            MGDEV+VVTTHEGVP+EFYGAKLIGSRSFP PWY KVPLSLALSPRIIS
Sbjct  1    MGDEVLVVTTHEGVPQEFYGAKLIGSRSFPFPWYQKVPLSLALSPRIIS  49



>gb|KEH28856.1| group 1 family glycosyltransferase [Medicago truncatula]
Length=375

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  511  MGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            MGDEVMVVTTHEGVP+EFYGA+LIGS+SFP PWY KVPLSLALSPRIIS
Sbjct  1    MGDEVMVVTTHEGVPKEFYGAQLIGSKSFPFPWYQKVPLSLALSPRIIS  49



>ref|XP_011396666.1| GDP-mannose-dependent alpha-mannosyltransferase [Auxenochlorella 
protothecoides]
 gb|KFM23788.1| GDP-mannose-dependent alpha-mannosyltransferase [Auxenochlorella 
protothecoides]
Length=416

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 9/88 (10%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV---------PEEFY  567
            P+RI + VEPSPF YV GY NR++N I+YL+E+G EV++VT  + V         PEEF 
Sbjct  7    PKRICILVEPSPFTYVCGYMNRYRNTIRYLKELGCEVLIVTPGKSVASTDDSQRQPEEFC  66

Query  568  GAKLIGSRSFPCPWYNKVPLSLALSPRI  651
            GAK++ + SF  PWY K+PL+  LSPRI
Sbjct  67   GAKVVEAMSFAFPWYAKLPLTFGLSPRI  94



>gb|ABC24951.1| plastid sulfolipid synthase [Prototheca wickerhamii]
Length=175

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 9/81 (11%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV---------PEEFY  567
            PRR+   VEPSPF YVSGY NR++N I+YL E+G EV++VT  +GV         P E+ 
Sbjct  95   PRRVCFLVEPSPFTYVSGYMNRYRNTIRYLVELGCEVLIVTPGKGVAPGMEGQAQPREYC  154

Query  568  GAKLIGSRSFPCPWYNKVPLS  630
            GAK++ + SFP PWY K+PLS
Sbjct  155  GAKVVEALSFPLPWYRKLPLS  175



>gb|KJB17031.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
 gb|KJB17035.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=372

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  526  MVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            MVVTTHEGVP EFYGAKLIGSRSFPCPWY KVPLSLALSPRIIS
Sbjct  1    MVVTTHEGVPTEFYGAKLIGSRSFPCPWYQKVPLSLALSPRIIS  44



>gb|KIY98280.1| sulfoquinovosyltransferase [Monoraphidium neglectum]
Length=549

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 56/89 (63%), Gaps = 10/89 (11%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV----------PEEF  564
            P+RI LFVEPSPF Y SGY+ RF   IK + E G +V+V+T   G           P EF
Sbjct  137  PKRIVLFVEPSPFTYTSGYQTRFLATIKEMVEAGCDVLVITPGRGAAGLLPGGKEQPAEF  196

Query  565  YGAKLIGSRSFPCPWYNKVPLSLALSPRI  651
             GA+++ + SFPCP Y  VPLSL LSPRI
Sbjct  197  AGARVVEAGSFPCPGYGTVPLSLGLSPRI  225



>ref|XP_011047420.1| PREDICTED: uncharacterized protein LOC105141768 isoform X2 [Populus 
euphratica]
Length=424

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  520  EVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            +V+VVTTHEGVP+EFYGAKLIGSRSFP PWY KVPLSLALSPRIIS
Sbjct  54   QVLVVTTHEGVPQEFYGAKLIGSRSFPFPWYQKVPLSLALSPRIIS  99



>ref|XP_001421416.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 ref|XP_001421447.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99709.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99740.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=456

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  418  RRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSF  597
            RR+A+FVEPSPF++VSG KNRF   I+ LREMGD+V+V+T     P+E++GAK+IG R F
Sbjct  82   RRVAIFVEPSPFSHVSGMKNRFLRLIENLREMGDDVVVITPDRDPPKEYHGAKVIGLRGF  141

Query  598  PCPWYNKVPL--SLALSPRI  651
              P+Y    L  S  L  R+
Sbjct  142  VLPFYGTDTLLCSFGLDGRV  161



>ref|XP_003083256.1| sulfolipid synthase (ISS), partial [Ostreococcus tauri]
Length=573

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            K RR+A+FVEPSPF++VSG KNRF   I+ LREMGD+V+V+T     P E++GAK+IG R
Sbjct  76   KKRRVAIFVEPSPFSHVSGMKNRFLRLIENLREMGDDVVVITPDRNPPAEYHGAKVIGLR  135

Query  592  SFPCPWYNKVPL  627
             F  P+Y    L
Sbjct  136  GFVLPFYGTDTL  147



>ref|XP_006583630.1| PREDICTED: uncharacterized protein LOC100804237 [Glycine max]
Length=366

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  526  MVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            MVVTTHEGVP+EFYGAKLIGS SFPCP Y KVPLSLALSPRIIS
Sbjct  1    MVVTTHEGVPQEFYGAKLIGSWSFPCPLYQKVPLSLALSPRIIS  44



>emb|CDX75469.1| BnaA01g02330D [Brassica napus]
Length=91

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  511  MGDEVMVVTTHEGVPEEFYGAKLIGSRSFPCPWYNKVPLSLALSPRIIS  657
            MGD +  + + EGVPEEFYGAK+IGSRSFPCPWY KVPL LALSPRIIS
Sbjct  1    MGDGIEEIES-EGVPEEFYGAKVIGSRSFPCPWYQKVPLLLALSPRIIS  48



>emb|CEG01736.1| Glycosyl transferase, family 1 [Ostreococcus tauri]
Length=756

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            K RR+A+FVEPSPF++VSG KNRF   I+ LREMGD+V+V+T     P E++GAK+IG R
Sbjct  79   KKRRVAIFVEPSPFSHVSGMKNRFLRLIENLREMGDDVVVITPDRNPPAEYHGAKVIGLR  138

Query  592  SFPCPWY  612
             F  P+Y
Sbjct  139  GFVLPFY  145



>ref|XP_003057606.1| glycosyltransferase family 4 protein [Micromonas pusilla CCMP1545]
 gb|EEH57557.1| glycosyltransferase family 4 protein [Micromonas pusilla CCMP1545]
Length=769

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRS  594
            PRRI +FVEPSPF++VSG KNRF   I+ L E+GD+V+V+T     P E+ GA++IG   
Sbjct  102  PRRIVVFVEPSPFSHVSGMKNRFLRLIENLTELGDDVVVITPDRNPPAEYAGAEVIGLHG  161

Query  595  FPCPWY--NKVPLSLALSPRI  651
            F  P+Y  N + LS A  PR+
Sbjct  162  FALPFYPGNTLLLSYARDPRV  182



>ref|XP_005644605.1| UDP-Glycosyltransferase/glycogen phosphorylase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20061.1| UDP-Glycosyltransferase/glycogen phosphorylase [Coccomyxa subellipsoidea 
C-169]
Length=487

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +1

Query  418  RRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSF  597
            ++IA+FVEPSPF++VSG K RF N IK LR++GD+VMVVT     P+ F+GAK++    F
Sbjct  77   KKIAIFVEPSPFSHVSGMKIRFSNLIKGLRQLGDDVMVVTPCINPPKTFHGAKVVNVLGF  136

Query  598  PCPWYN--KVPLSLALSPRII  654
              P+Y    + LSL LS R++
Sbjct  137  SLPFYRSPTLLLSLGLSVRVL  157



>gb|KIZ01145.1| hypothetical protein MNEG_6812, partial [Monoraphidium neglectum]
Length=94

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  418  RRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAK  576
            R++A+FVEPSPF+++SG KNRF++ IK LRE GDEVMVVT     P+EF GAK
Sbjct  42   RKVAIFVEPSPFSHISGMKNRFESLIKGLREAGDEVMVVTPDPTPPKEFCGAK  94



>ref|XP_010101801.1| GDP-mannose-dependent alpha-mannosyltransferase [Morus notabilis]
 gb|EXB89938.1| GDP-mannose-dependent alpha-mannosyltransferase [Morus notabilis]
Length=337

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDE  522
            PRRIALFVEPSPFAYVSGYKNRFQNFI+YLREMGDE
Sbjct  26   PRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDE  61



>ref|XP_005843576.1| hypothetical protein CHLNCDRAFT_33086 [Chlorella variabilis]
 gb|EFN51474.1| hypothetical protein CHLNCDRAFT_33086 [Chlorella variabilis]
Length=413

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 13/86 (15%)
 Frame = +1

Query  433  FVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV-------------PEEFYGA  573
             VEPSPF YV GY NR++N I++L E G +V+VVT   G+             P EF+GA
Sbjct  1    MVEPSPFTYVCGYMNRYRNTIRFLTEAGVDVLVVTPGPGMTAPGIDFSAACEQPAEFHGA  60

Query  574  KLIGSRSFPCPWYNKVPLSLALSPRI  651
            +++ + SF  PWY  +PLS  LSPRI
Sbjct  61   RVVQAFSFGLPWYLSLPLSFGLSPRI  86



>ref|XP_001699258.1| sulfolipid synthase [Chlamydomonas reinhardtii]
 gb|EDO98898.1| sulfolipid synthase, partial [Chlamydomonas reinhardtii]
Length=395

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  424  IALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFPC  603
            +ALFVEPSPF+++SG KNRFQ  I+ LRE GDEV V T     P E++GA+++G   F  
Sbjct  1    VALFVEPSPFSHISGMKNRFQCLIRNLREAGDEVRVFTPDPHAPSEYHGARVVGVLGFKL  60

Query  604  PWYN--KVPLSLALSPRII  654
            P+Y+   + LSL LS  ++
Sbjct  61   PFYSSPTLLLSLGLSVNVL  79



>ref|XP_007514956.1| SqdX [Bathycoccus prasinos]
 emb|CCO15196.1| SqdX [Bathycoccus prasinos]
Length=865

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = +1

Query  418  RRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSF  597
            R++A+FVEPSPF +VSG KNRF   I+ L E+GDEV+V+T     PEE+ G K+IG +  
Sbjct  141  RKVAIFVEPSPFTHVSGMKNRFLRLIENLAELGDEVVVITPCVDPPEEYCGCKVIGVKGI  200

Query  598  PCPWY--NKVPLSLALSPRI  651
              P+Y  + + LS  LS R+
Sbjct  201  VLPFYGTDTLLLSTGLSGRV  220



>ref|XP_005715110.1| unnamed protein product [Chondrus crispus]
 emb|CDF35291.1| unnamed protein product [Chondrus crispus]
Length=474

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 2/77 (3%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT--THEGVPEEFYGAKLIGS  588
            PRRIAL VEPSPF + SGY NRF+N +  LR+ GD V+V+        P EF GAK++  
Sbjct  56   PRRIALMVEPSPFTHTSGYSNRFKNLLLQLRDAGDSVLVIVPDNDPDAPTEFAGAKIVNV  115

Query  589  RSFPCPWYNKVPLSLAL  639
              F  P Y+++ L+L L
Sbjct  116  PGFRFPLYHRITLTLGL  132



>gb|KIZ02980.1| sulfoquinovosyltransferase [Monoraphidium neglectum]
Length=430

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            ++A+FVEPSPF ++SG KNRF++ I  LRE+GD V+VVT     P+ F+GA++IG   F 
Sbjct  2    KVAIFVEPSPFTHISGLKNRFESLIHGLREVGDSVLVVTPDPAPPKHFFGAEVIGVWGFR  61

Query  601  CPWYNKVPLSLA  636
             P YN   L L+
Sbjct  62   PPLYNSPTLLLS  73



>ref|XP_002501927.1| glycosyltransferase family 4 protein [Micromonas sp. RCC299]
 gb|ACO63185.1| glycosyltransferase family 4 protein [Micromonas sp. RCC299]
Length=763

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +1

Query  418  RRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSF  597
            +RI +FVEPSPF++VSG KNRF   I+ L E+GD+V+VVT     P+ + GA++IG   F
Sbjct  87   KRICIFVEPSPFSHVSGMKNRFLRLIENLVELGDDVVVVTPDRNPPQTYAGAEVIGVHGF  146

Query  598  PCPWY--NKVPLSLALSPRI  651
              P+Y  + +  S A  PR+
Sbjct  147  NLPFYMMDTLLFSYAKDPRV  166



>ref|XP_005538341.1| sulfoquinovosyldiacylglycerol biosynthesis protein [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82305.1| sulfoquinovosyldiacylglycerol biosynthesis protein [Cyanidioschyzon 
merolae strain 10D]
Length=517

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +1

Query  418  RRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHE--GVPEEFYGAKLIGSR  591
            RR+ L VEP+PF +VSGY NRF   ++YL+E GDEV+++T       P+E +G  +I  R
Sbjct  98   RRVCLVVEPTPFTHVSGYSNRFNELLRYLKEAGDEVLIITPDNSPDAPQEVFGYPVITIR  157

Query  592  SFPCPWYNKVPLSLALSPRII  654
             F    Y ++ LS+     ++
Sbjct  158  GFKFALYPRITLSIGFGSGMV  178



>gb|EJK62906.1| hypothetical protein THAOC_16464 [Thalassiosira oceanica]
Length=482

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 5/80 (6%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTH-----EGVPEEFYGAKL  579
            PR+IAL VEP+PF +VSGY NRF+  ++YL + GD V ++T       + +PEE +G K+
Sbjct  60   PRKIALLVEPTPFTHVSGYANRFKEMLRYLSKAGDNVDILTVDAKTPKDELPEESFGYKI  119

Query  580  IGSRSFPCPWYNKVPLSLAL  639
              ++ F  P Y+ + L+  L
Sbjct  120  EHTQGFVFPLYDHISLTFDL  139



>ref|XP_005705641.1| UDP-sulfoquinovose:DAG sulfoquinovosyltransferase [Galdieria 
sulphuraria]
 gb|EME29121.1| UDP-sulfoquinovose:DAG sulfoquinovosyltransferase [Galdieria 
sulphuraria]
Length=434

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHE--GVPEEFYGAKLIGS  588
            PR++ + +EP+PF ++SGY NRF+  +KYL++ GDEV+++        P+E YG  +I  
Sbjct  36   PRKVVMIIEPTPFTHISGYSNRFRETLKYLKQAGDEVLIIVPDNSFDAPQEIYGFPIISI  95

Query  589  RSFPCPWYNKVPLSLALSPRIIS  657
            R F    Y K+ LS  L   I S
Sbjct  96   RGFRFFLYPKITLSFGLFGGIFS  118



>ref|XP_002185276.1| glycosyl transferase, group 1 [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC43145.1| glycosyl transferase, group 1 [Phaeodactylum tricornutum CCAP 
1055/1]
Length=507

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTT------HEGVPEEFYGAK  576
            PR+I L VEP+PF +VSGY NRF+  +K++ + GDEV ++T       HE +P    G  
Sbjct  64   PRKICLMVEPTPFTHVSGYANRFKEMLKFMAKAGDEVDILTVDTKTPAHE-LPTACSGFS  122

Query  577  LIGSRSFPCPWYNKVPLSLAL  639
            +  ++ F  P YN++ L+  L
Sbjct  123  IKHTQGFTFPLYNQISLTFDL  143



>ref|XP_009034698.1| hypothetical protein AURANDRAFT_52616 [Aureococcus anophagefferens]
 gb|EGB11152.1| hypothetical protein AURANDRAFT_52616 [Aureococcus anophagefferens]
Length=432

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = +1

Query  418  RRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEE-----FYGAKLI  582
            R++AL VEP+PF +VSGY NRFQ  +K+L   GD V+ V T + VPE       +    +
Sbjct  44   RKVALLVEPTPFTHVSGYANRFQEMLKHLERRGD-VVAVATPDDVPEAPASFGKFAVTTL  102

Query  583  GSRSFPCPWYNKVPLSLALS  642
            G   F  PWY ++ LSL L 
Sbjct  103  GGFRFR-PWYPEICLSLDLD  121



>ref|XP_009035363.1| hypothetical protein AURANDRAFT_2613, partial [Aureococcus anophagefferens]
 gb|EGB09356.1| hypothetical protein AURANDRAFT_2613, partial [Aureococcus anophagefferens]
Length=379

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEG--VPEEFYGAKLIGS  588
            PRR+AL VEP+PF +VSGY NRF+  +KYL+E GD+V +    +    P+ + G  +   
Sbjct  1    PRRVALLVEPTPFTHVSGYANRFKEQLKYLKEFGDDVAIAVPDDKPEAPDSYDGFPITTV  60

Query  589  RSFPCPWYNKVPLS  630
              F  P Y  + L+
Sbjct  61   DGFRFPLYAHLCLT  74



>gb|EWM27152.1| gdp-mannose-dependent alpha-mannosyltransferase [Nannochloropsis 
gaditana]
Length=505

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHE--GVPEEFYGAKLIG  585
            +P R+ L VEP+PF +VSGY NRF+  +K+L   GD V + TT +    P +F   ++  
Sbjct  90   RPLRVGLLVEPTPFTHVSGYANRFKEMLKHLHRTGDRVEICTTDDVPSAPPKFLDYRINY  149

Query  586  SRSFPCPWYNKVPLSL  633
            +  F  P Y+ + LSL
Sbjct  150  TPGFRFPLYDHISLSL  165



>ref|XP_005767468.1| SQDG synthase [Emiliania huxleyi CCMP1516]
 gb|EOD15039.1| SQDG synthase [Emiliania huxleyi CCMP1516]
Length=660

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT--THEGVPEEFYGAKLIGS  588
            P R+ L VEP+PF +VSGY NRF+ ++KY +  G EV ++T    E  P+ F G  +   
Sbjct  53   PMRVQLIVEPTPFTHVSGYANRFKEYLKYQKAAGAEVSIITPDDSEDAPKHFLGYPIATI  112

Query  589  RSFPCPWYNK  618
            R F  P Y +
Sbjct  113  RGFRFPLYKQ  122



>emb|CBJ27895.1| UDP-sulfoquinovose: diacylglycerol alpha-sulfoquinovosyltransferase 
SQD2, N-terminal fragment, family GT4 [Ectocarpus siliculosus]
Length=193

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHE  546
            P ++AL VEP+PF ++SGY NRF+  +K+L + GDEV ++TT +
Sbjct  93   PLKVALLVEPTPFTHISGYSNRFREMLKFLSKAGDEVEILTTDD  136



>ref|XP_001689662.1| sulfolipid synthase [Chlamydomonas reinhardtii]
 gb|EDP09400.1| sulfolipid synthase [Chlamydomonas reinhardtii]
Length=402

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 13/67 (19%)
 Frame = +1

Query  490  FIKYLREMGDEVMVVTTHEGV-------------PEEFYGAKLIGSRSFPCPWYNKVPLS  630
             I+YL E G +V+VVTT  G              PE F GA+++ + SF CPWY +VPL+
Sbjct  1    MIRYLVEAGCQVLVVTTGAGYTLPGVDASSFREQPETFAGARVVSALSFGCPWYLQVPLT  60

Query  631  LALSPRI  651
             ALSPRI
Sbjct  61   FALSPRI  67



>ref|XP_005706721.1| sulfoquinovosyltransferase [Galdieria sulphuraria]
 gb|EME30201.1| sulfoquinovosyltransferase [Galdieria sulphuraria]
Length=561

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVT--THEGVPEEFYGAKLIGS  588
            P RI + +EPSPF +VSGY NRF   ++YL+E GD+V++V        P+E +G  ++  
Sbjct  142  PHRIVMIIEPSPFTHVSGYSNRFIETLRYLKEAGDDVLIVVPEVSGSAPKEIFGFPIVNI  201

Query  589  RSFPCPWYNKVPLS  630
              F    Y  + LS
Sbjct  202  PGFRFALYPNIVLS  215



>ref|XP_002295162.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED87466.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=366

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 5/74 (7%)
 Frame = +1

Query  433  FVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTH-----EGVPEEFYGAKLIGSRSF  597
             +EP+PF +VSGY NRF+  ++YL + GD V ++T       E +P+E +G  +  ++ F
Sbjct  1    MIEPTPFTHVSGYANRFKEMLRYLSKAGDNVDILTVDSKTPKEELPKEAFGYSIEHTQGF  60

Query  598  PCPWYNKVPLSLAL  639
              P YN + L++ L
Sbjct  61   VFPLYNHISLTVDL  74



>ref|XP_005791415.1| hypothetical protein EMIHUDRAFT_223825 [Emiliania huxleyi CCMP1516]
 gb|EOD38986.1| hypothetical protein EMIHUDRAFT_223825 [Emiliania huxleyi CCMP1516]
Length=234

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV  525
            PRR+AL VEP+PF ++SGY NRF+  +++L   GDEV
Sbjct  26   PRRVALLVEPTPFTHISGYSNRFKEMLRFLVAAGDEV  62



>ref|XP_005789854.1| hypothetical protein EMIHUDRAFT_225608 [Emiliania huxleyi CCMP1516]
 gb|EOD37425.1| hypothetical protein EMIHUDRAFT_225608 [Emiliania huxleyi CCMP1516]
Length=354

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  415  PRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEV  525
            PRR+AL VEP+PF ++SGY NRF+  +++L   GDEV
Sbjct  26   PRRVALLVEPTPFTHISGYSNRFKEMLRFLVAAGDEV  62



>gb|KJB17033.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=470

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 35/82 (43%), Gaps = 46/82 (56%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            KPRRIALFVEPSPF                                              
Sbjct  107  KPRRIALFVEPSPF----------------------------------------------  120

Query  592  SFPCPWYNKVPLSLALSPRIIS  657
            SFPCPWY KVPLSLALSPRIIS
Sbjct  121  SFPCPWYQKVPLSLALSPRIIS  142



>ref|XP_005834049.1| hypothetical protein GUITHDRAFT_45198, partial [Guillardia theta 
CCMP2712]
 gb|EKX47069.1| hypothetical protein GUITHDRAFT_45198, partial [Guillardia theta 
CCMP2712]
Length=323

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +1

Query  433  FVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGV--PEEFYGAKLIGSRSFPCP  606
             VEP+PF +VSGY NR+Q  ++Y+++  D++ +VT  +    PE F G  +  +  F   
Sbjct  1    IVEPTPFTHVSGYSNRYQEMLRYMQKAEDQIEIVTPDDSQDPPESFLGYPITYTPGFRFS  60

Query  607  WYNKVPLSL  633
             YN + LSL
Sbjct  61   LYNLICLSL  69



>emb|CAE20224.1| SqdX [Prochlorococcus marinus str. MIT 9313]
Length=409

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = +1

Query  412  KPRRIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSR  591
            +P +IA F E +    V G   R    +++L E GDEVMV    EG P E+ GA+LIG  
Sbjct  27   EPVKIAFFTE-TFLPKVDGIVTRLTKTVQHLVEAGDEVMVFCP-EGCPSEYMGAELIGVP  84

Query  592  SFPCPWYNKVPLSL  633
            + P P Y ++ L+L
Sbjct  85   AMPLPLYPELKLAL  98



>ref|WP_006042635.1| glycosyl transferase [Synechococcus sp. WH 7805]
 gb|EAR17689.1| SqdX [Synechococcus sp. WH 7805]
Length=382

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            +IA F E +    V G   R    +K+L E GDEV+V    EG PEE+ GA+LIG  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVKHLVEAGDEVIVFCP-EGCPEEYMGARLIGVPAMP  59

Query  601  CPWYNKVPLSL  633
             P Y ++ L+L
Sbjct  60   LPLYPELKLAL  70



>ref|WP_011931986.1| glycosyl transferase [Synechococcus sp. WH 7803]
 emb|CAK22478.1| Glycosyltransferase of family GT4; possible alpha-mannosyltransferase 
[Synechococcus sp. WH 7803]
Length=382

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            +IA F E +    V G   R    +K+L + GDEV+V    EG PEE+ GA+LIG  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEVIVFCP-EGCPEEYMGARLIGVPAMP  59

Query  601  CPWYNKVPLSL  633
             P Y ++ L+L
Sbjct  60   LPLYPELKLAL  70



>ref|WP_011363092.1| glycosyl transferase [Synechococcus sp. CC9605]
 gb|ABB33830.1| SqdX [Synechococcus sp. CC9605]
Length=381

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            ++A F E +    V G   R    +K+L + GDEV VV   EG PEE+ GA+LIG  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPEEYMGARLIGVPAMP  59

Query  601  CPWYNKVPLSL  633
             P Y ++ L+L
Sbjct  60   LPLYPELKLAL  70



>gb|AHF62481.1| SqdX [Synechococcus sp. WH 8109]
Length=381

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            ++A F E +    V G   R    +K+L + GDEV VV   EG PEE+ GA+LIG  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPEEYMGARLIGVPAMP  59

Query  601  CPWYNKVPLSL  633
             P Y ++ L+L
Sbjct  60   LPLYPELKLAL  70



>ref|WP_038551862.1| glycosyl transferase [Synechococcus sp. KORDI-52]
 gb|AII47975.1| glycosyl transferase [Synechococcus sp. KORDI-52]
Length=381

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            ++A F E +    V G   R    +K+L + GDEV VV   EG PEE+ GA+LIG  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPEEYMGARLIGVPAMP  59

Query  601  CPWYNKVPLSL  633
             P Y ++ L+L
Sbjct  60   LPLYPELKLAL  70



>ref|WP_028953281.1| glycosyl transferase [Synechococcus sp. CC9616]
Length=381

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            ++A F E +    V G   R    +K+L + GDEV VV   EG PEE+ GA+LIG  + P
Sbjct  2    KVAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPEEYMGARLIGVPAMP  59

Query  601  CPWYNKVPLSL  633
             P Y ++ L+L
Sbjct  60   LPLYPELKLAL  70



>ref|WP_009788501.1| glycosyl transferase [Synechococcus sp. BL107]
 gb|EAU71135.1| SqdX [Synechococcus sp. BL107]
Length=382

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +1

Query  421  RIALFVEPSPFAYVSGYKNRFQNFIKYLREMGDEVMVVTTHEGVPEEFYGAKLIGSRSFP  600
            +IA F E +    V G   R    +K+L + GDEV VV   EG P+E+ GA+LIG  + P
Sbjct  2    KIAFFTE-TFLPKVDGIVTRLTKTVKHLVDAGDEV-VVFCPEGCPDEYMGARLIGVPAMP  59

Query  601  CPWYNKVPLSL  633
             P Y ++ L+L
Sbjct  60   LPLYPELKLAL  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500