BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039K02

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD02268.1|  aspartate aminotransferase                             162   2e-46   Nicotiana tabacum [American tobacco]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    164   8e-45   Nicotiana sylvestris
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    164   1e-44   Solanum tuberosum [potatoes]
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     164   1e-44   Solanum tuberosum [potatoes]
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    161   1e-43   Solanum lycopersicum
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    161   2e-43   Nelumbo nucifera [Indian lotus]
dbj|BAD94538.1|  aspartate aminotransferase                             153   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    159   6e-43   Populus euphratica
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        159   6e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        159   7e-43   
gb|AFK46621.1|  unknown                                                 154   8e-43   Lotus japonicus
ref|XP_010042868.1|  PREDICTED: aspartate aminotransferase P2, mi...    150   8e-43   Eucalyptus grandis [rose gum]
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   157   1e-42   Citrus sinensis [apfelsine]
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             158   1e-42   Citrus clementina [clementine]
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    158   1e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK24563.1|  unknown                                                 158   2e-42   Picea sitchensis
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   158   2e-42   Citrus sinensis [apfelsine]
gb|ACN40845.1|  unknown                                                 158   2e-42   Picea sitchensis
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    158   2e-42   Prunus mume [ume]
emb|CDP18792.1|  unnamed protein product                                159   2e-42   Coffea canephora [robusta coffee]
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             157   2e-42   Prunus persica
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             157   2e-42   
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    157   3e-42   
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    157   4e-42   Populus euphratica
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    156   5e-42   Brassica rapa
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         157   6e-42   Jatropha curcas
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             156   6e-42   Capsella rubella
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    156   6e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    157   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    156   8e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002515455.1|  aspartate aminotransferase, putative               156   8e-42   Ricinus communis
gb|AAC12674.1|  aspartate aminotransferase                              156   8e-42   Lotus corniculatus
gb|AAB46611.1|  aspartate aminotransferase                              155   1e-41   Medicago sativa [alfalfa]
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             155   1e-41   
prf||1908424A  Asp aminotransferase                                     155   1e-41   Medicago sativa [alfalfa]
gb|KEH39860.1|  aspartate aminotransferase                              155   1e-41   Medicago truncatula
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    155   2e-41   Malus domestica [apple tree]
gb|ABR16448.1|  unknown                                                 154   2e-41   Picea sitchensis
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    155   3e-41   Cicer arietinum [garbanzo]
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    154   3e-41   Camelina sativa [gold-of-pleasure]
ref|NP_001190885.1|  aspartate aminotransferase                         154   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237987.1|  aspartate aminotransferase                         154   4e-41   
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    154   4e-41   Glycine max [soybeans]
emb|CAA56932.1|  aspartate aminotransferase                             154   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194927.1|  aspartate aminotransferase                            154   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB65891.1|  hypothetical protein B456_010G117400                    154   5e-41   Gossypium raimondii
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  154   5e-41   Canavalia lineata
gb|KJB65890.1|  hypothetical protein B456_010G117400                    154   6e-41   Gossypium raimondii
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             154   6e-41   
ref|XP_007011759.1|  Aspartate aminotransferase                         154   7e-41   
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                153   1e-40   Erythranthe guttata [common monkey flower]
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                153   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_007161154.1|  hypothetical protein PHAVU_001G0470000g            149   1e-40   Phaseolus vulgaris [French bean]
emb|CDJ26231.1|  putative aspartate aminotransferase                    153   1e-40   Brassica oleracea
ref|XP_010089944.1|  Aspartate aminotransferase                         153   1e-40   
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    152   2e-40   Eucalyptus grandis [rose gum]
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    152   2e-40   Glycine max [soybeans]
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   152   2e-40   Panicum miliaceum [broom millet]
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     152   2e-40   Eucalyptus grandis [rose gum]
emb|CDY13467.1|  BnaA03g51850D                                          152   2e-40   Brassica napus [oilseed rape]
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    152   3e-40   Setaria italica
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    152   3e-40   Elaeis guineensis
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    151   3e-40   
ref|NP_001149005.1|  aspartate aminotransferase                         152   3e-40   
gb|ACR34530.1|  unknown                                                 152   4e-40   Zea mays [maize]
gb|AAO23563.1|  aspartate aminotransferase                              151   4e-40   Oryza sativa [red rice]
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    152   4e-40   Glycine max [soybeans]
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    151   4e-40   
gb|KJB55008.1|  hypothetical protein B456_009G060500                    150   5e-40   Gossypium raimondii
prf||2009357A  Asp aminotransferase                                     151   7e-40   Medicago sativa [alfalfa]
emb|CDX75211.1|  BnaA01g04910D                                          151   7e-40   
ref|NP_001048397.1|  Os02g0797500                                       151   8e-40   
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    151   8e-40   Brassica rapa
ref|XP_001785888.1|  predicted protein                                  150   8e-40   
gb|KJB55006.1|  hypothetical protein B456_009G060500                    150   9e-40   Gossypium raimondii
gb|KJB55007.1|  hypothetical protein B456_009G060500                    150   9e-40   Gossypium raimondii
ref|NP_001031767.1|  aspartate aminotransferase                         150   9e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67272.1|  aspartate aminotransferase                              150   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    150   1e-39   Phaseolus vulgaris [French bean]
emb|CAN76227.1|  hypothetical protein VITISV_000267                     150   1e-39   Vitis vinifera
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    150   1e-39   Vitis vinifera
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          150   1e-39   Amborella trichopoda
emb|CDX68807.1|  BnaC01g06460D                                          150   2e-39   
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    150   2e-39   Gossypium arboreum [tree cotton]
gb|ACU24502.1|  unknown                                                 150   2e-39   Glycine max [soybeans]
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    149   2e-39   Cucumis melo [Oriental melon]
gb|KJB55009.1|  hypothetical protein B456_009G060500                    150   2e-39   Gossypium raimondii
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    149   3e-39   Cucumis melo [Oriental melon]
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    149   3e-39   Cucumis sativus [cucumbers]
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    149   4e-39   Fragaria vesca subsp. vesca
emb|CDX72339.1|  BnaC07g43610D                                          149   5e-39   
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    148   6e-39   Lupinus angustifolius
dbj|BAJ97030.1|  predicted protein                                      146   6e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               148   7e-39   Triticum urartu
emb|CAA04697.1|  aspartate aminotransferase 2                           148   8e-39   Canavalia lineata
dbj|BAJ92741.1|  predicted protein                                      148   9e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               147   2e-38   
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    146   3e-38   Brachypodium distachyon [annual false brome]
dbj|BAJ96638.1|  predicted protein                                      146   4e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             145   4e-38   
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             145   4e-38   
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    145   6e-38   Phoenix dactylifera
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    144   2e-37   
gb|ACG59771.1|  chloroplast aspartate aminotransferase                  137   2e-35   Triticum aestivum [Canadian hard winter wheat]
gb|EPS71467.1|  aspartate aminotransferase                              131   2e-35   Genlisea aurea
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...    131   8e-33   Phoenix dactylifera
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...    130   1e-32   
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            115   4e-27   Glycine soja [wild soybean]
ref|XP_008784800.1|  PREDICTED: aspartate aminotransferase, chlor...    111   7e-26   
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...    112   8e-26   
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             110   2e-25   Chlorella variabilis
ref|XP_005642879.1|  aspartate aminotransferase                         108   1e-24   Coccomyxa subellipsoidea C-169
ref|XP_005843806.1|  hypothetical protein CHLNCDRAFT_59799              106   7e-24   Chlorella variabilis
ref|XP_001695040.1|  aspartate aminotransferase                         105   1e-23   Chlamydomonas reinhardtii
ref|XP_002501168.1|  aspartate aminotransferase                         103   5e-23   Micromonas commoda
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial       102   2e-22   Auxenochlorella protothecoides
ref|XP_001700039.1|  aspartate aminotransferase                         102   2e-22   Chlamydomonas reinhardtii
ref|XP_002954714.1|  aspartate aminotransferase                         101   4e-22   Volvox carteri f. nagariensis
ref|XP_001771002.1|  predicted protein                                99.8    1e-21   
gb|KIZ05915.1|  aspartate aminotransferase                            98.2    4e-21   Monoraphidium neglectum
ref|XP_002950644.1|  aspartate aminotransferase                       98.2    7e-21   Volvox carteri f. nagariensis
ref|XP_003064597.1|  aspartate amino transferase                      97.4    1e-20   Micromonas pusilla CCMP1545
ref|XP_005643912.1|  aspartate aminotransferase                       94.4    2e-19   Coccomyxa subellipsoidea C-169
ref|XP_002514283.1|  aspartate aminotransferase, putative             93.6    2e-19   
gb|AAL82596.1|  aspartate aminotransferase 1                          88.6    4e-19   Musa acuminata [banana]
gb|AAM91546.1|  aspartate aminotransferase Asp2                       90.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493028.1|  PREDICTED: aspartate aminotransferase, cytop...  92.4    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010420761.1|  PREDICTED: aspartate aminotransferase, cytop...  92.4    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006287876.1|  hypothetical protein CARUB_v10001103mg           92.4    6e-19   Capsella rubella
ref|XP_010454237.1|  PREDICTED: aspartate aminotransferase, cytop...  92.4    6e-19   Camelina sativa [gold-of-pleasure]
emb|CBI20886.3|  unnamed protein product                              92.4    7e-19   Vitis vinifera
ref|XP_002871893.1|  hypothetical protein ARALYDRAFT_909992           92.4    7e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_011048396.1|  PREDICTED: aspartate aminotransferase, cytop...  92.0    7e-19   Populus euphratica
ref|XP_002284136.1|  PREDICTED: aspartate aminotransferase, cytop...  92.8    7e-19   Vitis vinifera
ref|XP_011043495.1|  PREDICTED: aspartate aminotransferase, cytop...  92.0    7e-19   Populus euphratica
ref|XP_010693429.1|  PREDICTED: aspartate aminotransferase, cytop...  92.4    8e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010254083.1|  PREDICTED: aspartate aminotransferase, cytop...  92.4    1e-18   Nelumbo nucifera [Indian lotus]
gb|AFK44136.1|  unknown                                               88.6    1e-18   Medicago truncatula
ref|XP_007137184.1|  hypothetical protein PHAVU_009G106800g           91.7    1e-18   Phaseolus vulgaris [French bean]
ref|XP_011078312.1|  PREDICTED: aspartate aminotransferase, cytop...  91.7    1e-18   Sesamum indicum [beniseed]
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...  92.0    1e-18   Solanum lycopersicum
emb|CDM84293.1|  unnamed protein product                              92.0    2e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...  91.7    2e-18   Solanum tuberosum [potatoes]
emb|CDX70399.1|  BnaC03g04830D                                        91.7    2e-18   
ref|XP_002989786.1|  hypothetical protein SELMODRAFT_184818           91.3    2e-18   
gb|KHG23914.1|  Aspartate aminotransferase, chloroplastic -like p...  91.7    2e-18   Gossypium arboreum [tree cotton]
ref|XP_009131210.1|  PREDICTED: aspartate aminotransferase 3, chl...  91.7    2e-18   Brassica rapa
gb|KFK25414.1|  aspartate aminotransferase                            91.7    2e-18   Arabis alpina [alpine rockcress]
ref|XP_006450636.1|  hypothetical protein CICLE_v10008274mg           91.7    2e-18   Citrus clementina [clementine]
ref|XP_002990136.1|  hypothetical protein SELMODRAFT_235954           90.9    2e-18   
gb|KJB07521.1|  hypothetical protein B456_001G028100                  91.7    2e-18   Gossypium raimondii
gb|AEX09183.1|  putative aspartate aminotransferase 2                 91.7    2e-18   Gossypium hirsutum [American cotton]
gb|AAA79370.1|  aspartate aminotransferase                            90.9    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197456.1|  aspartate aminotransferase                          90.9    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDP03316.1|  unnamed protein product                              90.9    2e-18   Coffea canephora [robusta coffee]
ref|XP_007012061.1|  Aspartate aminotransferase 3                     91.3    2e-18   
ref|XP_006451184.1|  hypothetical protein CICLE_v10008489mg           90.9    2e-18   Citrus clementina [clementine]
gb|ABY58643.1|  aspartate aminotransferase                            90.5    2e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010519716.1|  PREDICTED: aspartate aminotransferase, cytop...  90.1    2e-18   Tarenaya hassleriana [spider flower]
sp|P28734.1|AATC_DAUCA  RecName: Full=Aspartate aminotransferase,...  90.5    3e-18   Daucus carota [carrots]
ref|XP_004501184.1|  PREDICTED: aspartate aminotransferase 1-like     91.3    3e-18   Cicer arietinum [garbanzo]
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...  91.3    3e-18   Nicotiana tomentosiformis
ref|XP_004136291.1|  PREDICTED: aspartate aminotransferase, chlor...  91.3    3e-18   Cucumis sativus [cucumbers]
ref|XP_010519717.1|  PREDICTED: aspartate aminotransferase, cytop...  90.5    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_002324997.1|  aspartate aminotransferase family protein        90.5    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002516566.1|  aspartate aminotransferase, putative             90.9    3e-18   Ricinus communis
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...  90.9    3e-18   Nicotiana sylvestris
emb|CDY71396.1|  BnaCnng72730D                                        89.0    3e-18   Brassica napus [oilseed rape]
gb|AAL09704.1|AF419301_1  aspartate aminotransferase                  89.7    3e-18   Securigera parviflora
ref|XP_006476088.1|  PREDICTED: aspartate aminotransferase 3, chl...  90.9    3e-18   Citrus sinensis [apfelsine]
sp|P37833.1|AATC_ORYSJ  RecName: Full=Aspartate aminotransferase,...  90.1    4e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KJB07520.1|  hypothetical protein B456_001G028000                  89.4    4e-18   Gossypium raimondii
ref|XP_009410920.1|  PREDICTED: aspartate aminotransferase, cytop...  90.9    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789337.1|  PREDICTED: aspartate aminotransferase, cytop...  90.9    4e-18   Phoenix dactylifera
ref|XP_006644742.1|  PREDICTED: aspartate aminotransferase, cytop...  90.9    4e-18   Oryza brachyantha
ref|NP_001044317.1|  Os01g0760600                                     90.5    5e-18   
ref|XP_009120876.1|  PREDICTED: aspartate aminotransferase, cytop...  90.1    5e-18   Brassica rapa
emb|CDX92520.1|  BnaA10g15590D                                        90.1    5e-18   
ref|XP_006289742.1|  hypothetical protein CARUB_v10003310mg           90.5    5e-18   Capsella rubella
ref|XP_007013138.1|  Aspartate aminotransferase, cytoplasmic          89.7    5e-18   
emb|CDY65959.1|  BnaC09g54080D                                        89.7    6e-18   Brassica napus [oilseed rape]
gb|KDP33689.1|  hypothetical protein JCGZ_07260                       89.7    6e-18   Jatropha curcas
ref|XP_010419724.1|  PREDICTED: aspartate aminotransferase 3, chl...  90.1    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010453196.1|  PREDICTED: aspartate aminotransferase 3, chl...  90.1    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006352160.1|  PREDICTED: aspartate aminotransferase, cytop...  89.7    6e-18   Solanum tuberosum [potatoes]
gb|ABR16105.1|  unknown                                               89.7    6e-18   Picea sitchensis
ref|XP_010491885.1|  PREDICTED: aspartate aminotransferase 3, chl...  90.1    6e-18   Camelina sativa [gold-of-pleasure]
gb|KDP34208.1|  hypothetical protein JCGZ_07779                       90.1    6e-18   Jatropha curcas
gb|KJB07518.1|  hypothetical protein B456_001G028000                  89.7    7e-18   Gossypium raimondii
ref|XP_002873517.1|  hypothetical protein ARALYDRAFT_487989           90.1    7e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_011090162.1|  PREDICTED: aspartate aminotransferase, cytop...  90.1    7e-18   Sesamum indicum [beniseed]
ref|NP_196713.1|  aspartate aminotransferase 3                        89.7    8e-18   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA57534.1|  TPA: hypothetical protein ZEAMMB73_000065            86.7    8e-18   
gb|KFK40563.1|  hypothetical protein AALP_AA2G012200                  85.5    8e-18   Arabis alpina [alpine rockcress]
ref|XP_010920378.1|  PREDICTED: aspartate aminotransferase, cytop...  90.1    8e-18   Elaeis guineensis
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640        89.7    8e-18   Amborella trichopoda
ref|XP_009762342.1|  PREDICTED: aspartate aminotransferase, cytop...  89.4    9e-18   Nicotiana sylvestris
ref|XP_009395718.1|  PREDICTED: aspartate aminotransferase, cytop...  89.4    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010250350.1|  PREDICTED: aspartate aminotransferase, cytop...  89.7    9e-18   
gb|ACN40894.1|  unknown                                               89.7    9e-18   Picea sitchensis
ref|XP_009617506.1|  PREDICTED: aspartate aminotransferase, cytop...  89.4    9e-18   Nicotiana tomentosiformis
gb|ACU21245.1|  unknown                                               88.2    1e-17   Glycine max [soybeans]
ref|XP_008466236.1|  PREDICTED: aspartate aminotransferase, cytop...  89.4    1e-17   Cucumis melo [Oriental melon]
gb|EMT25743.1|  Aspartate aminotransferase, cytoplasmic               89.0    1e-17   
ref|XP_009112705.1|  PREDICTED: aspartate aminotransferase, cytop...  89.0    1e-17   Brassica rapa
gb|KEH36022.1|  aspartate aminotransferase                            89.0    1e-17   Medicago truncatula
emb|CAA43779.1|  aspartate aminotransferase                           89.0    1e-17   Medicago sativa [alfalfa]
ref|XP_010688229.1|  PREDICTED: aspartate aminotransferase, cytop...  88.6    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010100270.1|  Aspartate aminotransferase                       89.4    1e-17   Morus notabilis
tpg|DAA57533.1|  TPA: hypothetical protein ZEAMMB73_000065            86.7    1e-17   
gb|KHN10226.1|  Aspartate aminotransferase 1                          88.6    1e-17   Glycine soja [wild soybean]
gb|KJB64944.1|  hypothetical protein B456_010G072900                  88.6    2e-17   Gossypium raimondii
gb|KHG24168.1|  Aspartate aminotransferase, cytoplasmic               88.6    2e-17   Gossypium arboreum [tree cotton]
gb|AFK40370.1|  unknown                                               88.6    2e-17   Medicago truncatula
gb|KCW81535.1|  hypothetical protein EUGRSUZ_C02894                   89.0    2e-17   Eucalyptus grandis [rose gum]
gb|KEH36020.1|  aspartate aminotransferase                            89.0    2e-17   Medicago truncatula
ref|XP_004970037.1|  PREDICTED: aspartate aminotransferase, cytop...  89.0    2e-17   Setaria italica
emb|CDP16161.1|  unnamed protein product                              88.6    2e-17   Coffea canephora [robusta coffee]
ref|XP_011019648.1|  PREDICTED: aspartate aminotransferase, cytop...  89.0    2e-17   Populus euphratica
ref|XP_002308618.1|  aspartate transaminase family protein            88.6    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002284313.1|  PREDICTED: aspartate aminotransferase, cytop...  88.2    2e-17   Vitis vinifera
emb|CAN70394.1|  hypothetical protein VITISV_020521                   88.2    2e-17   Vitis vinifera
ref|XP_009126373.1|  PREDICTED: aspartate aminotransferase, cytop...  88.2    2e-17   Brassica rapa
emb|CDY42276.1|  BnaC02g08820D                                        88.2    2e-17   Brassica napus [oilseed rape]
gb|AAC50015.1|  aspartate aminotransferase cytosolic isozyme AAT2     88.2    2e-17   Glycine max [soybeans]
gb|KHG23915.1|  Aspartate aminotransferase, cytoplasmic               88.6    2e-17   Gossypium arboreum [tree cotton]
ref|XP_006399658.1|  hypothetical protein EUTSA_v10013515mg           88.6    2e-17   Eutrema salsugineum [saltwater cress]
ref|NP_001237541.1|  aspartate aminotransferase glyoxysomal isozy...  88.6    2e-17   Glycine max [soybeans]
gb|AAA50160.1|  aspartate aminotransferase P1                         88.2    3e-17   Lupinus angustifolius
ref|XP_006400515.1|  hypothetical protein EUTSA_v10013703mg           87.8    3e-17   Eutrema salsugineum [saltwater cress]
gb|AAA33408.1|  aspartate aminotransferase P1                         88.2    3e-17   Lupinus angustifolius
ref|XP_003569862.1|  PREDICTED: aspartate aminotransferase, cytop...  88.2    3e-17   Brachypodium distachyon [annual false brome]
emb|CDY44925.1|  BnaA02g04300D                                        87.4    3e-17   Brassica napus [oilseed rape]
emb|CAA45023.1|  aspartate aminotransferase                           87.4    3e-17   Panicum miliaceum [broom millet]
ref|XP_004291203.1|  PREDICTED: aspartate aminotransferase, cytop...  88.2    4e-17   Fragaria vesca subsp. vesca
gb|AIT70250.1|  aspartate aminotransferase                            87.4    4e-17   Betaphycus philippinensis
ref|XP_004243159.1|  PREDICTED: aspartate aminotransferase, cytop...  87.4    4e-17   
gb|KFK26196.1|  hypothetical protein AALP_AA8G215200                  87.4    4e-17   Arabis alpina [alpine rockcress]
gb|AIT70256.1|  aspartate aminotransferase                            87.4    5e-17   Eucheuma denticulatum
ref|XP_003486130.1|  PREDICTED: aspartate aminotransferase, mitoc...  87.4    5e-17   Bombus impatiens
ref|XP_003402856.1|  PREDICTED: aspartate aminotransferase, mitoc...  87.4    5e-17   Bombus terrestris [large earth bumblebee]
gb|EYU29270.1|  hypothetical protein MIMGU_mgv1a006139mg              87.4    5e-17   Erythranthe guttata [common monkey flower]
emb|CAA63894.1|  aspartate aminotransferase                           87.0    5e-17   Lotus japonicus
ref|XP_010532471.1|  PREDICTED: aspartate aminotransferase 3, chl...  87.4    6e-17   Tarenaya hassleriana [spider flower]
gb|AEX09182.1|  putative aspartate aminotransferase 1                 87.0    6e-17   Gossypium hirsutum [American cotton]
ref|XP_007298245.1|  hypothetical protein STEHIDRAFT_88821            87.0    6e-17   Stereum hirsutum FP-91666 SS1
ref|NP_001141224.1|  uncharacterized protein LOC100273311             87.4    7e-17   Zea mays [maize]
ref|XP_006476087.1|  PREDICTED: aspartate aminotransferase 3, chl...  87.0    8e-17   Citrus sinensis [apfelsine]
ref|XP_010049084.1|  PREDICTED: aspartate aminotransferase, cytop...  87.8    8e-17   
ref|XP_002308617.2|  hypothetical protein POPTR_0006s25820g           87.0    9e-17   
ref|XP_010048107.1|  PREDICTED: aspartate aminotransferase, cytop...  86.3    9e-17   Eucalyptus grandis [rose gum]
ref|XP_006401959.1|  hypothetical protein EUTSA_v10015824mg           85.9    9e-17   
gb|KCW80240.1|  hypothetical protein EUGRSUZ_C01585                   86.3    1e-16   Eucalyptus grandis [rose gum]
sp|P28011.2|AAT1_MEDSA  RecName: Full=Aspartate aminotransferase ...  86.3    1e-16   Medicago sativa [alfalfa]
emb|CDY34689.1|  BnaC04g19940D                                        86.3    1e-16   Brassica napus [oilseed rape]
ref|XP_011019649.1|  PREDICTED: aspartate aminotransferase, cytop...  85.9    1e-16   Populus euphratica
gb|EFA86317.1|  aspartate aminotransferase                            86.3    2e-16   Heterostelium album PN500
ref|XP_008378104.1|  PREDICTED: aspartate aminotransferase, cytop...  85.9    2e-16   Malus domestica [apple tree]
ref|XP_009367911.1|  PREDICTED: aspartate aminotransferase, cytop...  86.3    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_008352022.1|  PREDICTED: aspartate aminotransferase, cytop...  85.9    2e-16   
ref|XP_009367910.1|  PREDICTED: aspartate aminotransferase, cytop...  85.9    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_008361035.1|  PREDICTED: aspartate aminotransferase, cytop...  85.9    2e-16   
ref|XP_010473503.1|  PREDICTED: aspartate aminotransferase, cytop...  85.5    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008220042.1|  PREDICTED: aspartate aminotransferase, cytop...  85.9    2e-16   Prunus mume [ume]
ref|XP_007222958.1|  hypothetical protein PRUPE_ppa005315mg           85.9    2e-16   Prunus persica
gb|EYU32932.1|  hypothetical protein MIMGU_mgv1a0079832mg             79.7    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_009123404.1|  PREDICTED: aspartate aminotransferase, cytop...  84.7    4e-16   Brassica rapa
gb|EPS68452.1|  aspartate aminotransferase                            79.3    4e-16   Genlisea aurea
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242            84.3    6e-16   Gloeophyllum trabeum ATCC 11539
ref|XP_007012062.1|  Aspartate aminotransferase 3, putative           85.1    6e-16   
ref|XP_002767261.1|  aspartate aminotransferase, putative             79.0    7e-16   Perkinsus marinus ATCC 50983
emb|CEL53865.1|  aspartate aminotransferase                           84.0    8e-16   Rhizoctonia solani AG-1 IB
ref|XP_007378607.1|  hypothetical protein PUNSTDRAFT_109873           84.0    8e-16   Punctularia strigosozonata HHB-11173 SS5
gb|KDN44729.1|  putative aspartate aminotransferase, cytoplasmic      83.6    1e-15   Tilletiaria anomala UBC 951
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                 83.6    1e-15   Jaapia argillacea MUCL 33604
gb|KIL70778.1|  hypothetical protein M378DRAFT_183367                 83.6    1e-15   Amanita muscaria Koide BX008
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828           83.6    1e-15   Heterobasidion irregulare TC 32-1
emb|CDY32206.1|  BnaA03g54610D                                        83.2    1e-15   Brassica napus [oilseed rape]
ref|XP_004356181.1|  aspartate aminotransferase                       83.6    1e-15   Cavenderia fasciculata
gb|EMS51413.1|  Aspartate aminotransferase, cytoplasmic               83.6    1e-15   
emb|CDY20276.1|  BnaC04g36800D                                        83.2    1e-15   
gb|KJA29187.1|  hypothetical protein HYPSUDRAFT_32564                 83.2    1e-15   
emb|CDY39814.1|  BnaA09g10660D                                        82.8    2e-15   
ref|XP_010430356.1|  PREDICTED: aspartate aminotransferase, cytop...  82.8    2e-15   
gb|AAR00232.1|  aspartate transaminase                                79.0    2e-15   
gb|AIT70255.1|  aspartate aminotransferase                            82.8    2e-15   
dbj|BAE99790.1|  aspartate aminotransferase                           80.9    3e-15   
emb|CDX72238.1|  BnaC07g42600D                                        80.1    3e-15   
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517               82.0    4e-15   
gb|AIT70257.1|  aspartate aminotransferase                            82.0    4e-15   
gb|KIK06942.1|  hypothetical protein K443DRAFT_673835                 82.0    5e-15   
ref|XP_001873821.1|  glutamic oxaloacetic transaminase AAT1           81.6    5e-15   
ref|XP_005535358.1|  aspartate aminotransferase                       82.0    5e-15   
gb|KJB64945.1|  hypothetical protein B456_010G072900                  81.3    6e-15   
ref|XP_010418279.1|  PREDICTED: aspartate aminotransferase, cytop...  81.3    6e-15   
gb|KGB35954.1|  Aspartate aminotransferase, mitochondrial             81.6    6e-15   
ref|XP_006302336.1|  hypothetical protein CARUB_v10020394mg           81.3    7e-15   
ref|XP_002391771.1|  hypothetical protein MPER_08751                  79.0    7e-15   
emb|CCG83496.1|  putative Aspartate transaminase                      81.3    7e-15   
ref|XP_004337430.1|  aspartate aminotransferase, mitochondrial, p...  76.3    9e-15   
ref|NP_849838.1|  aspartate aminotransferase 4                        80.9    9e-15   
ref|NP_564803.1|  aspartate aminotransferase 4                        80.9    9e-15   
gb|AAA79372.1|  aspartate aminotransferase                            80.9    9e-15   
ref|XP_006391820.1|  hypothetical protein EUTSA_v10023500mg           80.9    9e-15   
ref|XP_008555500.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   
ref|XP_007359882.1|  PLP-dependent transferase                        80.9    1e-14   
ref|XP_008220045.1|  PREDICTED: aspartate aminotransferase, cytop...  80.9    1e-14   
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115           80.9    1e-14   
gb|ADP03197.1|  aspartate transaminase                                79.7    1e-14   
gb|ADP03191.1|  aspartate transaminase                                79.7    1e-14   
gb|ADP03185.1|  aspartate transaminase                                79.7    1e-14   
gb|AIT70254.1|  aspartate aminotransferase                            80.5    1e-14   
ref|XP_640082.1|  aspartate aminotransferase                          80.9    1e-14   
ref|XP_002765977.1|  aspartate aminotransferase, cytoplasmic isoz...  78.6    1e-14   
gb|ADP03202.1|  aspartate transaminase                                79.7    1e-14   
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                 80.5    1e-14   
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475           80.5    1e-14   
gb|EJU05387.1|  aspartate aminotransferase                            80.1    2e-14   
gb|KIJ34684.1|  hypothetical protein M422DRAFT_213094                 80.5    2e-14   
gb|KDN41452.1|  hypothetical protein RSAG8_07402                      77.0    2e-14   
gb|KIM24154.1|  hypothetical protein M408DRAFT_76285                  80.1    2e-14   
gb|AIT70258.1|  aspartate aminotransferase                            79.7    2e-14   
emb|CDJ46758.1|  aspartate aminotransferase, putative                 77.8    2e-14   
ref|XP_003328962.1|  aspartate aminotransferase                       79.7    2e-14   
ref|XP_007265164.1|  glutamic oxaloacetic transaminase AAT1           79.7    2e-14   
ref|XP_010048111.1|  PREDICTED: aspartate aminotransferase, cytop...  79.3    2e-14   
ref|XP_002886453.1|  hypothetical protein ARALYDRAFT_475071           79.7    2e-14   
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                 79.7    2e-14   
ref|XP_010048110.1|  PREDICTED: aspartate aminotransferase, cytop...  79.7    3e-14   
ref|XP_007338662.1|  aspartate aminotransferase                       79.7    3e-14   
gb|AIT70253.1|  aspartate aminotransferase                            79.3    3e-14   
ref|XP_003038704.1|  hypothetical protein SCHCODRAFT_42521            79.3    3e-14   
ref|XP_007852807.1|  aspartate aminotransferase                       79.7    3e-14   
emb|CDY31847.1|  BnaC09g13020D                                        79.3    3e-14   
gb|KIK43563.1|  hypothetical protein CY34DRAFT_803728                 79.3    3e-14   
gb|KDR10996.1|  Aspartate aminotransferase, mitochondrial             79.3    4e-14   
ref|XP_001833338.2|  aspartate aminotransferase                       79.3    4e-14   
gb|AIT70267.1|  aspartate aminotransferase                            79.3    4e-14   
gb|KFH12158.1|  aspartate aminotransferase                            78.6    4e-14   
gb|KFH15985.1|  aspartate aminotransferase                            78.6    4e-14   
gb|KFG64384.1|  aspartate aminotransferase                            79.3    4e-14   
ref|XP_001828762.2|  aspartate Aminotransferase                       79.3    4e-14   
gb|AAW26878.1|  SJCHGC06163 protein                                   79.0    4e-14   
gb|EER39969.1|  aspartate aminotransferase                            77.4    4e-14   
emb|CAX69569.1|  glutamate oxaloacetate transaminase 2                79.0    4e-14   
ref|XP_005705870.1|  aspartate aminotransferase                       79.0    5e-14   
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                 79.0    5e-14   
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                79.0    5e-14   
ref|XP_009113043.1|  PREDICTED: aspartate aminotransferase, cytop...  78.6    5e-14   
emb|CDY46924.1|  BnaA09g12700D                                        78.6    5e-14   
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644           79.0    5e-14   
gb|ESA01319.1|  hypothetical protein GLOINDRAFT_338037                79.0    5e-14   
gb|KIV84393.1|  hypothetical protein PV11_00176                       79.0    5e-14   
ref|XP_002680594.1|  aspartate aminotransferase                       79.0    6e-14   
ref|XP_007223291.1|  hypothetical protein PRUPE_ppa005576mg           79.0    6e-14   
gb|ADP03187.1|  aspartate transaminase                                77.8    6e-14   
ref|XP_002764660.1|  aspartate aminotransferase, cytoplasmic, put...  78.6    6e-14   
ref|XP_008883875.1|  aspartate aminotransferase                       78.6    6e-14   
gb|KFG54125.1|  aspartate aminotransferase                            78.2    6e-14   
gb|KIJ27386.1|  hypothetical protein M422DRAFT_37801                  78.6    6e-14   
ref|XP_005822486.1|  hypothetical protein GUITHDRAFT_97799            78.6    6e-14   
gb|KEP52891.1|  aspartate aminotransferase                            78.6    6e-14   
gb|EPS28777.1|  hypothetical protein PDE_03723                        79.0    7e-14   
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15             78.6    7e-14   
gb|EJT99836.1|  aspartate aminotransferase                            78.2    8e-14   
dbj|GAM40234.1|  aspartate aminotransferase                           78.2    9e-14   
ref|XP_003706300.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    9e-14   
gb|EUC63953.1|  aspartate aminotransferase                            78.2    9e-14   
ref|XP_006454385.1|  glutamic oxaloacetic transaminase AAT1           78.2    1e-13   
ref|XP_002847042.1|  aspartate aminotransferase                       78.2    1e-13   
gb|EJT48226.1|  aspartate transaminase                                78.2    1e-13   
gb|EQL28128.1|  aspartate aminotransferase                            77.8    1e-13   
ref|XP_002622447.1|  aspartate aminotransferase                       77.8    1e-13   
gb|EEQ92028.1|  aspartate aminotransferase                            77.8    1e-13   
ref|XP_002428654.1|  aspartate aminotransferase, putative             77.8    1e-13   
ref|XP_002780422.1|  aspartate aminotransferase, putative             77.8    1e-13   
ref|XP_004339901.1|  aspartate aminotransferase, putative             77.8    1e-13   
emb|CDH49583.1|  aspartate aminotransferase                           77.8    1e-13   
ref|XP_004340638.1|  aspartate aminotransferase, cytoplasmic, put...  77.8    1e-13   
ref|XP_002780423.1|  aspartate aminotransferase, putative             77.4    1e-13   
emb|CDH50946.1|  aspartate aminotransferase                           77.8    1e-13   
gb|AIT70259.1|  aspartate aminotransferase                            77.8    1e-13   
emb|CDS12997.1|  Putative Aspartate aminotransferase                  77.8    1e-13   
ref|XP_010757441.1|  hypothetical protein PADG_01404                  77.8    1e-13   
gb|EEH20659.1|  hypothetical protein PABG_02890                       77.8    1e-13   
ref|XP_002791767.1|  aspartate aminotransferase                       77.8    1e-13   
gb|KIO06515.1|  hypothetical protein M404DRAFT_946120                 77.4    1e-13   
ref|XP_011302240.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.8    1e-13   
gb|AEI84602.1|  mitochondrial aspartate transaminase                  77.4    1e-13   
ref|XP_001826273.1|  aspartate aminotransferase, cytoplasmic          77.8    1e-13   
gb|KFG48451.1|  aspartate aminotransferase                            78.2    1e-13   
gb|EGE78706.1|  aspartate aminotransferase                            78.2    1e-13   
gb|KIM66148.1|  hypothetical protein SCLCIDRAFT_1211371               77.4    1e-13   
gb|KIM28774.1|  hypothetical protein M408DRAFT_16169                  77.4    1e-13   
ref|XP_002565847.1|  Pc22g19440                                       77.8    2e-13   
gb|KII93192.1|  hypothetical protein PLICRDRAFT_35377                 77.4    2e-13   
gb|EHA22111.1|  hypothetical protein ASPNIDRAFT_56390                 77.8    2e-13   
gb|KIR78943.1|  aspartate aminotransferase                            77.4    2e-13   
gb|KDR85045.1|  hypothetical protein GALMADRAFT_218131                77.4    2e-13   
gb|AIT70252.1|  aspartate aminotransferase                            77.4    2e-13   
ref|XP_002764661.1|  aspartate aminotransferase, cytoplasmic, put...  77.0    2e-13   
ref|XP_003169961.1|  aspartate aminotransferase                       77.4    2e-13   
ref|XP_002367206.1|  aspartate aminotransferase, putative             77.8    2e-13   
ref|XP_009269315.1|  Aspartate aminotransferase, cytoplasmic          77.0    2e-13   
ref|XP_006476085.1|  PREDICTED: aspartate aminotransferase, cytop...  77.0    2e-13   
gb|KIO33848.1|  hypothetical protein M407DRAFT_178303                 77.0    2e-13   
ref|XP_006458215.1|  hypothetical protein AGABI2DRAFT_190572          77.0    2e-13   
gb|KFG46516.1|  aspartate aminotransferase                            77.8    2e-13   
gb|KIJ68976.1|  hypothetical protein HYDPIDRAFT_172482                77.0    2e-13   
gb|EPT25025.1|  aspartate aminotransferase                            77.8    2e-13   
gb|EPR63537.1|  aspartate aminotransferase                            77.8    2e-13   
gb|KIH60318.1|  hypothetical protein ANCDUO_09436                     72.8    2e-13   
emb|CEP17012.1|  hypothetical protein                                 77.0    2e-13   
emb|CCO28043.1|  aspartate aminotransferase                           72.4    2e-13   
ref|XP_663652.1|  hypothetical protein AN6048.2                       77.0    2e-13   
gb|KIJ21699.1|  aspartate transaminase                                77.0    2e-13   
ref|XP_007326695.1|  hypothetical protein AGABI1DRAFT_111350          76.6    2e-13   
gb|EMD38441.1|  hypothetical protein CERSUDRAFT_82693                 76.6    3e-13   
ref|XP_002482531.1|  aspartate transaminase, putative                 77.0    3e-13   
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                 76.6    3e-13   
ref|XP_002148269.1|  aspartate transaminase, putative                 77.0    3e-13   
emb|CEG05709.1|  unnamed protein product                              76.6    3e-13   
ref|XP_006959708.1|  PLP-dependent transferase                        76.6    3e-13   
gb|EGE09449.1|  aspartate transaminase                                75.1    3e-13   
ref|XP_008729478.1|  hypothetical protein G647_06938                  76.6    3e-13   
gb|KFX51903.1|  Aspartate aminotransferase, cytoplasmic               77.0    3e-13   
gb|KIM48153.1|  hypothetical protein M413DRAFT_439876                 76.6    3e-13   
gb|KIY72818.1|  hypothetical protein CYLTODRAFT_417594                76.6    3e-13   
ref|XP_002516565.1|  aspartate aminotransferase, putative             76.6    3e-13   
gb|AEI84593.1|  mitochondrial aspartate transaminase                  76.3    3e-13   
ref|XP_007273893.1|  aspartate aminotransferase                       76.3    3e-13   
ref|XP_007722546.1|  aspartate aminotransferase                       77.0    3e-13   
gb|AEI84598.1|  mitochondrial aspartate transaminase                  76.3    3e-13   
gb|AGR65730.1|  aspartate aminotransferase                            76.6    3e-13   
gb|AEI84589.1|  mitochondrial aspartate transaminase                  76.3    3e-13   
gb|AEI84591.1|  mitochondrial aspartate transaminase                  76.3    3e-13   
ref|XP_007004780.1|  hypothetical protein TREMEDRAFT_68635            76.6    3e-13   
gb|AEI84595.1|  mitochondrial aspartate transaminase                  76.3    3e-13   
ref|XP_007757790.1|  aspartate aminotransferase                       76.6    3e-13   
gb|AIT70262.1|  aspartate aminotransferase                            76.6    3e-13   
gb|KIJ16826.1|  aspartate transaminase                                76.3    4e-13   
dbj|GAN10535.1|  aspartate aminotransferase protein                   76.6    4e-13   
ref|XP_004337429.1|  mitochondrial aspartate aminotransferase         76.3    4e-13   
emb|CDS05732.1|  Putative Aspartate aminotransferase                  76.6    4e-13   
gb|KGO77057.1|  Pyridoxal phosphate-dependent transferase, major ...  76.3    4e-13   
gb|EQB50289.1|  aminotransferase class I and II                       76.3    4e-13   
ref|XP_007301170.1|  aspartate aminotransferase                       76.3    4e-13   
gb|KIR50768.1|  aspartate aminotransferase                            76.3    4e-13   
ref|XP_003197192.1|  aspartate transaminase                           76.3    4e-13   
ref|XP_003886076.1|  Contig An16c0190, complete genome. (Precurso...  76.3    4e-13   
gb|KIR82897.1|  aspartate aminotransferase                            76.3    4e-13   
gb|KDB13308.1|  aspartate aminotransferase                            76.3    4e-13   
gb|KIR44346.1|  aspartate aminotransferase                            76.3    4e-13   
gb|AFR98265.1|  aspartate aminotransferase                            76.3    4e-13   
gb|KIK23391.1|  hypothetical protein PISMIDRAFT_649018                76.3    4e-13   
gb|EGC45263.1|  aspartate aminotransferase                            76.3    4e-13   
ref|XP_005842469.1|  hypothetical protein GUITHDRAFT_83779            76.3    4e-13   
gb|EDP54494.1|  aspartate transaminase, putative                      76.6    4e-13   
ref|XP_755298.1|  aspartate transaminase                              76.6    4e-13   
gb|KEY79534.1|  aspartate transaminase                                76.6    4e-13   
ref|XP_001536357.1|  aspartate aminotransferase                       76.3    4e-13   
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...  76.3    5e-13   
emb|CDS04038.1|  hypothetical protein LRAMOSA06993                    75.9    5e-13   
gb|KGB78925.1|  aspartate transaminase                                75.9    5e-13   
ref|XP_001275272.1|  aspartate transaminase, putative                 75.9    5e-13   
gb|KIJ68385.1|  hypothetical protein HYDPIDRAFT_173129                76.3    5e-13   
gb|KIR97164.1|  aspartate aminotransferase                            75.9    5e-13   
ref|XP_009163630.1|  hypothetical protein T265_01360                  75.9    5e-13   
gb|KIP12008.1|  hypothetical protein PHLGIDRAFT_27620                 75.9    5e-13   
ref|XP_009052331.1|  hypothetical protein LOTGIDRAFT_231665           75.9    5e-13   
ref|XP_006476084.1|  PREDICTED: aspartate aminotransferase, cytop...  75.9    5e-13   
gb|EKV09426.1|  Aspartate transaminase, putative                      75.9    5e-13   
ref|XP_009159475.1|  aspartate aminotransferase                       75.9    5e-13   
ref|XP_646849.1|  aspartate aminotransferase                          75.9    5e-13   
gb|AGG09850.1|  mitochondrial aspartate aminotransferase              71.2    5e-13   
gb|EZF36094.1|  hypothetical protein H101_00376                       75.5    5e-13   
gb|EPB81943.1|  aspartate aminotransferase                            75.9    5e-13   
gb|KFH67254.1|  aspartate aminotransferase                            75.9    5e-13   
dbj|GAA55746.1|  aspartate aminotransferase cytoplasmic               73.2    5e-13   
gb|AEI84600.1|  mitochondrial aspartate transaminase                  75.5    5e-13   
gb|KIM55879.1|  hypothetical protein SCLCIDRAFT_133726                75.9    6e-13   
emb|CDJ39270.1|  aspartate aminotransferase, putative                 75.9    6e-13   
gb|EKD02362.1|  aspartate aminotransferase                            75.9    6e-13   
ref|NP_998544.1|  aspartate aminotransferase 2a                       75.9    6e-13   
gb|EJT52984.1|  aspartate aminotransferase, precursor                 75.9    6e-13   
ref|XP_009058471.1|  hypothetical protein LOTGIDRAFT_217673           75.9    6e-13   
ref|XP_005342923.1|  PREDICTED: aspartate aminotransferase, mitoc...  71.2    6e-13   
emb|CDJ68778.1|  aspartate aminotransferase, putative                 75.1    7e-13   
gb|KFH62511.1|  aspartate aminotransferase                            75.9    7e-13   
gb|EMD41819.1|  hypothetical protein CERSUDRAFT_128978                75.5    7e-13   
dbj|GAA85105.1|  aspartate transaminase                               75.5    7e-13   
ref|XP_003390732.1|  PREDICTED: aspartate aminotransferase, cytop...  75.1    7e-13   
ref|XP_001655159.1|  AAEL002399-PA                                    75.5    7e-13   
ref|XP_001260457.1|  aspartate transaminase, putative                 75.9    8e-13   
ref|XP_007321884.1|  hypothetical protein SERLADRAFT_475342           75.5    8e-13   
gb|EGD95227.1|  aspartate aminotransferase                            75.5    8e-13   
ref|XP_001397865.2|  aspartate aminotransferase, cytoplasmic          75.9    8e-13   
ref|XP_008347631.1|  PREDICTED: aspartate aminotransferase, cytop...  75.5    8e-13   
emb|CDM27766.1|  Aspartate aminotransferase, cytoplasmic              75.5    8e-13   
ref|XP_011401594.1|  Aspartate aminotransferase 1                     75.1    8e-13   



>dbj|BAD02268.1| aspartate aminotransferase [Nicotiana tabacum]
Length=227

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW +ILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAG
Sbjct  147  VRQKLYDSLSAKDKSGKDWPYILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAG  206

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LSAAKCEYLADAIIDSYYNVS
Sbjct  207  LSAAKCEYLADAIIDSYYNVS  227



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW++ILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAG
Sbjct  382  VRQKLYDSLSTKDKSGKDWSYILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAG  441

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LSAAKCEYLADAIIDSYYNVS
Sbjct  442  LSAAKCEYLADAIIDSYYNVS  462



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW+FILKQIGMFSFTGLNKAQSENM++KWH+YMTKDGRISLAG
Sbjct  389  VRQKLYDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSENMADKWHVYMTKDGRISLAG  448

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LSAAKCEYLADAIIDSYYNVS
Sbjct  449  LSAAKCEYLADAIIDSYYNVS  469



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW+FILKQIGMFSFTGLNKAQSENM++KWH+YMTKDGRISLAG
Sbjct  382  VRQKLYDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSENMADKWHVYMTKDGRISLAG  441

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LSAAKCEYLADAIIDSYYNVS
Sbjct  442  LSAAKCEYLADAIIDSYYNVS  462



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGK+W+FILKQIGMFSFTGL++AQSENM+NKWH+YMTKDGRISLAG
Sbjct  382  VRQKLYDSLSAKDKSGKNWSFILKQIGMFSFTGLDRAQSENMANKWHVYMTKDGRISLAG  441

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LSAAKCEYLADAIIDSYYNVS
Sbjct  442  LSAAKCEYLADAIIDSYYNVS  462



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAG
Sbjct  390  VRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAG  449

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  450  LSLAKCEYLADAIIDSYHNVS  470



>dbj|BAD94538.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=187

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  107  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  166

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  167  LSLAKCEYLADAIIDSYHNVS  187



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  386  VRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  445

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  446  LSLAKCEYLADAIIDSYHNVS  466



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  386  VRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  445

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  446  LSLAKCEYLADAIIDSYHNVS  466



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FILKQIGMFSFTGLNK QSENM+NKWH+YMTKDGRISLAG
Sbjct  386  VRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLNKTQSENMTNKWHVYMTKDGRISLAG  445

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  446  LSLAKCEYLADAIIDSYHNVS  466



>gb|AFK46621.1| unknown [Lotus japonicus]
Length=241

 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDS+S KDKSGKDW+FIL+QIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  161  VRQKLYDSISSKDKSGKDWSFILEQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAG  220

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  221  LSLAKCEYLADAIIDSYHNVS  241



>ref|XP_010042868.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Eucalyptus grandis]
Length=120

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL DSLS KDKSGKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAG
Sbjct  40   VRQKLNDSLSAKDKSGKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAG  99

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYLADAI+DSY+NVS
Sbjct  100  LNLAKCEYLADAIVDSYHNVS  120



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  330  VRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  389

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  390  LSLAKCEYLADAIIDSYHNVS  410



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  379  VRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  438

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  439  LSLAKCEYLADAIIDSYHNVS  459



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYD+L  KDKSGKDW++ILKQIGMFSFTGLNKAQS+NM+NKWHIYMTKDGRISLAG
Sbjct  379  VRQKLYDNLISKDKSGKDWSYILKQIGMFSFTGLNKAQSDNMTNKWHIYMTKDGRISLAG  438

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LSAAKCEYLADAIIDSYYNVS
Sbjct  439  LSAAKCEYLADAIIDSYYNVS  459



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYD+LS KDK+GKDW+F+L+QIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG
Sbjct  384  VRQRLYDNLSAKDKTGKDWSFVLRQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS +KCEYLADAI+DSYYNVS
Sbjct  444  LSLSKCEYLADAIVDSYYNVS  464



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  387  VRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  446

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  447  LSLAKCEYLADAIIDSYHNVS  467



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYD+LS KDK+GKDW+F+L+QIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG
Sbjct  373  VRQRLYDNLSAKDKTGKDWSFVLRQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS +KCEYLADAI+DSYYNVS
Sbjct  433  LSLSKCEYLADAIVDSYYNVS  453



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYD+L+ KDKSGKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAG
Sbjct  384  VRQKLYDNLTAKDKSGKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYL+DAIIDSY+NVS
Sbjct  444  LSLAKCEYLSDAIIDSYHNVS  464



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   159 bits (401),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  469  VRQKLYDSLRAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  528

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS+AKCEYLADAI DSY+NVS
Sbjct  529  LSSAKCEYLADAIFDSYHNVS  549



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYD+L+ KDKSGKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAG
Sbjct  384  VRQKLYDNLTAKDKSGKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYL+DAIIDSY+NVS
Sbjct  444  LSLAKCEYLSDAIIDSYHNVS  464



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  373  VRQKLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSLAKCEYLADAIIDSYHNVS  453



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR+KLYDSLS KD SGKDW+F+LKQIGMFSFTGLN AQSENM+NKWH+YMTKDGRISLAG
Sbjct  371  VRKKLYDSLSAKDNSGKDWSFVLKQIGMFSFTGLNDAQSENMTNKWHVYMTKDGRISLAG  430

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS+AKCEYLADAIIDSYYN+S
Sbjct  431  LSSAKCEYLADAIIDSYYNIS  451



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FILKQIGMFSFTGL K QSENM+NKWH+YMTKDGRISLAG
Sbjct  386  VRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLTKTQSENMTNKWHVYMTKDGRISLAG  445

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  446  LSLAKCEYLADAIIDSYHNVS  466



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  373  VRQRLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSMAKCEYLADAIIDSYHNVS  453



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAG
Sbjct  386  VRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAG  445

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  446  LSLAKCEYLADAIIDSYHNVS  466



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  373  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSMAKCEYLADAIIDSYHNVS  453



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  373  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSMAKCEYLADAIIDSYHNVS  453



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  415  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  474

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  475  LSMAKCEYLADAIIDSYHNVS  495



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  373  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSLAKCEYLADAIIDSYHNVS  453



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW+FILKQIGMFS+TGLNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  384  VRQKLYDSLSAKDKSGKDWSFILKQIGMFSYTGLNKTQSDNMTNKWHVYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  444  LSLAKCEYLADAIIDSYHNVS  464



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDS+S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  377  VRQKLYDSISSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAG  436

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  437  LSLAKCEYLADAIIDSYHNVS  457



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAG
Sbjct  375  VRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAG  434

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  435  LSLAKCEYLADAIIDSYHNVS  455



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  373  VRQKLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSLAKCEYLADAIIDSYHNVS  453



>prf||1908424A Asp aminotransferase
Length=465

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAG
Sbjct  385  VRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAG  444

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  445  LSLAKCEYLADAIIDSYHNVS  465



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAG
Sbjct  385  VRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAG  444

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  445  LSLAKCEYLADAIIDSYHNVS  465



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYD+L+  DKSGKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAG
Sbjct  384  VRQKLYDNLTATDKSGKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYL+DAIIDSY+NVS
Sbjct  444  LSLAKCEYLSDAIIDSYHNVS  464



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LY +LS KDKSGKDW+F+L+QIGMFSFTGLNKAQSENMS+KWHIYMTKDGRISLAG
Sbjct  330  VRQRLYANLSAKDKSGKDWSFVLRQIGMFSFTGLNKAQSENMSSKWHIYMTKDGRISLAG  389

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS +KCEYLADAIIDSYYNVS
Sbjct  390  LSLSKCEYLADAIIDSYYNVS  410



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWHIYMTKDGRISLAG
Sbjct  387  VRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHIYMTKDGRISLAG  446

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  447  LSLAKCEYLADAIIDSYHNVS  467



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  373  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSMAKCEYLADAIIDSYHNVS  453



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  368  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  427

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  428  LSLAKCEYLADAIIDSYHNVS  448



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDS++ KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  383  VRQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAG  442

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  443  LSLAKCEYLADAIIDSYHNVS  463



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDS++ KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  383  VRQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAG  442

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  443  LSLAKCEYLADAIIDSYHNVS  463



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  373  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSLAKCEYLADAIIDSYHNVS  453



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  373  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSLAKCEYLADAIIDSYHNVS  453



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR KL+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAG
Sbjct  380  VRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAG  439

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  440  LSLAKCEYLADAIIDSYHNVS  460



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  385  VRQLLYDSISSKDKSGKDWSFILKQIGMFSFTGLNKEQSDNMTNKWHVYMTKDGRISLAG  444

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  445  LSLAKCEYLADAIIDSYHNVS  465



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR KL+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAG
Sbjct  380  VRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAG  439

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  440  LSLAKCEYLADAIIDSYHNVS  460



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  373  VRQKLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS AKCEYLADAIIDSY+N
Sbjct  433  LSLAKCEYLADAIIDSYHN  451



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAG
Sbjct  384  VRQKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNV  242
            LS AKCEYLADAIIDSY+NV
Sbjct  444  LSLAKCEYLADAIIDSYHNV  463



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR+KLYDSL  KD SGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  382  VRKKLYDSLCAKDNSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  441

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS+A CEYLADAIIDSY+NVS
Sbjct  442  LSSANCEYLADAIIDSYHNVS  462



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR+KLYDSL  KD SGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  383  VRKKLYDSLCAKDNSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  442

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS+A CEYLADAIIDSY+NVS
Sbjct  443  LSSANCEYLADAIIDSYHNVS  463



>ref|XP_007161154.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
 gb|ESW33148.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
Length=261

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LY+S++ KD SGKDW+FILKQIGMFSFTGLNK Q++NM+NKWH+YMTKDGRISLAG
Sbjct  181  VRQQLYNSITSKDNSGKDWSFILKQIGMFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAG  240

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  241  LSLAKCEYLADAIIDSYHNVS  261



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  373  VRQQLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDS++NVS
Sbjct  433  LSMAKCEYLADAIIDSHHNVS  453



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FILKQIGMFSFTGLN+AQS+ M+NKWH+YMTKDGRISLAG
Sbjct  402  VRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLNEAQSDKMTNKWHVYMTKDGRISLAG  461

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDS++NVS
Sbjct  462  LSLAKCEYLADAIIDSFHNVS  482



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAG
Sbjct  382  VRQKLYDSLSAKDKSGKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAG  441

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCE LADAI+DSY+NVS
Sbjct  442  LNLAKCEDLADAIVDSYHNVS  462



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDS++ KDKSGKDW+FILKQIGMFSFTGLN  QS+NM+NKWH+YMTKDGRISLAG
Sbjct  383  VRQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNTNQSDNMTNKWHVYMTKDGRISLAG  442

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  443  LSLAKCEYLADAIIDSYHNVS  463



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  377  VRQKLYDSLSAKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAG  436

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKC+YLADAIIDS++NVS
Sbjct  437  LSLAKCDYLADAIIDSFHNVS  457



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL DSLS KDKSGKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAG
Sbjct  381  VRQKLNDSLSAKDKSGKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAG  440

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYLADAI+DSY+NVS
Sbjct  441  LNLAKCEYLADAIVDSYHNVS  461



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQ-SENMSNKWHIYMTKDGRISLA  179
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQ S+NM+NKWH+YMTKDGRISLA
Sbjct  373  VRQRLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQQSDNMTNKWHVYMTKDGRISLA  432

Query  180  GLSAAKCEYLADAIIDSYYNVS  245
            GLS AKCEYLADAIIDSY+NVS
Sbjct  433  GLSMAKCEYLADAIIDSYHNVS  454



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS+KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  378  VRQKLYDSLSVKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAG  437

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKC+YLADAIIDS++NV+
Sbjct  438  LSLAKCDYLADAIIDSFHNVN  458



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+L+D LS KDKSGKDW+FILKQIGMFSFTGLNKAQSE+M+NKWH+YMTKDGRISLAG
Sbjct  374  VRQRLFDYLSRKDKSGKDWSFILKQIGMFSFTGLNKAQSEHMTNKWHVYMTKDGRISLAG  433

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS +KCEYLADAIIDS++NVS
Sbjct  434  LSLSKCEYLADAIIDSFHNVS  454



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KD SGKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAG
Sbjct  342  VRQKLYDSLSAKDNSGKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAG  401

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDS++NVS
Sbjct  402  LSLAKCEYLADAIIDSFHNVS  422



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWHIYMTKDGRISLAG
Sbjct  379  VRQKLYDSLSAKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHIYMTKDGRISLAG  438

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKC+YLADAIIDS++NV+
Sbjct  439  LSLAKCDYLADAIIDSFHNVN  459



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWHIYMTKDGRISLAG
Sbjct  379  VRQKLYDSLSAKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHIYMTKDGRISLAG  438

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKC+YLADAIIDS++NV+
Sbjct  439  LSLAKCDYLADAIIDSFHNVN  459



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KD SGKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAG
Sbjct  334  VRQKLYDSLSAKDDSGKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAG  393

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDS++NVS
Sbjct  394  LSLAKCEYLADAIIDSFHNVS  414



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDS++ KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRIS AG
Sbjct  383  VRQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISSAG  442

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  443  LSLAKCEYLADAIIDSYHNVS  463



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+L+D LS KDKSGKDW+FILKQIGMFSFTGLNKAQSE+M+NKWH+YMTKDGRISLAG
Sbjct  358  VRQRLFDYLSRKDKSGKDWSFILKQIGMFSFTGLNKAQSEHMTNKWHVYMTKDGRISLAG  417

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS +KCEYLADAIIDS++NVS
Sbjct  418  LSLSKCEYLADAIIDSFHNVS  438



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR KL+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAG
Sbjct  316  VRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAG  375

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+N S
Sbjct  376  LSLAKCEYLADAIIDSYHNGS  396



>prf||2009357A Asp aminotransferase
Length=463

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENM-SNKWHIYMTKDGRISLA  179
            VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM +NKWHIYMTKDGRISLA
Sbjct  382  VRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMMTNKWHIYMTKDGRISLA  441

Query  180  GLSAAKCEYLADAIIDSYYNVS  245
            GLS AKCEYLADAIIDSY+NVS
Sbjct  442  GLSLAKCEYLADAIIDSYHNVS  463



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  373  VRQQLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS AKCEYLADAIIDSY+N
Sbjct  433  LSMAKCEYLADAIIDSYHN  451



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KD SGKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAG
Sbjct  378  VRQKLYDSLSAKDDSGKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAG  437

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDS++NVS
Sbjct  438  LSLAKCEYLADAIIDSFHNVS  458



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  373  VRQQLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS AKCEYLADAIIDSY+N
Sbjct  433  LSMAKCEYLADAIIDSYHN  451



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYD LS KDKSGKDW+F+LKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  381  VRQRLYDELSTKDKSGKDWSFVLKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  440

Query  183  LSAAKCEYLADAIIDSYYNV  242
            L+ AKC YLADAIIDSYYN+
Sbjct  441  LNLAKCAYLADAIIDSYYNI  460



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR KL+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAG
Sbjct  384  VRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+N S
Sbjct  444  LSLAKCEYLADAIIDSYHNGS  464



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR KL+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAG
Sbjct  388  VRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAG  447

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+N S
Sbjct  448  LSLAKCEYLADAIIDSYHNGS  468



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  373  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS AKCEYLADAIIDSY+N
Sbjct  433  LSLAKCEYLADAIIDSYHN  451



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM++KWH+Y TKDGRISLAG
Sbjct  373  VRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMTDKWHVYXTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  433  LSLAKCEYLADAIIDSYHNVS  453



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LY+S++ KD SGKDW+FILKQIGMFSFTGLNK Q++NM+NKWH+YMTKDGRISLAG
Sbjct  381  VRQQLYNSITSKDNSGKDWSFILKQIGMFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAG  440

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  441  LSLAKCEYLADAIIDSYHNVS  461



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDK GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAG
Sbjct  382  VRQKLFDSLSAKDKCGKDWSFILKQIGMFSFTGLSKVQSENMTNKWHVYMTKDGRISLAG  441

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDS++ VS
Sbjct  442  LSLAKCEYLADAIIDSFHCVS  462



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+DSLS KDK GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAG
Sbjct  382  VRQKLFDSLSAKDKCGKDWSFILKQIGMFSFTGLSKVQSENMTNKWHVYMTKDGRISLAG  441

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDS++ VS
Sbjct  442  LSLAKCEYLADAIIDSFHCVS  462



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR++L+++LS KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAG
Sbjct  389  VRKRLFENLSQKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAG  448

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS +KCEYLADAIIDSY+NV+
Sbjct  449  LSLSKCEYLADAIIDSYHNVN  469



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAG
Sbjct  424  VRQQLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAG  483

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS AKCEYLADAIIDSY+N
Sbjct  484  LSMAKCEYLADAIIDSYHN  502



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR KL+DSLS +DKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+ KWHIYMTKDGRISLAG
Sbjct  384  VRDKLFDSLSSEDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMTTKWHIYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  444  LSLAKCEYLADAIIDSYHNVS  464



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDS++ KDKSGKDW+FILKQIGMFSFT LNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  383  VRQQLYDSITSKDKSGKDWSFILKQIGMFSFTSLNKNQSDNMTNKWHVYMTKDGRISLAG  442

Query  183  LSAAKCEYLADAIIDSYYNV  242
            LS AKCEYLADAIIDSY+NV
Sbjct  443  LSLAKCEYLADAIIDSYHNV  462



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAG
Sbjct  330  VRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAG  389

Query  183  LSAAKCEYLADAIIDSYYNV  242
            LS AKCEYLADAIIDS++NV
Sbjct  390  LSLAKCEYLADAIIDSFHNV  409



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR KL+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAG
Sbjct  416  VRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAG  475

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+N S
Sbjct  476  LSLAKCEYLADAIIDSYHNGS  496



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAG
Sbjct  385  VRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAG  444

Query  183  LSAAKCEYLADAIIDSYYNV  242
            LS AKCEYLADAIIDS++NV
Sbjct  445  LSLAKCEYLADAIIDSFHNV  464



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAG
Sbjct  384  VRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAG  443

Query  183  LSAAKCEYLADAIIDSYYNV  242
            LS AKCEYLADAIIDS++NV
Sbjct  444  LSLAKCEYLADAIIDSFHNV  463



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL  KDKSGKDW+FILKQIGMFSFTGLN  Q+ENM+ KWH++MTKDGRISLAG
Sbjct  373  VRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLNTTQTENMTKKWHVFMTKDGRISLAG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYL+DAIIDSY+NVS
Sbjct  433  LNLAKCEYLSDAIIDSYHNVS  453



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQ-SENMSNKWHIYMTKDGRISLA  179
            VRQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQ S+NM+NKWH+YMTKDGRISLA
Sbjct  373  VRQRLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQQSDNMTNKWHVYMTKDGRISLA  432

Query  180  GLSAAKCEYLADAIIDSYYN  239
            GLS AKCEYLADAIIDSY+N
Sbjct  433  GLSMAKCEYLADAIIDSYHN  452



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDS+S KDKSGKDW+FILKQIGMFS+TGLNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  374  VRQQLYDSISSKDKSGKDWSFILKQIGMFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAG  433

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDS++ VS
Sbjct  434  LSLAKCEYLADAIIDSFHYVS  454



>dbj|BAJ97030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAG
Sbjct  265  VRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAG  324

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYLADAIIDS++NV+
Sbjct  325  LNLAKCEYLADAIIDSFHNVN  345



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAG
Sbjct  388  VRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAG  447

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYLADAIIDS++NV+
Sbjct  448  LNLAKCEYLADAIIDSFHNVN  468



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ LYD +S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+ MTKDGRIS AG
Sbjct  385  VRQLLYDPISSKDKSGKDWSFILKQIGMFSFTGLNKEQSDNMTNKWHVLMTKDGRISPAG  444

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  445  LSLAKCEYLADAIIDSYHNVS  465



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAG
Sbjct  377  VRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAG  436

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYLADAIIDS++NV+
Sbjct  437  LNLAKCEYLADAIIDSFHNVN  457



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAG
Sbjct  403  VRQKLYDSLTEKDQSGKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAG  462

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYLADAIIDS++NV+
Sbjct  463  LNLAKCEYLADAIIDSFHNVN  483



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSLS KD+SGKDW+FIL QIGMFS+TGLN+ QS+NM++KWHIYMTKDGRISLAG
Sbjct  375  VRQKLYDSLSAKDQSGKDWSFILSQIGMFSYTGLNRNQSDNMTDKWHIYMTKDGRISLAG  434

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYLADAIIDS++NV+
Sbjct  435  LNLAKCEYLADAIIDSFHNVN  455



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAG
Sbjct  377  VRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAG  436

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            L+ AKCEYLA+AIIDS++NV+
Sbjct  437  LNLAKCEYLAEAIIDSFHNVN  457



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLY++L  KDKSGKDW+FILKQIGMFSFTGL K+QS+NM++KWH+YMTKDGRISLAG
Sbjct  330  VRQKLYEALLSKDKSGKDWSFILKQIGMFSFTGLTKSQSDNMTDKWHVYMTKDGRISLAG  389

Query  183  LSAAKCEYLADAIIDSYYNV  242
            L+ AKC+YLADAIIDSYYNV
Sbjct  390  LNLAKCDYLADAIIDSYYNV  409



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLY++L  KDKSGKDW+FILKQIGMFSFTGL K+QS+NM++KWH+YMTKDGRISLAG
Sbjct  330  VRQKLYEALLSKDKSGKDWSFILKQIGMFSFTGLTKSQSDNMTDKWHVYMTKDGRISLAG  389

Query  183  LSAAKCEYLADAIIDSYYNV  242
            L+ AKC+YLADAIIDSYYNV
Sbjct  390  LNLAKCDYLADAIIDSYYNV  409



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+L+D LS KDKSGKDW+FILKQIGMFSFTGLNKAQS++M+NKW +YMTKDGRISLAG
Sbjct  374  VRQRLFDYLSQKDKSGKDWSFILKQIGMFSFTGLNKAQSDHMTNKWRVYMTKDGRISLAG  433

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS +KCEYLADAI+DS++NVS
Sbjct  434  LSLSKCEYLADAIMDSFHNVS  454



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LY++LS KDKSGKDW+F+LKQIGMFS+TGL+KAQS++M++KWHIYMTKDGRISLAG
Sbjct  345  VRQRLYENLSQKDKSGKDWSFVLKQIGMFSYTGLHKAQSDHMTDKWHIYMTKDGRISLAG  404

Query  183  LSAAKCEYLADAIIDSYYNV  242
            LS +KCEYLADAIIDS++NV
Sbjct  405  LSLSKCEYLADAIIDSFHNV  424



>gb|ACG59771.1| chloroplast aspartate aminotransferase [Triticum aestivum]
Length=368

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKLYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAG
Sbjct  295  VRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAG  354

Query  183  LSAAKCEYLADAII  224
            L+ AKCEYLADAII
Sbjct  355  LNLAKCEYLADAII  368



>gb|EPS71467.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=133

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR+ LY+ LS  D +GKDW+FIL+QIGMFSFTGLNK QSE M+ KWH+YMTKDGRISLAG
Sbjct  55   VRKLLYEELSRSDGTGKDWSFILRQIGMFSFTGLNKEQSEKMTGKWHVYMTKDGRISLAG  114

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS+AKC YLA AI+DSY+N
Sbjct  115  LSSAKCSYLAGAIVDSYHN  133



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L++SLS KD+SG+DW+FI+K+ G+FSF GLNKAQ +NM NKWH+YM KDGR+SL G
Sbjct  373  LRQRLFESLSCKDRSGRDWSFIVKENGIFSFIGLNKAQIDNMRNKWHVYMIKDGRMSLGG  432

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS ++CEYLADAIIDS++NVS
Sbjct  433  LSLSQCEYLADAIIDSFHNVS  453



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR+KLYD LS KD SGKDW+F +K IGM+S++GLN+AQ ENM NKWH+YMTKDGR++L G
Sbjct  326  VRKKLYDCLSAKDMSGKDWSFFVKHIGMYSYSGLNEAQRENMRNKWHVYMTKDGRMALTG  385

Query  183  LSAAKCEYLADAIIDSYYNV  242
            +S AKCEYLADA IDSY+ V
Sbjct  386  VSQAKCEYLADAFIDSYHYV  405



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ+LYDS++ KDKSG+  +       +    GLNK QS+NM+NKWH+YMTKDGRISLAG
Sbjct  383  VRQQLYDSITSKDKSGQSASQYPDNCVLPFIPGLNKNQSDNMTNKWHVYMTKDGRISLAG  442

Query  183  LSAAKCEYLADAIIDSYYNVS  245
            LS AKCEYLADAIIDSY+NVS
Sbjct  443  LSLAKCEYLADAIIDSYHNVS  463



>ref|XP_008784800.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=386

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 73/120 (61%), Gaps = 39/120 (33%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQS---------------------  119
            +RQ+L++SLS KD+SG+DW+FI+K+ G+FSF GLNKAQ                      
Sbjct  267  LRQRLFESLSCKDRSGRDWSFIVKENGIFSFIGLNKAQISNPHGSAYQIAHALAVSVFLI  326

Query  120  ------------------ENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  245
                              +NM NKWH+YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  327  LHAFWYVLHCVFVRLSQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  386



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 73/120 (61%), Gaps = 39/120 (33%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQS---------------------  119
            +RQ+L++SLS KD+SG+DW+FI+K+ G+FSF GLNKAQ                      
Sbjct  373  LRQRLFESLSCKDRSGRDWSFIVKENGIFSFIGLNKAQISNPHGSAYQIAHALAVSVFLI  432

Query  120  ------------------ENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  245
                              +NM NKWH+YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  433  LHAFWYVLHCVFVRLSQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  492



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ LYD+L ++    KDW+F+LKQIGMF+FTG+   Q +NM+NKWH+YMTKDGR+SLAG
Sbjct  363  VRQDLYDAL-VEINPDKDWSFVLKQIGMFTFTGMTPQQCDNMTNKWHVYMTKDGRLSLAG  421

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS+AK  YLA AI DS  N
Sbjct  422  LSSAKAAYLARAIDDSVRN  440



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ L+D L+ K    KDW+FIL+Q+GMFSFTGLN AQ +NM+NK HIYMTKDGRISLAG
Sbjct  375  VRQVLHDELA-KLNGDKDWSFILRQLGMFSFTGLNPAQVDNMTNKHHIYMTKDGRISLAG  433

Query  183  LSAAKCEYLADAIIDSYYN  239
            L ++K  YLA AI DS+ N
Sbjct  434  LPSSKAAYLAAAIDDSFRN  452



>ref|XP_005843806.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
 gb|EFN51704.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
Length=406

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LY +L      G DW  IL+QIGMFS+TGL KAQ ENM+NKWH+YMT DGRIS+AG
Sbjct  328  MRQQLYQALQEVGAPG-DWGHILRQIGMFSYTGLTKAQVENMTNKWHVYMTFDGRISMAG  386

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS++KC YLA A+ DS  N
Sbjct  387  LSSSKCGYLAQAMKDSVEN  405



>ref|XP_001695040.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP02192.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=433

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ LY  L  +   G DW+F+LKQIGMFS+TGL+KAQ E ++ KWHI++T DGRIS+AG
Sbjct  352  MRQALYGQLVARQLPG-DWSFVLKQIGMFSYTGLSKAQCEVLTRKWHIHLTMDGRISMAG  410

Query  183  LSAAKCEYLADAIIDSYYN  239
            LSAA C YLA+AI D   N
Sbjct  411  LSAASCPYLAEAIADVVTN  429



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR  LYD+L  K    KDW+F+ +QIGMFSFTGLN  Q ++M+ K  IYMT DGRISLAG
Sbjct  332  VRAMLYDNL-CKLNPDKDWSFVTRQIGMFSFTGLNPNQVKHMTEKHAIYMTGDGRISLAG  390

Query  183  LSAAKCEYLADAIIDSY  233
            LS AKCEYLA+AI+DS+
Sbjct  391  LSQAKCEYLANAIVDSF  407



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 5/79 (6%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQ LYD L+    S KDW+FI    GMFSFTGL+  Q ENM+NKWH++MTKDGRISLAG
Sbjct  312  VRQDLYDHLTRLLPS-KDWSFI----GMFSFTGLSPQQVENMTNKWHVFMTKDGRISLAG  366

Query  183  LSAAKCEYLADAIIDSYYN  239
            L+ AK  YLA+AI+DS  N
Sbjct  367  LNRAKAGYLAEAIVDSVQN  385



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR +L  SL  K  S KDW+FI KQIGMFSFTGL  AQ +NM+NK  I+MT+DGRISLAG
Sbjct  350  VRGELQRSLESKYPS-KDWSFITKQIGMFSFTGLTPAQVDNMTNKHAIFMTRDGRISLAG  408

Query  183  LSAAKCEYLADAIIDSYYN  239
            L++AK +YLA+AI+DS  N
Sbjct  409  LNSAKVDYLAEAIVDSVRN  427



>ref|XP_002954714.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ44120.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=426

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ LYD L  ++  G DW+F+LKQIGMFSFTG+ + Q E + +KWH+++T DGRIS+AG
Sbjct  348  MRQVLYDQLVARNVPG-DWSFVLKQIGMFSFTGMTRHQCEQLVSKWHVHLTLDGRISMAG  406

Query  183  LSAAKCEYLADAIIDSYYN  239
            LSAA   YLA+AI D   N
Sbjct  407  LSAATAPYLAEAIADVIQN  425



>ref|XP_001771002.1| predicted protein [Physcomitrella patens]
 gb|EDQ64157.1| predicted protein [Physcomitrella patens]
Length=409

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LYD+L  +   G DWT +LKQIGMF+FTGLNK+Q E M+ ++HIYMT DGRIS+AG
Sbjct  327  MRQQLYDALQARGTPG-DWTHVLKQIGMFTFTGLNKSQVEFMTRQYHIYMTSDGRISMAG  385

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  386  LSSKTVPHLADAI  398



>gb|KIZ05915.1| aspartate aminotransferase [Monoraphidium neglectum]
Length=345

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR +L  +L  K  + KDW+F+ KQIGMFS+TG++  Q +NM+NK  +YMT+DGRISLAG
Sbjct  267  VRGELRAALE-KRMADKDWSFVTKQIGMFSYTGMSPQQVDNMTNKHAVYMTRDGRISLAG  325

Query  183  LSAAKCEYLADAIIDSYYN  239
            LS+AK +YLADAI+DS  N
Sbjct  326  LSSAKVDYLADAIVDSVRN  344



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR +L  +L  K    KDW+FI KQIGMF+FTGL  AQ +NM+NK  ++MT+DGRISLAG
Sbjct  360  VRGELQRALEAKYPD-KDWSFITKQIGMFTFTGLTPAQVDNMTNKHSVFMTRDGRISLAG  418

Query  183  LSAAKCEYLADAIIDSYYN  239
            L++AK EYLA+AI++S  N
Sbjct  419  LNSAKVEYLANAIVESVRN  437



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR++L++ L+ +    KDW+F+ +QIGMFSFTGL+ AQ E M+    I+MTKDGRISLAG
Sbjct  335  VRRELFEELT-RLNPDKDWSFVTRQIGMFSFTGLSPAQVERMTGTHKIFMTKDGRISLAG  393

Query  183  LSAAKCEYLADAIIDSYYNV  242
            LS+AK +YLA+AI DS+ N 
Sbjct  394  LSSAKVKYLANAIDDSFRNA  413



>ref|XP_005643912.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE19368.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=440

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+ +L      G  W  IL QIGMFSFTGL K Q   M++KWH+YMT DGRIS+AG
Sbjct  362  MRQELFRALQQVGAPG-SWNHILDQIGMFSFTGLTKEQVRVMTDKWHVYMTFDGRISMAG  420

Query  183  LSAAKCEYLADAIIDS  230
            LS++KC YLA+AI D+
Sbjct  421  LSSSKCHYLAEAINDA  436



>ref|XP_002514283.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF48237.1| aspartate aminotransferase, putative [Ricinus communis]
Length=404

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  325  MRQKLFDALSARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTADGRISMAG  383

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  384  LSSKTVPHLADAI  396



>gb|AAL82596.1| aspartate aminotransferase 1 [Musa acuminata]
 gb|AAL82597.1| aspartate aminotransferase 2 [Musa acuminata]
Length=114

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  35   MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNTEQVTFMTKEYHIYMTSDGRISMAG  93

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  94   LSSKTVPHLVDAI  106



>gb|AAM91546.1| aspartate aminotransferase Asp2 [Arabidopsis thaliana]
Length=201

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AG
Sbjct  122  MRQQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAG  180

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  181  LSSKTVPHLADAM  193



>ref|XP_010493028.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFDAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  385  LSSKTVPHLADAM  397



>ref|XP_010420761.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Camelina sativa]
Length=405

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFDAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  385  LSSKTVPHLADAM  397



>ref|XP_006287876.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
 gb|EOA20774.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
Length=405

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFDAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  385  LSSKTVPHLADAM  397



>ref|XP_010454237.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFDAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  385  LSSKTVPHLADAM  397



>emb|CBI20886.3| unnamed protein product [Vitis vinifera]
Length=422

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW  ILKQIGMF+FTGLN AQ   M+ ++H+YMT DGRIS+AG
Sbjct  343  MRQQLFDALRARGTPG-DWNHILKQIGMFTFTGLNTAQVAFMTKEYHVYMTSDGRISMAG  401

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  402  LSSKTVPHLADAI  414



>ref|XP_002871893.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48152.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L++++  +   G DWT I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFEAIQARGTPG-DWTHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  385  LSSKTVPHLADAM  397



>ref|XP_011048396.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Populus 
euphratica]
Length=407

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  328  MRQKLFDALSARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  386

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  387  LSSRTVPLLADAI  399



>ref|XP_002284136.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
Length=450

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW  ILKQIGMF+FTGLN AQ   M+ ++H+YMT DGRIS+AG
Sbjct  371  MRQQLFDALRARGTPG-DWNHILKQIGMFTFTGLNTAQVAFMTKEYHVYMTSDGRISMAG  429

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  430  LSSKTVPHLADAI  442



>ref|XP_011043495.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
 ref|XP_011014875.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=407

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  328  MRQKLFDALSARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  386

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  387  LSSRTVPLLADAI  399



>ref|XP_010693429.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+D+L  +   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  372  MRQKLFDALQTRGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAG  430

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  431  LSSKTIPHLADAM  443



>ref|XP_010254083.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Nelumbo 
nucifera]
Length=461

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q  +M+ ++HIYMT DGRIS+AG
Sbjct  382  MRQQLFDALRARGTPG-DWSHIVKQIGMFTFTGLNTEQVASMTKEYHIYMTSDGRISMAG  440

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  441  LSSRTVPHLADAI  453



>gb|AFK44136.1| unknown [Medicago truncatula]
Length=153

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AG
Sbjct  74   MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAG  132

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  133  LSSKTVPHLADAI  145



>ref|XP_007137184.1| hypothetical protein PHAVU_009G106800g [Phaseolus vulgaris]
 gb|ESW09178.1| hypothetical protein PHAVU_009G106800g [Phaseolus vulgaris]
Length=410

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+N++HIYMT DGRIS+AG
Sbjct  331  MRQQLFDALRSRGTPG-DWSHIIKQIGMFTFTGLNSKQVSFMTNEYHIYMTSDGRISMAG  389

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  390  LSSKTVPLLADAI  402



>ref|XP_011078312.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=406

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LYD+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  327  MRQQLYDALCARGTPG-DWSHIIKQIGMFTFTGLNTNQVAFMTKEYHIYMTSDGRISMAG  385

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  386  LSSKTVPHLADAI  398



>ref|XP_004245266.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=452

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  373  MRQQLFDALRAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAG  431

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  432  LSSRTVPHLTDAI  444



>emb|CDM84293.1| unnamed protein product [Triticum aestivum]
Length=454

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+L +++  G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  375  MREQLFDALKIRETPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAG  433

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  434  LSSRTVPHLADAI  446



>ref|XP_006366212.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Solanum 
tuberosum]
Length=453

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  374  MRQQLFDALRAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAG  432

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  433  LSSRTIPHLTDAI  445



>emb|CDX70399.1| BnaC03g04830D [Brassica napus]
Length=450

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  371  MRKQLFEALRARGTPG-DWTHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAG  429

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  430  LSSKTVPHLADAI  442



>ref|XP_002989786.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
 gb|EFJ09053.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
Length=413

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R KLYD+L  +   G DWT ILKQIGMFSFTGLNK Q + M+ ++ IYMT DGRIS+AG
Sbjct  333  MRHKLYDALRARGTPG-DWTHILKQIGMFSFTGLNKEQVQFMTREYRIYMTLDGRISMAG  391

Query  183  LSAAKCEYLADAI  221
            LS      LADAI
Sbjct  392  LSLKTVPLLADAI  404



>gb|KHG23914.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=452

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AG
Sbjct  373  MRKQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAG  431

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  432  LSSKTVPHLADAI  444



>ref|XP_009131210.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Brassica 
rapa]
 emb|CDX78428.1| BnaA03g03400D [Brassica napus]
Length=452

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  373  MRKQLFEALRARGTPG-DWTHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAG  431

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  432  LSSKTVPHLADAI  444



>gb|KFK25414.1| aspartate aminotransferase [Arabis alpina]
Length=449

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  370  MRKQLFEALRARGTPG-DWTHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAG  428

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  429  LSSKTVPHLADAI  441



>ref|XP_006450636.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63876.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=449

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AG
Sbjct  370  MRQKLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAG  428

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  429  LSSKTVPHLADAI  441



>ref|XP_002990136.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
 gb|EFJ08853.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
Length=414

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R KLYD+L  +   G DWT ILKQIGMFSFTGLNK Q + M+ ++ IYMT DGRIS+AG
Sbjct  334  MRHKLYDALRARGTPG-DWTHILKQIGMFSFTGLNKEQVQFMTREYRIYMTLDGRISMAG  392

Query  183  LSAAKCEYLADAI  221
            LS      LADAI
Sbjct  393  LSLKTVPLLADAI  405



>gb|KJB07521.1| hypothetical protein B456_001G028100 [Gossypium raimondii]
Length=452

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AG
Sbjct  373  MRKQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAG  431

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  432  LSSKTVPHLADAI  444



>gb|AEX09183.1| putative aspartate aminotransferase 2 [Gossypium hirsutum]
Length=452

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AG
Sbjct  373  MRKQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAG  431

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  432  LSSKTVPHLADAI  444



>gb|AAA79370.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  385  LSSKTVPHLADAM  397



>ref|NP_197456.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46645.2|AAT2_ARATH RecName: Full=Aspartate aminotransferase, cytoplasmic isozyme 
1; AltName: Full=Transaminase A [Arabidopsis thaliana]
 gb|ABG25061.1| At5g19550 [Arabidopsis thaliana]
 gb|AED92724.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  385  LSSKTVPHLADAM  397



>emb|CDP03316.1| unnamed protein product [Coffea canephora]
Length=410

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  331  MRQKLFDALQARGTPG-DWSHIIKQIGMFTFTGLNAQQVAFMTKEYHIYMTSDGRISMAG  389

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  390  LSSQTVPLLADAI  402



>ref|XP_007012061.1| Aspartate aminotransferase 3 [Theobroma cacao]
 gb|EOY29680.1| Aspartate aminotransferase 3 [Theobroma cacao]
Length=450

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  372  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTREYHIYMTSDGRISMAG  430

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  431  LSSKTVPHLADAI  443



>ref|XP_006451184.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 ref|XP_006475645.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Citrus 
sinensis]
 gb|ESR64424.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 gb|KDO48875.1| hypothetical protein CISIN_1g015435mg [Citrus sinensis]
Length=407

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  328  MRQQLFDALSARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAG  386

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  387  LSSKTVPHLTDAI  399



>gb|ABY58643.1| aspartate aminotransferase [Triticum aestivum]
Length=380

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+L +++  G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  307  MREQLFDALKIRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAG  365

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  366  LSSRTVPHLADAI  378



>ref|XP_010519716.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X1 [Tarenaya hassleriana]
Length=340

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +LYD+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  261  MRHQLYDALQARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  319

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  320  LSSKTVPHLADAI  332



>sp|P28734.1|AATC_DAUCA RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Daucus carota]
 gb|AAA33134.1| aspartate aminotransferase [Daucus carota]
 prf||1909339A Asp aminotransferase
Length=405

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  K   G DW+ I+KQIGMF+FTGLN  Q   M+N++HIY+T DGRIS+AG
Sbjct  326  MRQELFNALQAKGTPG-DWSHIVKQIGMFTFTGLNSEQVTFMTNEYHIYLTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  385  LSSRTVPHLADAI  397



>ref|XP_004501184.1| PREDICTED: aspartate aminotransferase 1-like [Cicer arietinum]
Length=458

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  379  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSFMTKEYHIYMTSDGRISMAG  437

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  438  LSSRTVSHLADAI  450



>ref|XP_009595013.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=448

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  369  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAG  427

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  428  LSSRTVPHLADAI  440



>ref|XP_004136291.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004168053.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN60208.1| hypothetical protein Csa_3G889160 [Cucumis sativus]
Length=464

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  385  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVSFMTKEYHIYMTSDGRISMAG  443

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  444  LSSRTVPHLADAI  456



>ref|XP_010519717.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X2 [Tarenaya hassleriana]
Length=405

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +LYD+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRHQLYDALQARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  385  LSSKTVPHLADAI  397



>ref|XP_002324997.1| aspartate aminotransferase family protein [Populus trichocarpa]
 gb|ABK95824.1| unknown [Populus trichocarpa]
 gb|EEF03562.1| aspartate aminotransferase family protein [Populus trichocarpa]
Length=407

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  328  MRQQLFDALSARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  386

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  387  LSSRTVPHLTDAI  399



>ref|XP_002516566.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF45907.1| aspartate aminotransferase, putative [Ricinus communis]
Length=440

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  361  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAG  419

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  420  LSSKTVPHLADAI  432



>ref|XP_009782665.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=450

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  371  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAG  429

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  430  LSSRTVPHLADAI  442



>emb|CDY71396.1| BnaCnng72730D [Brassica napus]
Length=240

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LY+++  +   G DW+ I+KQIGMFSFTGLN+ Q   M+ ++HIYMT DGRIS+AG
Sbjct  161  MRQQLYEAIQARGTPG-DWSHIIKQIGMFSFTGLNEKQVRMMAKEYHIYMTYDGRISMAG  219

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  220  LSSKTVPQLADAI  232



>gb|AAL09704.1|AF419301_1 aspartate aminotransferase [Securigera parviflora]
Length=341

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  K   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIY+T DGRIS+AG
Sbjct  262  MRQQLFDALRAKGTPG-DWSHIIKQIGMFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAG  320

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  321  LSSKTVSHLADAI  333



>ref|XP_006476088.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=449

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+D+L  +   G DW+ I KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AG
Sbjct  370  MRQKLFDALRARGTPG-DWSHIFKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAG  428

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  429  LSSKTVPHLADAI  441



>sp|P37833.1|AATC_ORYSJ RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Oryza sativa Japonica Group]
 dbj|BAA03504.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAB61211.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC78585.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|ABL74572.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|EAY75902.1| hypothetical protein OsI_03821 [Oryza sativa Indica Group]
 gb|EAZ13614.1| hypothetical protein OsJ_03530 [Oryza sativa Japonica Group]
Length=407

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  ++  G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  328  MRQQLFDALKTRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAG  386

Query  183  LSAAKCEYLADAI  221
            LS     +LADAI
Sbjct  387  LSGRTIPHLADAI  399



>gb|KJB07520.1| hypothetical protein B456_001G028000 [Gossypium raimondii]
Length=337

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR++LYDSL  K   G DW+ I+KQ+GM+SFTGLNK Q + ++ ++HIYM+ DGRI++ G
Sbjct  252  VRRQLYDSLCNKGTPG-DWSHIIKQVGMYSFTGLNKDQVDFLTREYHIYMSSDGRINIGG  310

Query  183  LSAAKCEYLADAIIDS  230
            LS+    Y ADAI D+
Sbjct  311  LSSKAVPYFADAIHDA  326



>ref|XP_009410920.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN+ Q  +M+ ++HIYMT DGRIS+AG
Sbjct  380  MRQQLFDALRTRGTPG-DWSHIVKQIGMFTFTGLNREQVTSMTKEYHIYMTSDGRISMAG  438

Query  183  LSAAKCEYLADAI  221
            LS+    +LA AI
Sbjct  439  LSSKTVPHLAGAI  451



>ref|XP_008789337.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Phoenix dactylifera]
Length=463

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN+ Q   M+ ++HIYMT DGRIS+AG
Sbjct  384  MRQLLFDALHARGTPG-DWSHIIKQIGMFTFTGLNREQVAFMTQEYHIYMTSDGRISMAG  442

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  443  LSSKTVPHLADAI  455



>ref|XP_006644742.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Oryza 
brachyantha]
Length=458

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  ++  G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  379  MRQQLFDALKTRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAG  437

Query  183  LSAAKCEYLADAI  221
            LS     +LADAI
Sbjct  438  LSGRTIPHLADAI  450



>ref|NP_001044317.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAD87343.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06231.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAG96155.1| unnamed protein product [Oryza sativa Japonica Group]
Length=460

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  ++  G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  381  MRQQLFDALKTRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAG  439

Query  183  LSAAKCEYLADAI  221
            LS     +LADAI
Sbjct  440  LSGRTIPHLADAI  452



>ref|XP_009120876.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Brassica rapa]
Length=405

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS     +L DAI
Sbjct  385  LSTKTVPHLVDAI  397



>emb|CDX92520.1| BnaA10g15590D [Brassica napus]
Length=405

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS     +L DAI
Sbjct  385  LSTKTVPHLVDAI  397



>ref|XP_006289742.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
 gb|EOA22640.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
Length=452

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  373  MRKQLFEALRTRGTPG-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAG  431

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  432  LSSKTVPHLADAI  444



>ref|XP_007013138.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
 gb|EOY30757.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
Length=405

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRKQLFDALSARGTPG-DWSHIIKQIGMFTFTGLNSDQVAFMTKEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  385  LSSKTVPHLADAI  397



>emb|CDY65959.1| BnaC09g54080D [Brassica napus]
Length=405

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS     +L DAI
Sbjct  385  LSTKTVPHLVDAI  397



>gb|KDP33689.1| hypothetical protein JCGZ_07260 [Jatropha curcas]
Length=407

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +L+D+L+ +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  328  MRHQLFDALTARGTPG-DWSHIMKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAG  386

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  387  LSSKTVPHLADAI  399



>ref|XP_010419724.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=454

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  375  MRKQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAG  433

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  434  LSSKTVPHLADAI  446



>ref|XP_010453196.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Camelina 
sativa]
Length=455

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  376  MRKQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAG  434

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  435  LSSKTVPHLADAI  447



>ref|XP_006352160.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Solanum 
tuberosum]
Length=406

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LYD++  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  327  MRQQLYDAMQARGTPG-DWSHIIKQIGMFTFTGLNVEQVSFMTREYHIYMTSDGRISMAG  385

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  386  LSSRTVPHLADAM  398



>gb|ABR16105.1| unknown [Picea sitchensis]
Length=424

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +LYD+L  +   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIY+T DGRIS+AG
Sbjct  345  MRHQLYDALKARGTPG-DWSHIIKQIGMFTFTGLNKDQVSFMTAEYHIYLTSDGRISMAG  403

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  404  LSSKTVPHLADAI  416



>ref|XP_010491885.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=451

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  372  MRKQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAG  430

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  431  LSSKTVPHLADAI  443



>gb|KDP34208.1| hypothetical protein JCGZ_07779 [Jatropha curcas]
Length=454

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  375  MRQQLFDALHARGTPG-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAG  433

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  434  LSSKTVPHLADAI  446



>gb|KJB07518.1| hypothetical protein B456_001G028000 [Gossypium raimondii]
Length=426

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR++LYDSL  K   G DW+ I+KQ+GM+SFTGLNK Q + ++ ++HIYM+ DGRI++ G
Sbjct  341  VRRQLYDSLCNKGTPG-DWSHIIKQVGMYSFTGLNKDQVDFLTREYHIYMSSDGRINIGG  399

Query  183  LSAAKCEYLADAIIDS  230
            LS+    Y ADAI D+
Sbjct  400  LSSKAVPYFADAIHDA  415



>ref|XP_002873517.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49776.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  370  MRKQLFEALRTRGTPG-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAG  428

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  429  LSSKTVPHLADAI  441



>ref|XP_011090162.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=460

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  381  MRQQLFDALRSRGTPG-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAG  439

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  440  LSSRTVPHLADAI  452



>ref|NP_196713.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
 sp|P46644.1|AAT3_ARATH RecName: Full=Aspartate aminotransferase 3, chloroplastic; AltName: 
Full=Protein YELLOW-LEAF-SPECIFIC GENE 4; AltName: Full=Transaminase 
A; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA79371.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB87712.1| aspartate aminotransferase (Asp3) [Arabidopsis thaliana]
 gb|AAK92700.1| putative aspartate aminotransferase Asp3 [Arabidopsis thaliana]
 gb|AAL85041.1| putative aspartate aminotransferase ASP3 [Arabidopsis thaliana]
 gb|AED91691.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
Length=449

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  370  MRKQLFEALRTRGTPG-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAG  428

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  429  LSSKTVPHLADAI  441



>tpg|DAA57534.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=171

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  92   MRQQLFNALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAG  150

Query  183  LSAAKCEYLADAI  221
            LS     +LADAI
Sbjct  151  LSMRTVPHLADAI  163



>gb|KFK40563.1| hypothetical protein AALP_AA2G012200 [Arabis alpina]
Length=119

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LY++L  +   G DW+ I+KQIGMFSFTGLN+ Q   M+ ++HIYMT +GRIS+ G
Sbjct  40   MRQQLYEALQARGTPG-DWSHIIKQIGMFSFTGLNEKQVRLMAKEYHIYMTYNGRISIGG  98

Query  183  LSAAKCEYLADAIID  227
            LS      LADAI D
Sbjct  99   LSLKTVTRLADAIHD  113



>ref|XP_010920378.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Elaeis guineensis]
Length=464

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  385  MRQMLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAG  443

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  444  LSSKTVPHLADAI  456



>ref|XP_006833326.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
 gb|ERM98604.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
Length=452

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++LYD+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  373  MRKQLYDALCSRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  431

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  432  LSSRTVPHLADAI  444



>ref|XP_009762342.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=409

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +  +G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AG
Sbjct  330  MRQQLFDALQARGTTG-DWSHIIKQIGMFTFTGLNTEQVSFMTREHHIYMTSDGRISMAG  388

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  389  LSSRTIPHLADAI  401



>ref|XP_009395718.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=421

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  342  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNTEQVTFMTKEYHIYMTSDGRISMAG  400

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  401  LSSKTVPHLVDAI  413



>ref|XP_010250350.1| PREDICTED: aspartate aminotransferase, cytoplasmic, partial [Nelumbo 
nucifera]
Length=458

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  379  MRQQLFDALRDRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  437

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  438  LSSRTVPHLADAI  450



>gb|ACN40894.1| unknown [Picea sitchensis]
Length=462

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +LYD+L  +   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIY+T DGRIS+AG
Sbjct  383  MRHQLYDALKARGTPG-DWSHIIKQIGMFTFTGLNKDQVSFMTAEYHIYLTSDGRISMAG  441

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  442  LSSKTVPHLADAI  454



>ref|XP_009617506.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=409

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +  +G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AG
Sbjct  330  MRQQLFDALQARGTAG-DWSHIIKQIGMFTFTGLNTEQVSFMTREHHIYMTSDGRISMAG  388

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  389  LSSRTIPHLADAI  401



>gb|ACU21245.1| unknown [Glycine max]
Length=344

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  265  MRQELFDALRSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAG  323

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  324  LSSKTVPLLADAI  336



>ref|XP_008466236.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Cucumis melo]
Length=460

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  381  MRQQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVSFMTKEYHIYMTSDGRISMAG  439

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  440  LSSRTVPHLADAI  452



>gb|EMT25743.1| Aspartate aminotransferase, cytoplasmic [Aegilops tauschii]
Length=407

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L +++  G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  328  MREQLFNALKIRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAG  386

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  387  LSSRTVPHLADAI  399



>ref|XP_009112705.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 2 
isoform X1 [Brassica rapa]
Length=405

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LY+++  +   G DW+ I+KQIGMFSFTGLN+ Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLYEAIQARGTPG-DWSHIIKQIGMFSFTGLNEKQVRMMAKEYHIYMTYDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  385  LSSKTVPQLADAI  397



>gb|KEH36022.1| aspartate aminotransferase [Medicago truncatula]
Length=418

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AG
Sbjct  339  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAG  397

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  398  LSSKTVPHLADAI  410



>emb|CAA43779.1| aspartate aminotransferase [Medicago sativa]
Length=417

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AG
Sbjct  338  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAG  396

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  397  LSSKTVPHLADAI  409



>ref|XP_010688229.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Beta 
vulgaris subsp. vulgaris]
Length=405

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L+ +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFDALNARGTPG-DWSHIIKQIGMFTFTGLNADQVTFMRAEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  385  LSSRTVPHLADAI  397



>ref|XP_010100270.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB82277.1| Aspartate aminotransferase [Morus notabilis]
Length=463

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  384  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNAEQVAFMTKEYHIYMTSDGRISMAG  442

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  443  LSSKTVPHLVDAI  455



>tpg|DAA57533.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=201

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  122  MRQQLFNALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAG  180

Query  183  LSAAKCEYLADAI  221
            LS     +LADAI
Sbjct  181  LSMRTVPHLADAI  193



>gb|KHN10226.1| Aspartate aminotransferase 1 [Glycine soja]
Length=416

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  337  MRQELFDALRSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAG  395

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  396  LSSKTVPLLADAI  408



>gb|KJB64944.1| hypothetical protein B456_010G072900 [Gossypium raimondii]
Length=405

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+LS K   G +W+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRKQLFDALSAKGTPG-NWSHIIKQIGMFTFTGLNSDQVAFMTKEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  385  LSSKTVPHLADAI  397



>gb|KHG24168.1| Aspartate aminotransferase, cytoplasmic [Gossypium arboreum]
Length=405

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+LS K   G DW+ I+KQIGMF+FTGL+  Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRKQLFDALSAKGTPG-DWSHIIKQIGMFTFTGLDSDQVAFMTKEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  385  LSSKTVPHLADAI  397



>gb|AFK40370.1| unknown [Medicago truncatula]
Length=418

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AG
Sbjct  339  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVSILTKEYHIYLTSDGRISMAG  397

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  398  LSSKTVPHLADAI  410



>gb|KCW81535.1| hypothetical protein EUGRSUZ_C02894 [Eucalyptus grandis]
Length=452

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  373  MRHQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSQQVAFMTKEYHIYMTSDGRISMAG  431

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  432  LSSKTVPHLADAI  444



>gb|KEH36020.1| aspartate aminotransferase [Medicago truncatula]
Length=458

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AG
Sbjct  379  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAG  437

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  438  LSSKTVPHLADAI  450



>ref|XP_004970037.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Setaria 
italica]
Length=460

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  381  MRQQLFDALKSRGTPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAG  439

Query  183  LSAAKCEYLADAI  221
            LS     +LADAI
Sbjct  440  LSTRTVPHLADAI  452



>emb|CDP16161.1| unnamed protein product [Coffea canephora]
Length=420

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  341  MRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVTFMRKEYHIYMTSDGRISMAG  399

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  400  LSSRTVPHLTDAI  412



>ref|XP_011019648.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=449

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  370  MRQKLFEALRARGTPG-DWSHIVKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAG  428

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  429  LSSKTVPHLADAM  441



>ref|XP_002308618.1| aspartate transaminase family protein [Populus trichocarpa]
 gb|EEE92141.1| aspartate transaminase family protein [Populus trichocarpa]
Length=449

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  370  MRQKLFEALHARGTPG-DWSHIVKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAG  428

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  429  LSSKTVPHLADAM  441



>ref|XP_002284313.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
 emb|CBI28052.3| unnamed protein product [Vitis vinifera]
Length=411

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  332  MRQLLFDTLRDRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  390

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  391  LSSRTVPHLADAI  403



>emb|CAN70394.1| hypothetical protein VITISV_020521 [Vitis vinifera]
Length=411

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  332  MRQLLFDTLRDRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAG  390

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  391  LSSRTVPHLADAI  403



>ref|XP_009126373.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Brassica rapa]
Length=405

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +L +AI
Sbjct  385  LSSKTVPHLVEAI  397



>emb|CDY42276.1| BnaC02g08820D [Brassica napus]
Length=405

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +L +AI
Sbjct  385  LSSKTVPHLVEAI  397



>gb|AAC50015.1| aspartate aminotransferase cytosolic isozyme AAT2 [Glycine max]
Length=419

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  340  MRQELFDALCSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAG  398

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  399  LSSKTVPLLADAI  411



>gb|KHG23915.1| Aspartate aminotransferase, cytoplasmic [Gossypium arboreum]
Length=426

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VR++LYDSL  K   G DW+ I+KQ+GM+SFTGLNK + + ++ ++HIYM+ DGRI++ G
Sbjct  341  VRRQLYDSLCNKGTPG-DWSHIIKQVGMYSFTGLNKDEVDFLTREYHIYMSSDGRINIGG  399

Query  183  LSAAKCEYLADAIIDS  230
            LS+    Y ADAI D+
Sbjct  400  LSSKAVPYFADAIHDA  415



>ref|XP_006399658.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
 dbj|BAJ33906.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41111.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
Length=453

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  374  MRKQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAG  432

Query  183  LSAAKCEYLADAI  221
            LS+    +LAD+I
Sbjct  433  LSSKTVPHLADSI  445



>ref|NP_001237541.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|AAC50014.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|KHN18198.1| Aspartate aminotransferase 1 [Glycine soja]
Length=456

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  377  MRQELFDALCSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAG  435

Query  183  LSAAKCEYLADAI  221
            LS+     LADAI
Sbjct  436  LSSKTVPLLADAI  448



>gb|AAA50160.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AG
Sbjct  341  MRQQLFDALQSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAG  399

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  400  LSSKTVPHLADAI  412



>ref|XP_006400515.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
 gb|ESQ41968.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
Length=405

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRKQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +L DAI
Sbjct  385  LSSKTVPHLVDAI  397



>gb|AAA33408.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AG
Sbjct  341  MRQQLFDALQSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAG  399

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  400  LSSKTVPHLADAI  412



>ref|XP_003569862.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Brachypodium 
distachyon]
Length=464

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L+++   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  385  MRQQLFNALNIRGTPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAG  443

Query  183  LSAAKCEYLADAI  221
            LS+   ++LA+AI
Sbjct  444  LSSRTVDHLANAI  456



>emb|CDY44925.1| BnaA02g04300D [Brassica napus]
Length=405

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AG
Sbjct  326  MRQHLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +L +AI
Sbjct  385  LSSKTVPHLVEAI  397



>emb|CAA45023.1| aspartate aminotransferase [Panicum miliaceum]
 dbj|BAA04992.1| aspartate aminotransferase [Panicum miliaceum]
Length=409

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  330  MRQQLFDALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAG  388

Query  183  LSAAKCEYLADAI  221
            L+     +LADAI
Sbjct  389  LNMKNVPHLADAI  401



>ref|XP_004291203.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Fragaria 
vesca subsp. vesca]
Length=459

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +L+DSL  K   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  380  MRHQLFDSLRAKGTPG-DWSHIIKQIGMFTFTGLNPEQVAFMTKEYHIYMTSDGRISMAG  438

Query  183  LSAAKCEYLADAI  221
            LS+    +L +AI
Sbjct  439  LSSRTVPHLTEAI  451



>gb|AIT70250.1| aspartate aminotransferase [Betaphycus philippinensis]
Length=420

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQKL  +L +K+ +  +W  I+ QIGMFSFTGL  AQ E M NK+HIYMT +GRIS+AG
Sbjct  334  MRQKLRGAL-VKNGTPGNWDHIVNQIGMFSFTGLTAAQVELMKNKYHIYMTSNGRISMAG  392

Query  183  LSAAKCEYLADAIIDS  230
            L+    EY+ADA+ D+
Sbjct  393  LTEDTVEYVADAMKDA  408



>ref|XP_004243159.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=406

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LY ++  +   G DW+ I+KQIGMF+FTGLN  Q   M++++HIYMT DGRIS+AG
Sbjct  327  MRQQLYAAMQARGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMTSEYHIYMTSDGRISMAG  385

Query  183  LSAAKCEYLADAI  221
            LS+    +LADA+
Sbjct  386  LSSRTVPHLADAM  398



>gb|KFK26196.1| hypothetical protein AALP_AA8G215200 [Arabis alpina]
Length=405

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AG
Sbjct  326  MRKQLFEALQTRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMTKEHHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAIIDS  230
            LS+    +LADAI D+
Sbjct  385  LSSKTVPHLADAIHDA  400



>gb|AIT70256.1| aspartate aminotransferase [Eucheuma denticulatum]
Length=420

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R+KL  +L +K+ +  +W  I+KQIGMFSFTGL  AQ E M NK+HIYMT +GRIS+AG
Sbjct  334  MREKLRAAL-IKNGTPGNWDHIVKQIGMFSFTGLTAAQVEFMKNKYHIYMTSNGRISMAG  392

Query  183  LSAAKCEYLADAIIDS  230
            L+    EY+ADA+ D+
Sbjct  393  LTNYTVEYVADAMKDA  408



>ref|XP_003486130.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Bombus 
impatiens]
Length=427

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+D+L  K  S +DW  I  QIGMF FTGLN  + E + N +HIY+TKDGRIS+AG
Sbjct  351  VRQKLHDNLK-KMGSTRDWKHITDQIGMFCFTGLNPNEVEKLINDYHIYLTKDGRISMAG  409

Query  183  LSAAKCEYLADAIID  227
            +++   EY+A AI D
Sbjct  410  VTSKNVEYIAKAIYD  424



>ref|XP_003402856.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Bombus 
terrestris]
Length=427

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            VRQKL+D+L  K  S +DW  I  QIGMF FTGLN  + E + N +HIY+TKDGRIS+AG
Sbjct  351  VRQKLHDNLK-KMGSTRDWKHITDQIGMFCFTGLNPNEVEKLINDYHIYLTKDGRISMAG  409

Query  183  LSAAKCEYLADAIID  227
            +++   EY+A AI D
Sbjct  410  VTSKNVEYIAKAIYD  424



>gb|EYU29270.1| hypothetical protein MIMGU_mgv1a006139mg [Erythranthe guttata]
Length=455

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  376  MRTQLFDALRSRGTPG-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAG  434

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  435  LSSRTVPHLADAI  447



>emb|CAA63894.1| aspartate aminotransferase [Lotus japonicus]
Length=418

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+D+L  +   G DW+ I+K IGMF+FTGLN  Q   M+ ++HIY+T DGRIS+AG
Sbjct  339  MRQQLFDALRSRGTPG-DWSHIIKSIGMFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAG  397

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  398  LSSKTVPHLADAI  410



>ref|XP_010532471.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Tarenaya 
hassleriana]
Length=451

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AG
Sbjct  372  MRKQLFDALRARGTPG-DWSHIVKQIGMFTFTGLNTAQVSFMTKEYHIYMTSDGRISMAG  430

Query  183  LSAAKCEYLADAI  221
            LS+    +L +AI
Sbjct  431  LSSKTVPHLTEAI  443



>gb|AEX09182.1| putative aspartate aminotransferase 1 [Gossypium hirsutum]
Length=405

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R++L+D+LS K   G DW+ I+KQIGMF+FTGL+  Q   M  ++HIYMT DGRIS+AG
Sbjct  326  MRKQLFDALSAKGTPG-DWSHIIKQIGMFTFTGLDSDQVAFMIKEYHIYMTSDGRISMAG  384

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  385  LSSKTVPHLADAI  397



>ref|XP_007298245.1| hypothetical protein STEHIDRAFT_88821 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM92100.1| hypothetical protein STEHIDRAFT_88821 [Stereum hirsutum FP-91666 
SS1]
Length=427

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R KLYDSL+   K+  +W  I  QIGMFSFTGL   Q++ ++ K HIYMT DGRIS+AG
Sbjct  347  MRDKLYDSLTHTHKTPGEWGHIKSQIGMFSFTGLTPPQTKALAEKAHIYMTADGRISMAG  406

Query  183  LSAAKCEYLADAI  221
            L+A   EY A+++
Sbjct  407  LNANNIEYFAESV  419



>ref|NP_001141224.1| uncharacterized protein LOC100273311 [Zea mays]
 gb|ACF85765.1| unknown [Zea mays]
 tpg|DAA57530.1| TPA: aspartate aminotransferase [Zea mays]
Length=459

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AG
Sbjct  380  MRQQLFNALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAG  438

Query  183  LSAAKCEYLADAI  221
            LS     +LADAI
Sbjct  439  LSMRTVPHLADAI  451



>ref|XP_006476087.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=455

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +3

Query  3    VRQKLYDSLSLKD-----KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGR  167
            +RQKL+D+L  ++      +  DW+ I KQIGMF+FTGLN  Q   M+  +HIYMT DGR
Sbjct  370  MRQKLFDALRAREIWYIAGTPGDWSHIFKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGR  429

Query  168  ISLAGLSAAKCEYLADAI  221
            IS+AGLS+    +LADAI
Sbjct  430  ISMAGLSSKTVPHLADAI  447



>ref|XP_010049084.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Eucalyptus 
grandis]
Length=594

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +R +L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AG
Sbjct  515  MRHQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSQQVAFMTKEYHIYMTSDGRISMAG  573

Query  183  LSAAKCEYLADAI  221
            LS+    +LADAI
Sbjct  574  LSSKTVPHLADAI  586



>ref|XP_002308617.2| hypothetical protein POPTR_0006s25820g [Populus trichocarpa]
 gb|EEE92140.2| hypothetical protein POPTR_0006s25820g [Populus trichocarpa]
Length=479

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG  182
            +RQ+LYD+L  +   G DW+ I+KQ+GM++F+GLN  Q   M+ ++HIYM+ DGRI++AG
Sbjct  399  LRQQLYDALRDRGTPG-DWSHIMKQVGMYTFSGLNAEQVAFMNKEYHIYMSSDGRINMAG  457

Query  183  LSAAKCEYLADAI  221
            LSA    YLADAI
Sbjct  458  LSAKTVPYLADAI  470



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600