BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039J23

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97059.1|  unnamed protein product                                363   6e-122   Coffea canephora [robusta coffee]
gb|EYU37791.1|  hypothetical protein MIMGU_mgv1a008244mg                363   7e-122   Erythranthe guttata [common monkey flower]
sp|P93397.1|GBB1_TOBAC  RecName: Full=Guanine nucleotide-binding ...    361   4e-121   Nicotiana tabacum [American tobacco]
gb|AIL52187.1|  heterotrimeric G-protein beta subunit                   361   4e-121   Capsicum annuum
ref|XP_009800901.1|  PREDICTED: guanine nucleotide-binding protei...    361   4e-121   Nicotiana sylvestris
gb|AAG12330.1|AF249743_1  heterotrimeric GTP-binding protein subu...    361   4e-121   Nicotiana tabacum [American tobacco]
gb|ACR77529.1|  heterotrimeric G protein beta 2 subunit                 361   6e-121   Nicotiana benthamiana
gb|KHG11481.1|  Guanine nucleotide-binding subunit beta-2               360   1e-120   Gossypium arboreum [tree cotton]
gb|KJB32495.1|  hypothetical protein B456_005G243000                    360   2e-120   Gossypium raimondii
gb|AJE63427.1|  heterotrimeric G protein beta 2 subunit                 360   2e-120   Capsicum annuum
ref|XP_011048621.1|  PREDICTED: guanine nucleotide-binding protei...    359   3e-120   Populus euphratica
ref|XP_009605958.1|  PREDICTED: guanine nucleotide-binding protei...    358   4e-120   Nicotiana tomentosiformis
ref|XP_003631647.1|  PREDICTED: guanine nucleotide-binding protei...    358   5e-120   Vitis vinifera
ref|XP_011048613.1|  PREDICTED: guanine nucleotide-binding protei...    358   5e-120   Populus euphratica
ref|XP_002313052.1|  ERECTA-LIKE 4 family protein                       358   7e-120   Populus trichocarpa [western balsam poplar]
sp|Q40507.1|GBB3_TOBAC  RecName: Full=Guanine nucleotide-binding ...    358   8e-120   Nicotiana tabacum [American tobacco]
ref|XP_011037538.1|  PREDICTED: guanine nucleotide-binding protei...    357   1e-119   Populus euphratica
ref|XP_002509478.1|  guanine nucleotide-binding protein beta, put...    357   2e-119   Ricinus communis
sp|P93339.1|GBB_NICPL  RecName: Full=Guanine nucleotide-binding p...    357   2e-119   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004230907.1|  PREDICTED: guanine nucleotide-binding protei...    356   5e-119   Solanum lycopersicum
ref|NP_001240891.1|  uncharacterized protein LOC100811645               356   6e-119   Glycine max [soybeans]
gb|AAD49742.1|AF170921_1  G protein beta subunit                        355   7e-119   Pisum sativum [garden pea]
ref|XP_002306098.1|  ERECTA-LIKE 4 family protein                       355   9e-119   Populus trichocarpa [western balsam poplar]
ref|XP_008236879.1|  PREDICTED: guanine nucleotide-binding protei...    355   1e-118   Prunus mume [ume]
gb|KCW55344.1|  hypothetical protein EUGRSUZ_I01264                     353   1e-118   Eucalyptus grandis [rose gum]
ref|XP_007201063.1|  hypothetical protein PRUPE_ppa007241mg             355   1e-118   Prunus persica
ref|XP_010107843.1|  Guanine nucleotide-binding protein subunit b...    355   2e-118   Morus notabilis
ref|XP_008375922.1|  PREDICTED: guanine nucleotide-binding protei...    354   2e-118   Malus domestica [apple tree]
ref|XP_004299095.1|  PREDICTED: guanine nucleotide-binding protei...    354   2e-118   Fragaria vesca subsp. vesca
ref|XP_003603911.1|  Guanine nucleotide-binding protein subunit b...    354   2e-118   Medicago truncatula
sp|P93563.1|GBB_SOLTU  RecName: Full=Guanine nucleotide-binding p...    354   3e-118   Solanum tuberosum [potatoes]
gb|KDP46245.1|  hypothetical protein JCGZ_10085                         353   4e-118   Jatropha curcas
ref|NP_001274886.1|  guanine nucleotide-binding protein subunit beta    353   4e-118   Solanum tuberosum [potatoes]
ref|XP_003527220.1|  PREDICTED: guanine nucleotide-binding protei...    353   4e-118   Glycine max [soybeans]
gb|KHN20072.1|  Guanine nucleotide-binding protein subunit beta-2       353   4e-118   Glycine soja [wild soybean]
ref|XP_010254875.1|  PREDICTED: guanine nucleotide-binding protei...    353   7e-118   Nelumbo nucifera [Indian lotus]
ref|XP_004500814.1|  PREDICTED: guanine nucleotide-binding protei...    352   1e-117   Cicer arietinum [garbanzo]
ref|XP_011088384.1|  PREDICTED: guanine nucleotide-binding protei...    352   2e-117   Sesamum indicum [beniseed]
gb|AEQ61903.1|  GTP-binding protein beta subunit                        352   2e-117   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007042211.1|  GTP binding protein beta 1 isoform 1               351   5e-117   
ref|XP_009779361.1|  PREDICTED: guanine nucleotide-binding protei...    351   5e-117   Nicotiana sylvestris
ref|XP_009609408.1|  PREDICTED: guanine nucleotide-binding protei...    350   6e-117   Nicotiana tomentosiformis
ref|XP_010028582.1|  PREDICTED: guanine nucleotide-binding protei...    350   9e-117   Eucalyptus grandis [rose gum]
gb|AAM97354.1|  G protein beta subunit                                  350   1e-116   Pisum sativum [garden pea]
ref|XP_010690896.1|  PREDICTED: guanine nucleotide-binding protei...    350   1e-116   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010263695.1|  PREDICTED: guanine nucleotide-binding protei...    348   1e-116   Nelumbo nucifera [Indian lotus]
ref|XP_009345730.1|  PREDICTED: guanine nucleotide-binding protei...    348   3e-116   Pyrus x bretschneideri [bai li]
gb|KDO49094.1|  hypothetical protein CISIN_1g016458mg                   348   4e-116   Citrus sinensis [apfelsine]
ref|XP_009374178.1|  PREDICTED: guanine nucleotide-binding protei...    348   4e-116   
ref|XP_006423250.1|  hypothetical protein CICLE_v10028655mg             348   4e-116   Citrus clementina [clementine]
gb|KDO49095.1|  hypothetical protein CISIN_1g016458mg                   349   4e-116   Citrus sinensis [apfelsine]
gb|AAD33959.1|AF145976_1  G protein beta subunit                        348   4e-116   Pisum sativum [garden pea]
gb|KDO49093.1|  hypothetical protein CISIN_1g016458mg                   348   6e-116   Citrus sinensis [apfelsine]
ref|XP_010263694.1|  PREDICTED: guanine nucleotide-binding protei...    347   1e-115   Nelumbo nucifera [Indian lotus]
ref|XP_011092783.1|  PREDICTED: guanine nucleotide-binding protei...    346   5e-115   Sesamum indicum [beniseed]
ref|XP_010530843.1|  PREDICTED: guanine nucleotide-binding protei...    345   7e-115   Tarenaya hassleriana [spider flower]
ref|XP_003541055.1|  PREDICTED: guanine nucleotide-binding protei...    344   2e-114   Glycine max [soybeans]
ref|XP_003537878.1|  PREDICTED: guanine nucleotide-binding protei...    343   3e-114   Glycine max [soybeans]
ref|XP_010254874.1|  PREDICTED: guanine nucleotide-binding protei...    344   3e-114   Nelumbo nucifera [Indian lotus]
gb|AFK33707.1|  unknown                                                 342   2e-113   Lotus japonicus
ref|XP_006856030.1|  hypothetical protein AMTR_s00059p00065870          340   1e-112   Amborella trichopoda
ref|XP_007131843.1|  hypothetical protein PHAVU_011G045900g             340   1e-112   Phaseolus vulgaris [French bean]
gb|AGZ15391.1|  G protein beta subunit                                  340   1e-112   Phaseolus vulgaris [French bean]
ref|XP_008447036.1|  PREDICTED: guanine nucleotide-binding protei...    338   4e-112   Cucumis melo [Oriental melon]
ref|XP_004160234.1|  PREDICTED: guanine nucleotide-binding protei...    334   3e-111   
gb|KJB79197.1|  hypothetical protein B456_013G037500                    334   3e-111   Gossypium raimondii
ref|XP_010432411.1|  PREDICTED: guanine nucleotide-binding protei...    336   3e-111   Camelina sativa [gold-of-pleasure]
gb|KHG07839.1|  Guanine nucleotide-binding subunit beta-2               335   7e-111   Gossypium arboreum [tree cotton]
ref|XP_010526922.1|  PREDICTED: guanine nucleotide-binding protei...    332   7e-111   Tarenaya hassleriana [spider flower]
ref|XP_004150413.1|  PREDICTED: guanine nucleotide-binding protei...    334   2e-110   Cucumis sativus [cucumbers]
gb|AIS73131.1|  heterotrimeric G protein beta subunit 2                 333   4e-110   Brassica nigra
gb|KJB79195.1|  hypothetical protein B456_013G037500                    333   4e-110   Gossypium raimondii
ref|XP_010437612.1|  PREDICTED: guanine nucleotide-binding protei...    333   5e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006412223.1|  hypothetical protein EUTSA_v10025475mg             332   1e-109   Eutrema salsugineum [saltwater cress]
ref|NP_974683.1|  guanine nucleotide-binding protein subunit beta       331   1e-109   Arabidopsis thaliana [mouse-ear cress]
gb|ACX43274.1|  GTP binding protein beta subunit                        332   1e-109   Brassica napus [oilseed rape]
dbj|BAJ34135.1|  unnamed protein product                                332   1e-109   Eutrema halophilum
gb|KFK30072.1|  hypothetical protein AALP_AA7G213100                    332   1e-109   Arabis alpina [alpine rockcress]
ref|XP_002867119.1|  hypothetical protein ARALYDRAFT_491213             332   2e-109   
ref|NP_195172.1|  guanine nucleotide-binding protein subunit beta       331   2e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AAV85721.1|  At4g34460                                               331   2e-109   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69061.1|  BnaC01g03920D                                          331   2e-109   
ref|XP_006283934.1|  hypothetical protein CARUB_v10005053mg             330   7e-109   Capsella rubella
gb|AIO11833.1|  heterotrimeric G-protein beta subunit 3                 329   1e-108   Brassica rapa
ref|XP_009112299.1|  PREDICTED: guanine nucleotide-binding protei...    329   1e-108   Brassica rapa
emb|CDX75436.1|  BnaA01g02660D                                          329   1e-108   
gb|AIO11831.1|  heterotrimeric G-protein beta subunit 1                 329   2e-108   Brassica rapa
gb|AIS73130.1|  heterotrimeric G protein beta subunit 1                 328   2e-108   Brassica nigra
ref|XP_009138296.1|  PREDICTED: guanine nucleotide-binding protei...    328   3e-108   Brassica rapa
gb|AIS73132.1|  heterotrimeric G protein beta subunit 3                 327   7e-108   Brassica nigra
ref|XP_009108730.1|  PREDICTED: guanine nucleotide-binding protei...    325   5e-107   Brassica rapa
ref|XP_008783473.1|  PREDICTED: guanine nucleotide-binding protei...    325   8e-107   Phoenix dactylifera
ref|XP_010942027.1|  PREDICTED: guanine nucleotide-binding protei...    323   3e-106   
ref|XP_009406753.1|  PREDICTED: guanine nucleotide-binding protei...    323   5e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942026.1|  PREDICTED: guanine nucleotide-binding protei...    323   5e-106   Elaeis guineensis
emb|CDX72483.1|  BnaC07g45050D                                          337   6e-106   
ref|XP_010942025.1|  PREDICTED: guanine nucleotide-binding protei...    323   7e-106   Elaeis guineensis
gb|AIO11832.1|  heterotrimeric G-protein beta subunit 2                 322   1e-105   Brassica rapa
ref|NP_001078491.1|  guanine nucleotide-binding protein subunit beta    321   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004982214.1|  PREDICTED: guanine nucleotide-binding protei...    322   4e-105   
ref|XP_004982216.1|  PREDICTED: guanine nucleotide-binding protei...    320   5e-105   Setaria italica
gb|ACF86117.1|  unknown                                                 320   8e-105   Zea mays [maize]
ref|XP_009416786.1|  PREDICTED: guanine nucleotide-binding protei...    320   1e-104   
ref|XP_004982215.1|  PREDICTED: guanine nucleotide-binding protei...    320   1e-104   
ref|XP_002466691.1|  hypothetical protein SORBIDRAFT_01g012370          318   3e-104   Sorghum bicolor [broomcorn]
gb|EEC75892.1|  hypothetical protein OsI_12941                          318   3e-104   Oryza sativa Indica Group [Indian rice]
sp|Q40687.1|GBB_ORYSJ  RecName: Full=Guanine nucleotide-binding p...    318   3e-104   Oryza sativa Japonica Group [Japonica rice]
gb|AEE69019.1|  heterotrimeric G protein beta subunit                   318   4e-104   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105365.1|  guanine nucleotide-binding protein subunit beta    317   6e-104   Zea mays [maize]
emb|CDY45313.1|  BnaA03g52860D                                          332   8e-104   Brassica napus [oilseed rape]
gb|ABR17717.1|  unknown                                                 316   3e-103   Picea sitchensis
gb|ADL27745.1|  G protein beta subunit                                  315   6e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_009381288.1|  PREDICTED: guanine nucleotide-binding protei...    315   6e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935069.1|  PREDICTED: guanine nucleotide-binding protei...    315   9e-103   Elaeis guineensis
gb|AHJ60245.1|  heterotrimeric G-protein beta subunit                   314   1e-102   Picea abies
ref|XP_009416784.1|  PREDICTED: guanine nucleotide-binding protei...    313   4e-102   
gb|EMT27863.1|  hypothetical protein F775_27280                         312   6e-102   
ref|XP_003561442.1|  PREDICTED: guanine nucleotide-binding protei...    307   7e-100   Brachypodium distachyon [annual false brome]
pdb|3J60|GG  Chain g, Localization Of The Small Subunit Ribosomal...    305   3e-99    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010526923.1|  PREDICTED: guanine nucleotide-binding protei...    299   2e-98    Tarenaya hassleriana [spider flower]
emb|CAN73515.1|  hypothetical protein VITISV_027042                     303   2e-98    Vitis vinifera
gb|AFK40354.1|  unknown                                                 293   4e-97    Medicago truncatula
gb|EEE63415.1|  hypothetical protein OsJ_18227                          296   7e-96    Oryza sativa Japonica Group [Japonica rice]
gb|AAC39373.1|  G protein beta subunit                                  296   2e-95    Avena fatua
ref|XP_010935070.1|  PREDICTED: guanine nucleotide-binding protei...    294   1e-94    
ref|XP_010935068.1|  PREDICTED: guanine nucleotide-binding protei...    293   2e-94    
ref|XP_010935067.1|  PREDICTED: guanine nucleotide-binding protei...    293   7e-94    Elaeis guineensis
gb|EMS45783.1|  Guanine nucleotide-binding protein subunit beta         288   6e-86    Triticum urartu
ref|XP_009779362.1|  PREDICTED: guanine nucleotide-binding protei...    257   5e-81    Nicotiana sylvestris
ref|NP_849494.2|  guanine nucleotide-binding protein subunit beta       254   4e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDX76284.1|  BnaA08g11160D                                          245   4e-76    
emb|CDY46247.1|  BnaC03g66080D                                          243   3e-75    Brassica napus [oilseed rape]
ref|XP_001753169.1|  GPB1 heterotrimeric G protein beta subunit p...    216   1e-64    
ref|XP_002967710.1|  hypothetical protein SELMODRAFT_440157             207   3e-61    Selaginella moellendorffii
ref|XP_002964323.1|  hypothetical protein SELMODRAFT_142121             203   1e-59    Selaginella moellendorffii
gb|KDO49096.1|  hypothetical protein CISIN_1g016458mg                   177   1e-50    Citrus sinensis [apfelsine]
gb|KEH36360.1|  guanine nucleotide-binding protein beta subunit-l...    177   1e-50    Medicago truncatula
gb|KCW55346.1|  hypothetical protein EUGRSUZ_I01264                     172   8e-49    Eucalyptus grandis [rose gum]
ref|XP_001757493.1|  GPB2 heterotrimeric G protein beta subunit p...    166   8e-47    
gb|KJB79196.1|  hypothetical protein B456_013G037500                    166   1e-46    Gossypium raimondii
gb|AGH70128.1|  guanine nucleotide-binding protein beta 1               164   1e-46    Placozoa sp. H4
ref|XP_009166447.1|  hypothetical protein T265_13295                    163   2e-46    Opisthorchis viverrini [Southeast Asian liver fluke]
gb|EJU00042.1|  guanine nucleotide binding protein beta subunit 2       166   2e-45    Dacryopinax primogenitus
gb|KDE07792.1|  guanine nucleotide-binding protein subunit beta         166   2e-45    Microbotryum lychnidis-dioicae p1A1 Lamole
emb|CCD58560.1|  unnamed protein product                                164   3e-45    Schistosoma mansoni
gb|AAW26990.1|  SJCHGC05537 protein                                     165   4e-45    Schistosoma japonicum
emb|CCA67815.1|  related to G-protein beta subunit Bpp1                 165   4e-45    Serendipita indica DSM 11827
ref|XP_002127296.1|  PREDICTED: guanine nucleotide-binding protei...    164   6e-45    Ciona intestinalis [sea vase]
gb|ACI34200.1|  Guanine nucleotide-binding protein GI/GS/GT subun...    164   6e-45    Salmo salar
emb|CDQ76873.1|  unnamed protein product                                164   7e-45    Oncorhynchus mykiss
gb|ACI33136.1|  Guanine nucleotide-binding protein GI/GS/GT subun...    164   7e-45    Salmo salar
emb|CDQ88615.1|  unnamed protein product                                164   7e-45    Oncorhynchus mykiss
ref|XP_006740020.1|  PREDICTED: guanine nucleotide-binding protei...    164   7e-45    Leptonychotes weddellii
gb|KIM28934.1|  hypothetical protein M408DRAFT_328991                   164   8e-45    Serendipita vermifera MAFF 305830
ref|XP_010782136.1|  PREDICTED: guanine nucleotide-binding protei...    164   9e-45    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009032026.1|  hypothetical protein HELRODRAFT_91325              164   9e-45    Helobdella robusta
ref|XP_004349142.1|  guanine nucleotide-binding protein beta subunit    163   1e-44    Capsaspora owczarzaki ATCC 30864
ref|XP_009013973.1|  hypothetical protein HELRODRAFT_75178              163   1e-44    Helobdella robusta
gb|AAG31060.1|AF277161_1  G-protein B1 subunit                          163   1e-44    Ambystoma tigrinum
emb|CCX14452.1|  Similar to Guanine nucleotide-binding protein su...    163   1e-44    Pyronema omphalodes CBS 100304
ref|XP_010873676.1|  PREDICTED: guanine nucleotide-binding protei...    163   2e-44    Esox lucius
ref|XP_007237084.1|  PREDICTED: guanine nucleotide-binding protei...    163   2e-44    Astyanax mexicanus [blind cave fish]
gb|EZF44104.1|  guanine nucleotide-binding protein subunit beta         160   2e-44    Trichophyton rubrum CBS 100081
gb|EZF68383.1|  guanine nucleotide-binding protein subunit beta         160   2e-44    Trichophyton soudanense CBS 452.61
ref|XP_002113727.1|  G protein beta 1 subunit                           162   2e-44    Trichoplax adhaerens
gb|AAW25818.1|  unknown                                                 159   2e-44    Schistosoma japonicum
gb|EZF28331.1|  guanine nucleotide-binding protein subunit beta         161   2e-44    Trichophyton interdigitale H6
ref|XP_003132597.2|  PREDICTED: guanine nucleotide-binding protei...    160   2e-44    
gb|EZF25118.1|  guanine nucleotide-binding protein subunit beta         160   2e-44    Trichophyton rubrum MR850
gb|EZG11290.1|  guanine nucleotide-binding protein subunit beta         161   2e-44    Trichophyton rubrum CBS 202.88
gb|EZF79069.1|  guanine nucleotide-binding protein subunit beta         160   2e-44    Trichophyton rubrum MR1448
gb|KIK07337.1|  hypothetical protein K443DRAFT_673598                   162   2e-44    Laccaria amethystina LaAM-08-1
ref|XP_005796981.1|  PREDICTED: guanine nucleotide-binding protei...    162   3e-44    Xiphophorus maculatus
ref|XP_003017524.1|  hypothetical protein ARB_04406                     159   3e-44    Trichophyton benhamiae CBS 112371
ref|XP_004068666.1|  PREDICTED: guanine nucleotide-binding protei...    162   3e-44    Oryzias latipes [Japanese rice fish]
ref|XP_003962986.1|  PREDICTED: guanine nucleotide-binding protei...    162   3e-44    Takifugu rubripes [tiger puffer]
ref|XP_003455365.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    Oreochromis niloticus
ref|XP_003973377.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    Takifugu rubripes [tiger puffer]
ref|XP_005724603.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    Pundamilia nyererei
ref|XP_008317802.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003448366.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    
ref|XP_004548729.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    
ref|NP_997774.1|  guanine nucleotide-binding protein G(I)/G(S)/G(...    162   4e-44    Danio rerio [leopard danio]
gb|ACY66435.1|  guanine nucleotide-binding protein G(I)/G(S)/G(T)...    160   4e-44    Scylla paramamosain
ref|XP_010729805.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    
ref|XP_008283304.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    Stegastes partitus
ref|XP_006642037.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    Lepisosteus oculatus
ref|XP_010169104.1|  PREDICTED: guanine nucleotide-binding protei...    162   4e-44    
ref|XP_011117389.1|  hypothetical protein AOL_s00004g438                162   5e-44    Arthrobotrys oligospora ATCC 24927
ref|XP_009065631.1|  hypothetical protein LOTGIDRAFT_236462             162   5e-44    Lottia gigantea
gb|EFX00034.1|  guanine nucleotide-binding protein beta subunit         161   5e-44    Grosmannia clavigera kw1407
gb|KDQ31285.1|  hypothetical protein PLEOSDRAFT_1088718                 162   5e-44    Pleurotus ostreatus PC15
gb|KEF53104.1|  guanine nucleotide-binding protein subunit beta         161   5e-44    Exophiala aquamarina CBS 119918
ref|XP_005800197.1|  PREDICTED: guanine nucleotide-binding protei...    161   5e-44    Xiphophorus maculatus
ref|XP_011419294.1|  PREDICTED: guanine nucleotide-binding protei...    161   6e-44    Crassostrea gigas
emb|CBY09724.1|  unnamed protein product                                162   6e-44    Oikopleura dioica
ref|XP_007422850.1|  PREDICTED: guanine nucleotide-binding protei...    161   6e-44    
ref|XP_001176793.1|  PREDICTED: guanine nucleotide-binding protei...    161   6e-44    Strongylocentrotus purpuratus [purple urchin]
gb|ETE67977.1|  Guanine nucleotide-binding protein subunit beta-4       161   7e-44    Ophiophagus hannah
gb|ELT98472.1|  hypothetical protein CAPTEDRAFT_124853                  161   8e-44    Capitella teleta
ref|XP_011107440.1|  hypothetical protein H072_1448                     161   8e-44    
ref|XP_009864056.1|  PREDICTED: guanine nucleotide-binding protei...    160   8e-44    Apaloderma vittatum
dbj|GAA51958.1|  guanine nucleotide binding protein (G protein) b...    164   9e-44    Clonorchis sinensis [oriental liver fluke]
ref|XP_005069787.1|  PREDICTED: guanine nucleotide-binding protei...    161   9e-44    
emb|CBY35900.1|  unnamed protein product                                162   9e-44    Oikopleura dioica
gb|KDR85626.1|  hypothetical protein GALMADRAFT_218719                  161   9e-44    Galerina marginata CBS 339.88
gb|ACI34147.1|  Guanine nucleotide-binding protein GI/GS/GT subun...    161   9e-44    Salmo salar
ref|XP_003509126.1|  PREDICTED: guanine nucleotide-binding protei...    161   1e-43    Cricetulus griseus [Chinese hamsters]
ref|XP_009864055.1|  PREDICTED: guanine nucleotide-binding protei...    161   1e-43    Apaloderma vittatum
emb|CBY34556.1|  unnamed protein product                                162   1e-43    Oikopleura dioica
ref|XP_005343822.1|  PREDICTED: guanine nucleotide-binding protei...    161   1e-43    Microtus ochrogaster [prairie voles]
gb|KII94026.1|  hypothetical protein PLICRDRAFT_413480                  161   1e-43    Plicaturopsis crispa FD-325 SS-3
ref|XP_010894390.1|  PREDICTED: guanine nucleotide-binding protei...    160   1e-43    Esox lucius
ref|XP_004570997.1|  PREDICTED: guanine nucleotide-binding protei...    160   1e-43    Maylandia zebra
dbj|BAF63410.1|  G-protein beta subunit 1                               160   1e-43    Cyprinus carpio [carp]
gb|AGY52593.1|  G protein B subunit                                     160   1e-43    Crassostrea angulata [Portugese oyster]
emb|CBY37164.1|  unnamed protein product                                162   1e-43    Oikopleura dioica
gb|EWC48535.1|  guanine nucleotide-binding protein subunit beta         161   1e-43    Drechslerella stenobrocha 248
gb|AFA34431.1|  G protein B subunit                                     160   1e-43    Ostrea edulis [Colchester native oyster]
ref|XP_006971195.1|  PREDICTED: guanine nucleotide-binding protei...    160   1e-43    
ref|NP_001098323.1|  guanine nucleotide-binding protein beta subunit    160   1e-43    Oryzias latipes [Japanese rice fish]
ref|XP_003230593.2|  PREDICTED: guanine nucleotide-binding protei...    159   1e-43    
ref|XP_006454225.1|  guanine nucleotide binding protein beta subu...    161   1e-43    Agaricus bisporus var. bisporus H97
ref|XP_007390873.1|  hypothetical protein PHACADRAFT_248083             160   1e-43    Phanerochaete carnosa HHB-10118-sp
ref|XP_002411384.1|  THO complex subunit, putative                      160   1e-43    Ixodes scapularis [blacklegged tick]
gb|KIO06877.1|  hypothetical protein M404DRAFT_998299                   160   1e-43    Pisolithus tinctorius Marx 270
gb|AAH15920.1|  GNB3 protein                                            159   1e-43    Homo sapiens [man]
ref|XP_002795766.1|  guanine nucleotide-binding protein subunit beta    160   2e-43    
ref|XP_003037057.1|  guanine nucleotide binding protein beta subu...    160   2e-43    Schizophyllum commune H4-8
ref|XP_007721690.1|  guanine nucleotide-binding protein subunit beta    160   2e-43    Capronia coronata CBS 617.96
ref|XP_007733470.1|  guanine nucleotide-binding protein subunit beta    160   2e-43    Capronia epimyces CBS 606.96
gb|EYC12356.1|  hypothetical protein Y032_0047g1438                     159   2e-43    Ancylostoma ceylanicum
ref|XP_002473929.1|  candidate G-protein beta subunit                   160   2e-43    
ref|XP_007807978.1|  G protein beta subunit                             159   2e-43    Metarhizium acridum CQMa 102
gb|KDQ14498.1|  hypothetical protein BOTBODRAFT_55346                   160   2e-43    Botryobasidium botryosum FD-172 SS1
gb|KFG82472.1|  G protein beta subunit                                  159   2e-43    Metarhizium anisopliae
gb|KIP11721.1|  hypothetical protein PHLGIDRAFT_17891                   160   2e-43    Phlebiopsis gigantea 11061_1 CR5-6
gb|KIW11996.1|  guanine nucleotide-binding protein subunit beta         160   2e-43    Exophiala spinifera
ref|XP_007001778.1|  G-protein beta subunit GPB1                        160   2e-43    Tremella mesenterica DSM 1558
ref|XP_006183833.1|  PREDICTED: guanine nucleotide-binding protei...    160   2e-43    Camelus ferus
ref|XP_005927503.1|  PREDICTED: guanine nucleotide-binding protei...    160   2e-43    Haplochromis burtoni
gb|KEZ45296.1|  hypothetical protein SAPIO_CDS2093                      160   2e-43    Scedosporium apiospermum
ref|XP_005802948.1|  PREDICTED: guanine nucleotide-binding protei...    160   2e-43    Xiphophorus maculatus
gb|KIL01011.1|  hypothetical protein PAXRUDRAFT_7786                    160   2e-43    Paxillus rubicundulus Ve08.2h10
ref|XP_006132712.1|  PREDICTED: guanine nucleotide-binding protei...    160   2e-43    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_002075419.1|  GK15234                                            160   2e-43    Drosophila willistoni
ref|NP_001013515.1|  guanine nucleotide-binding protein G(I)/G(S)...    160   2e-43    Danio rerio [leopard danio]
ref|XP_007786191.1|  Guanine nucleotide-binding protein subunit beta    160   2e-43    Endocarpon pusillum Z07020
ref|XP_005165361.1|  PREDICTED: guanine nucleotide-binding protei...    160   2e-43    Danio rerio [leopard danio]
gb|KIW40198.1|  guanine nucleotide-binding protein subunit beta         160   2e-43    Exophiala oligosperma
ref|XP_001963646.1|  GF20505                                            160   2e-43    Drosophila ananassae
ref|NP_525090.1|  G protein beta-subunit 13F, isoform A                 160   2e-43    Drosophila melanogaster
emb|CDP96801.1|  Protein BM-GPB-1, isoform a                            160   3e-43    Brugia malayi [agent of lymphatic filariasis]
ref|NP_998646.1|  guanine nucleotide binding protein (G protein),...    160   3e-43    Danio rerio [leopard danio]
gb|EEH40417.2|  guanine nucleotide-binding protein subunit beta         160   3e-43    Paracoccidioides lutzii Pb01
gb|KIY03752.1|  guanine nucleotide-binding protein subunit beta         161   3e-43    Fonsecaea multimorphosa CBS 102226
gb|AAU12180.1|  G protein beta 1 subunit                                160   3e-43    Penaeus vannamei [white Pacific shrimp]
ref|XP_001991835.1|  GH12882                                            160   3e-43    Drosophila grimshawi
ref|XP_007844457.1|  guanine nucleotide binding protein beta subu...    160   3e-43    
ref|XP_002621970.1|  small G-beta protein GPB                           160   3e-43    Blastomyces gilchristii SLH14081
ref|XP_002012317.1|  GI14221                                            160   3e-43    Drosophila mojavensis
ref|XP_003379057.1|  guanine nucleotide-binding protein subunit b...    160   3e-43    Trichinella spiralis
emb|CEF60778.1|  Guanine nucleotide-binding protein subunit beta-4      160   3e-43    Strongyloides ratti
gb|EJD74494.1|  guanine nucleotide-binding protein subunit beta-1       160   3e-43    Loa loa
sp|Q5GIS3.1|GBB_PINFU  RecName: Full=Guanine nucleotide-binding p...    159   3e-43    Pinctada fucata
gb|KFQ86003.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    159   3e-43    Phoenicopterus ruber ruber
gb|EEQ90059.1|  small G-beta protein GPB                                160   3e-43    
gb|KDQ63041.1|  hypothetical protein JAAARDRAFT_29031                   160   3e-43    Jaapia argillacea MUCL 33604
dbj|BAO20876.1|  guanine nucleotide-binding protein (G protein), ...    159   3e-43    Patiria pectinifera
gb|EFX88843.1|  guanine nucleotide binding protein, beta subunit        159   3e-43    Daphnia pulex
gb|ACB05680.1|  G protein beta subunit                                  159   3e-43    Euprymna scolopes
gb|ADJ96637.1|  GTP-binding protein beta subunit                        159   3e-43    Bursaphelenchus xylophilus [pine wilt nematode]
gb|KIH68783.1|  WD domain, G-beta repeat protein                        158   3e-43    Ancylostoma duodenale
gb|KIL71611.1|  hypothetical protein M378DRAFT_174841                   160   3e-43    Amanita muscaria Koide BX008
ref|XP_008712871.1|  guanine nucleotide-binding protein subunit beta    160   3e-43    Cyphellophora europaea CBS 101466
dbj|BAJ94652.1|  predicted protein                                      160   3e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006957610.1|  guanine nucleotide binding protein beta subu...    160   3e-43    Wallemia mellicola CBS 633.66
ref|XP_007298281.1|  G-protein beta subunit                             160   3e-43    Stereum hirsutum FP-91666 SS1
ref|XP_007740645.1|  guanine nucleotide-binding protein subunit beta    160   3e-43    Cladophialophora psammophila CBS 110553
gb|KIK70487.1|  hypothetical protein GYMLUDRAFT_147651                  160   3e-43    
gb|KIK30110.1|  hypothetical protein PISMIDRAFT_671161                  160   3e-43    
ref|NP_001254312.1|  Protein GPB-1, isoform a                           159   4e-43    
ref|XP_003021074.1|  hypothetical protein TRV_04826                     160   4e-43    
gb|EPE07329.1|  heterotrimeric g-protein beta subunit                   160   4e-43    
ref|XP_010760821.1|  guanine nucleotide-binding protein subunit beta    160   4e-43    
ref|XP_010210682.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-43    
gb|AAL90861.1|AF484341_1  G-protein beta subunit                        160   4e-43    
emb|CAA35532.1|  G-protein                                              159   4e-43    
ref|XP_008730131.1|  guanine nucleotide-binding protein subunit beta    160   4e-43    
gb|KIW85998.1|  guanine nucleotide-binding protein subunit beta         160   4e-43    
gb|KIX08259.1|  guanine nucleotide-binding protein subunit beta         160   4e-43    
gb|KIW33780.1|  guanine nucleotide-binding protein subunit beta         160   4e-43    
gb|KDB20108.1|  guanine nucleotide-binding protein subunit beta         159   4e-43    
ref|XP_004591382.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-43    
ref|XP_003067194.1|  Guanine nucleotide-binding protein beta subu...    160   4e-43    
gb|KGL75733.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    158   4e-43    
ref|XP_007760803.1|  guanine nucleotide-binding protein subunit beta    159   4e-43    
gb|AFJ79447.1|  G protein beta subunit                                  160   4e-43    
gb|EHH17199.1|  hypothetical protein EGK_13538                          155   4e-43    
ref|XP_010384208.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-43    
ref|XP_009540278.1|  hypothetical protein HETIRDRAFT_30594              159   4e-43    
gb|AAH00115.1|  Guanine nucleotide binding protein (G protein), b...    159   4e-43    
ref|XP_001495326.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-43    
gb|EPT03478.1|  hypothetical protein FOMPIDRAFT_1022435                 159   4e-43    
ref|XP_006693118.1|  G protein beta subunit-like protein                160   4e-43    
ref|NP_002066.1|  guanine nucleotide-binding protein G(I)/G(S)/G(...    159   4e-43    
ref|XP_007379313.1|  guanine nucleotide binding protein beta subunit    159   4e-43    
ref|XP_001239616.1|  guanine nucleotide-binding protein beta subunit    159   4e-43    
gb|KIV87521.1|  guanine nucleotide-binding protein subunit beta         159   4e-43    
ref|XP_009955153.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-43    
ref|XP_004424767.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-43    
ref|XP_008597057.1|  heterotrimeric G protein beta subunit              159   4e-43    
ref|XP_007946466.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-43    
ref|XP_005235415.1|  PREDICTED: guanine nucleotide-binding protei...    159   4e-43    
gb|KIW60360.1|  guanine nucleotide-binding protein subunit beta         159   4e-43    
gb|KIV92928.1|  guanine nucleotide-binding protein subunit beta         159   4e-43    
gb|EQL27839.1|  guanine nucleotide-binding protein subunit beta         159   4e-43    
ref|XP_007232826.1|  PREDICTED: guanine nucleotide-binding protei...    159   5e-43    
ref|XP_009478038.1|  PREDICTED: guanine nucleotide-binding protei...    159   5e-43    
ref|XP_002822884.1|  PREDICTED: guanine nucleotide-binding protei...    159   5e-43    
gb|KDN37942.1|  putative G-protein beta subunit Bpp1                    160   5e-43    
ref|XP_004038092.1|  PREDICTED: guanine nucleotide-binding protei...    159   5e-43    
ref|XP_002584356.1|  guanine nucleotide-binding protein beta subunit    159   5e-43    
emb|CDW52509.1|  guanine nucleotide binding protein subunit             159   5e-43    
gb|AFD33363.1|  G protein beta 1                                        159   5e-43    
gb|AAT40565.1|  small G-beta protein GPB                                159   5e-43    
ref|XP_009478052.1|  PREDICTED: guanine nucleotide-binding protei...    159   5e-43    
dbj|BAF83260.1|  unnamed protein product                                159   5e-43    
ref|XP_008497347.1|  PREDICTED: guanine nucleotide-binding protei...    159   5e-43    
ref|XP_007965599.1|  PREDICTED: guanine nucleotide-binding protei...    158   5e-43    
gb|KIW64254.1|  guanine nucleotide-binding protein subunit beta         159   5e-43    
ref|XP_008497348.1|  PREDICTED: guanine nucleotide-binding protei...    159   5e-43    
ref|XP_008297219.1|  PREDICTED: guanine nucleotide-binding protei...    159   5e-43    
gb|KFU98078.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    159   6e-43    
ref|XP_009564992.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
ref|XP_007537105.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
ref|XP_004527108.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
ref|XP_003663156.1|  hypothetical protein MYCTH_2304670                 159   6e-43    
ref|XP_009930326.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
gb|KIW98040.1|  guanine nucleotide-binding protein subunit beta         160   6e-43    
ref|XP_006219841.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
dbj|BAC26917.1|  unnamed protein product                                157   6e-43    
ref|XP_003456880.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
ref|NP_038558.1|  guanine nucleotide-binding protein G(I)/G(S)/G(...    159   6e-43    
ref|XP_003440070.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
ref|NP_001092503.1|  guanine nucleotide-binding protein subunit b...    159   6e-43    
ref|XP_005735592.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
ref|XP_008031945.1|  G-protein beta subunit                             159   6e-43    
gb|KGB36772.1|  Guanine nucleotide-binding protein subunit beta         160   6e-43    
gb|EER38890.1|  small G-beta protein GPB                                157   6e-43    
ref|XP_004563951.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
gb|KJA28607.1|  hypothetical protein HYPSUDRAFT_62246                   159   6e-43    
ref|XP_004904454.1|  PREDICTED: guanine nucleotide-binding protei...    159   6e-43    
sp|O45040.1|GBB1_HOMAM  RecName: Full=Guanine nucleotide-binding ...    159   6e-43    
gb|EEH10050.1|  small G-beta protein GPB                                159   6e-43    
ref|XP_004603145.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_004647349.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
gb|KIY46334.1|  guanine nucleotide binding protein beta subunit 2       159   7e-43    
emb|CDO73153.1|  hypothetical protein BN946_scf185007.g208              159   7e-43    
gb|AAQ90156.1|  visual G-protein beta subunit                           159   7e-43    
ref|XP_009512645.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
gb|KHJ34880.1|  putative guanine nucleotide-binding protein beta ...    159   7e-43    
ref|XP_009897913.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_009696410.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_009564991.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
gb|KIM88701.1|  hypothetical protein PILCRDRAFT_813678                  159   7e-43    
ref|XP_009897915.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|XP_009810422.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|NP_001007453.1|  uncharacterized protein LOC492811                  157   7e-43    
ref|XP_004652379.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
gb|ACB97665.1|  G-protein beta subunit                                  159   7e-43    
sp|P23232.1|GBB_LOLFO  RecName: Full=Guanine nucleotide-binding p...    159   7e-43    
ref|XP_010208723.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|XP_010565876.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_009930323.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_009474496.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_011292221.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_005146699.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_009696411.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|XP_005383097.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|NP_067642.1|  guanine nucleotide-binding protein subunit beta-4     159   7e-43    
ref|XP_009978715.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|XP_008703526.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_010565877.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|XP_009474497.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|XP_009978713.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_006884085.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_006811873.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|XP_009930324.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
ref|XP_004003182.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
emb|CDJ81143.1|  WD40 repeat domain containing protein                  158   7e-43    
ref|XP_004479026.1|  PREDICTED: guanine nucleotide-binding protei...    159   7e-43    
emb|CEG80074.1|  Putative Guanine nucleotide binding protein beta...    159   7e-43    
ref|XP_009683421.1|  PREDICTED: guanine nucleotide-binding protei...    158   7e-43    
ref|XP_007935314.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
dbj|BAD92520.1|  guanine nucleotide-binding protein, beta-3 subun...    158   8e-43    
ref|XP_008566332.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_005016818.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_010290515.1|  PREDICTED: guanine nucleotide-binding protei...    158   8e-43    
ref|XP_008406240.1|  PREDICTED: guanine nucleotide-binding protei...    158   8e-43    
ref|XP_009810421.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_009930322.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_003655108.1|  hypothetical protein THITE_2118396                 159   8e-43    
gb|KFB44464.1|  AGAP005913-PA-like protein                              159   8e-43    
ref|XP_008143081.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_545211.1|  PREDICTED: guanine nucleotide-binding protein s...    159   8e-43    
ref|XP_006750274.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_009810420.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_004448567.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_009810419.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-43    
ref|XP_009656945.1|  guanine nucleotide-binding protein subunit beta    158   8e-43    
ref|XP_010208722.1|  PREDICTED: guanine nucleotide-binding protei...    158   8e-43    
ref|XP_006038431.1|  PREDICTED: guanine nucleotide-binding protei...    158   8e-43    
ref|XP_004398413.1|  PREDICTED: guanine nucleotide-binding protei...    158   8e-43    
emb|CEG66533.1|  Putative Guanine nucleotide-binding protein subu...    159   8e-43    
gb|KFW04858.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    158   8e-43    
ref|XP_003467593.1|  PREDICTED: guanine nucleotide-binding protei...    158   8e-43    
ref|NP_001011107.1|  guanine nucleotide binding protein (G protei...    158   8e-43    
sp|Q08706.1|GBB_LYMST  RecName: Full=Guanine nucleotide-binding p...    159   8e-43    
gb|KIJ29823.1|  hypothetical protein M422DRAFT_268694                   159   8e-43    
ref|XP_009683420.1|  PREDICTED: guanine nucleotide-binding protei...    158   8e-43    
gb|KFP46588.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    158   8e-43    
gb|AIC56938.1|  GNB4                                                    158   8e-43    
ref|XP_006273452.1|  PREDICTED: guanine nucleotide-binding protei...    158   8e-43    
gb|ENH75085.1|  Guanine nucleotide-binding protein subunit beta         159   8e-43    
ref|XP_009918990.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    158   9e-43    
gb|KIM70152.1|  hypothetical protein SCLCIDRAFT_12727                   159   9e-43    
ref|XP_002758128.1|  PREDICTED: guanine nucleotide-binding protei...    158   9e-43    
ref|NP_001080452.1|  guanine nucleotide binding protein (G protei...    158   9e-43    
ref|XP_010149498.1|  PREDICTED: guanine nucleotide-binding protei...    158   9e-43    
ref|XP_009512644.1|  PREDICTED: guanine nucleotide-binding protei...    158   9e-43    
ref|XP_009930321.1|  PREDICTED: guanine nucleotide-binding protei...    159   9e-43    
ref|XP_010149497.1|  PREDICTED: guanine nucleotide-binding protei...    158   9e-43    
gb|KFP36036.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    157   9e-43    
ref|XP_010290514.1|  PREDICTED: guanine nucleotide-binding protei...    158   9e-43    
gb|EIE75342.1|  hypothetical protein RO3G_00046                         159   9e-43    
ref|XP_006237445.1|  PREDICTED: guanine nucleotide-binding protei...    157   9e-43    
ref|XP_010118278.1|  PREDICTED: guanine nucleotide-binding protei...    157   9e-43    
ref|XP_005111356.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
gb|ADN95999.1|  GTP binding protein beta subunit                        159   1e-42    
ref|XP_001398668.1|  guanine nucleotide-binding protein subunit beta    159   1e-42    
gb|ADB12512.1|  GTP binding protein beta subunit                        159   1e-42    
gb|EYE94068.1|  guanine nucleotide-binding protein beta subunit         159   1e-42    
gb|EWY85348.1|  guanine nucleotide-binding protein subunit beta         157   1e-42    
dbj|BAB69489.1|  guanine nucleotide-binding protein beta subunit        159   1e-42    
gb|ADF97618.1|  guanine nucleotide-binding protein beta polypepti...    158   1e-42    
gb|EMT65914.1|  Guanine nucleotide-binding protein subunit beta         159   1e-42    
ref|XP_003002364.1|  guanine nucleotide-binding protein subunit beta    158   1e-42    
ref|XP_006803381.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_315943.3|  AGAP005913-PA                                         158   1e-42    
gb|EFB29343.1|  hypothetical protein PANDA_000240                       157   1e-42    
ref|XP_009245660.1|  PREDICTED: guanine nucleotide-binding protei...    159   1e-42    
ref|XP_008205635.1|  PREDICTED: guanine nucleotide-binding protei...    155   1e-42    
emb|CCD76389.1|  putative g-protein, beta subunit                       158   1e-42    
ref|XP_009810418.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_007923553.1|  g-protein beta subunit-like protein                158   1e-42    
gb|KIM47595.1|  hypothetical protein M413DRAFT_439261                   158   1e-42    
dbj|GAA97540.1|  hypothetical protein E5Q_04218                         161   1e-42    
gb|ADO28368.1|  guanine nucleotide-binding protein g(i)/g(s)/g(t)...    158   1e-42    
ref|XP_004448566.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_008971923.1|  PREDICTED: guanine nucleotide-binding protei...    159   1e-42    
gb|KFM80559.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    158   1e-42    
ref|XP_009199588.1|  PREDICTED: guanine nucleotide-binding protei...    157   1e-42    
dbj|BAQ19551.1|  guanine nucleotide-binding protein, beta               158   1e-42    
ref|XP_004570295.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_007069693.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_001657260.1|  AAEL013997-PA                                      158   1e-42    
ref|XP_006963580.1|  heterotrimeric G protein, beta subunit             158   1e-42    
ref|XP_004675045.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_009100870.1|  PREDICTED: guanine nucleotide-binding protei...    157   1e-42    
gb|EHK46560.1|  heterotrimeric G protein beta subunit                   158   1e-42    
ref|XP_007797937.1|  putative guanine nucleotide-binding protein ...    158   1e-42    
ref|XP_008924224.1|  PREDICTED: guanine nucleotide-binding protei...    157   1e-42    
ref|XP_007518188.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
gb|EME48011.1|  G protein beta like subunit                             158   1e-42    
ref|XP_007832652.1|  Guanine nucleotide-binding protein subunit beta    158   1e-42    
gb|KEI41986.1|  hypothetical protein L969DRAFT_43010                    161   1e-42    
gb|KIE01589.1|  G protein beta subunit                                  158   1e-42    
ref|XP_009251519.1|  hypothetical protein FPSE_00124                    158   1e-42    
ref|XP_008924073.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_011386498.1|  G-protein beta subunit Bpp1                        158   1e-42    
ref|XP_006124209.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_003746776.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
gb|ABE72964.1|  G-protein beta subunit                                  158   1e-42    
gb|KIJ22142.1|  hypothetical protein PAXINDRAFT_165409                  158   1e-42    
dbj|GAC99464.1|  hypothetical protein PHSY_007065                       158   1e-42    
ref|XP_005506341.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
gb|KFB44468.1|  guanine nucleotide-binding protein subunit beta 1       158   1e-42    
ref|XP_007265325.1|  guanine nucleotide binding protein beta subu...    158   1e-42    
ref|XP_007818659.2|  G protein beta subunit                             158   1e-42    
ref|XP_003044802.1|  predicted protein                                  158   1e-42    
ref|XP_010073124.1|  PREDICTED: guanine nucleotide-binding protei...    159   1e-42    
ref|XP_315941.1|  AGAP005911-PA                                         158   1e-42    
gb|KFH43953.1|  Guanine nucleotide-binding protein subunit beta-l...    158   1e-42    
emb|CAQ86900.1|  G protein beta subunit                                 158   1e-42    
ref|XP_003202725.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
ref|XP_010630753.1|  PREDICTED: guanine nucleotide-binding protei...    158   1e-42    
gb|KIY65983.1|  guanine nucleotide binding protein beta subunit 2       158   1e-42    
gb|EMF15237.1|  G-protein beta subunit                                  158   1e-42    
gb|ETN60410.1|  guanine nucleotide-binding protein beta 3 (g prot...    158   1e-42    



>emb|CDO97059.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   363 bits (932),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AATQTV++LR+RLK+KRLLLLDTDVA Y+RSQG+TP+SFGPTDLVCCR 
Sbjct  1    MSVAELKERHLAATQTVSALRDRLKQKRLLLLDTDVAGYSRSQGRTPVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGH GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHNGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VS+ LSGHKGYVS+CQYVP+EDAHLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLPVSKMLSGHKGYVSSCQYVPDEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            CGLWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CGLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|EYU37791.1| hypothetical protein MIMGU_mgv1a008244mg [Erythranthe guttata]
Length=380

 Score =   363 bits (932),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVA+LKERHMAAT+TVNSLR+RLK+KRLLLLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVADLKERHMAATETVNSLRDRLKQKRLLLLDTDVAGYARSQGKTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN P D DGN  VSRTLSGHKGYVS+CQYVP+ED HLIT+SGD+T
Sbjct  121  SVACGGLDSMCSIFNLNSPTDKDGNLPVSRTLSGHKGYVSSCQYVPDEDTHLITASGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>sp|P93397.1|GBB1_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-1 
[Nicotiana tabacum]
 emb|CAB06618.1| G protein beta subunit [Nicotiana tabacum]
Length=377

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|AIL52187.1| heterotrimeric G-protein beta subunit [Capsicum annuum]
Length=377

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERHM ATQTVN LRE+LK+KRL LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMVATQTVNDLREKLKQKRLQLLDTDVAGYARSQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_009800901.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Nicotiana sylvestris]
Length=377

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|AAG12330.1|AF249743_1 heterotrimeric GTP-binding protein subunit beta 1 [Nicotiana 
tabacum]
Length=377

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|ACR77529.1| heterotrimeric G protein beta 2 subunit [Nicotiana benthamiana]
Length=377

 Score =   361 bits (926),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAATQTVN L E+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVKELKERHMAATQTVNDLCEKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|KHG11481.1| Guanine nucleotide-binding subunit beta-2 [Gossypium arboreum]
Length=377

 Score =   360 bits (923),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKE+H AAT+TVN+LRERLK++R  LLDTDVATYARSQGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKEKHAAATETVNNLRERLKQRRQQLLDTDVATYARSQGKSPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN P D DGN  VS+TLSGHKGYVS CQYVP+ED H+ITSSGD+T
Sbjct  121  SVACGGLDSMCSIFNLNSPTDRDGNLPVSKTLSGHKGYVSCCQYVPDEDIHIITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|KJB32495.1| hypothetical protein B456_005G243000 [Gossypium raimondii]
Length=377

 Score =   360 bits (923),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKE+H AAT+TVN+LRERLK++R  LLDTDVATYARSQGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKEKHAAATETVNNLRERLKQRRQQLLDTDVATYARSQGKSPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN P D DGN  VS+TLSGHKGYVS CQYVP+ED H+ITSSGD+T
Sbjct  121  SVACGGLDSMCSIFNLNSPTDRDGNLPVSKTLSGHKGYVSCCQYVPDEDIHIITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|AJE63427.1| heterotrimeric G protein beta 2 subunit [Capsicum annuum]
Length=377

 Score =   360 bits (923),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHM ATQTVN LRE+LK+KRL LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMVATQTVNDLREKLKQKRLQLLDTDVAGYARSQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_011048621.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X2 [Populus euphratica]
Length=375

 Score =   359 bits (921),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH+AAT+TVNSLRERLK+KRLLLLDTD+A +AR+QG+ P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLRERLKQKRLLLLDTDIAGHARAQGRNPVSFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPAGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_009605958.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Nicotiana tomentosiformis]
 sp|P93398.1|GBB2_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-2 
[Nicotiana tabacum]
 emb|CAB06619.1| G protein beta subunit [Nicotiana tabacum]
Length=377

 Score =   358 bits (920),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP+ FGPTDLVCCR 
Sbjct  1    MSVKELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVIFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED H+ITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHVITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_003631647.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Vitis vinifera]
 emb|CBI32581.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   358 bits (920),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERHMAAT+TVNSLRERLK+KRLLLLDTDVA YAR+QGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATETVNSLRERLKQKRLLLLDTDVAGYARAQGKSPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTTEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  +S+ LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLAMSKMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_011048613.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X1 [Populus euphratica]
Length=377

 Score =   358 bits (919),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH+AAT+TVNSLRERLK+KRLLLLDTD+A +AR+QG+ P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLRERLKQKRLLLLDTDIAGHARAQGRNPVSFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPAGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_002313052.1| ERECTA-LIKE 4 family protein [Populus trichocarpa]
 gb|EEE87007.1| ERECTA-LIKE 4 family protein [Populus trichocarpa]
Length=377

 Score =   358 bits (919),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH+AAT+TVNSL ERLK+KRLLLLDTD+A +AR+QG+ P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLGERLKQKRLLLLDTDIAGHARAQGRNPVSFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPAGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>sp|Q40507.1|GBB3_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Nicotiana tabacum]
 emb|CAA66842.1| G protein [Nicotiana tabacum]
Length=375

 Score =   358 bits (918),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAATQTV+ LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVSDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSI+NLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIYNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_011037538.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Populus euphratica]
Length=377

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH+AAT+TVNSLRERLK+KRLLLLDTD+ATYAR+Q ++P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLRERLKQKRLLLLDTDMATYARAQERSPVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTG+RTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGIRTSVFGGEFQSGHTADV  207



>ref|XP_002509478.1| guanine nucleotide-binding protein beta, putative [Ricinus communis]
 gb|EEF50865.1| guanine nucleotide-binding protein beta, putative [Ricinus communis]
Length=377

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELK RH+AAT+TVN+LRERLK+KRLLLLDTDVA YAR+QGKTP+SFGPTDLVCCR 
Sbjct  1    MSVAELKARHVAATETVNTLRERLKQKRLLLLDTDVAGYARAQGKTPVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTAEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P + DGN  VS+ LSGHKGYVSACQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTEKDGNLPVSKMLSGHKGYVSACQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>sp|P93339.1|GBB_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta; 
AltName: Full=NpGPB1 [Nicotiana plumbaginifolia]
 emb|CAA70704.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=377

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+G 
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGH  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+Q GHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQFGHTADV  207



>ref|XP_004230907.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Solanum 
lycopersicum]
Length=377

 Score =   356 bits (913),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YA++QGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYAKTQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN P D DG   VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|NP_001240891.1| uncharacterized protein LOC100811645 [Glycine max]
 gb|ACU21225.1| unknown [Glycine max]
 gb|KHN33759.1| Guanine nucleotide-binding protein subunit beta-2 [Glycine soja]
Length=377

 Score =   356 bits (913),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH+AAT+TVNSLRERLKE+RL LLDTD+A YARSQG++P++FGPTDLVCCR 
Sbjct  1    MSVTELKERHLAATETVNSLRERLKERRLSLLDTDIAGYARSQGRSPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGH GKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHAGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCS+FNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSLFNLNSPTDRDGNLAVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|AAD49742.1|AF170921_1 G protein beta subunit [Pisum sativum]
Length=377

 Score =   355 bits (912),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AAT+TVN+LRERLK++RL LLDTD+A YARSQG+ P++FGPTD++CCR 
Sbjct  1    MSVAELKERHIAATETVNNLRERLKQRRLSLLDTDIAGYARSQGRAPVTFGPTDILCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_002306098.1| ERECTA-LIKE 4 family protein [Populus trichocarpa]
 gb|EEE86609.1| ERECTA-LIKE 4 family protein [Populus trichocarpa]
Length=377

 Score =   355 bits (911),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH+AAT+TVNSLRERLK+KRLLLLDTD+A YAR+Q ++P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLRERLKQKRLLLLDTDMARYARAQERSPVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTG+RTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGIRTSVFGGEFQSGHTADV  207



>ref|XP_008236879.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Prunus mume]
Length=377

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA++TVNSLRERLK+KR  LLDTDVA YA+SQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASETVNSLRERLKQKRASLLDTDVAGYAKSQGKTPLTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN   D DGN  VSRTLSGHKGYVS+CQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSLCDKDGNLPVSRTLSGHKGYVSSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|KCW55344.1| hypothetical protein EUGRSUZ_I01264 [Eucalyptus grandis]
Length=313

 Score =   353 bits (905),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/222 (82%), Positives = 198/222 (89%), Gaps = 1/222 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH AAT+TVNSLRERLK+KR+ LLDTDVA YAR+QGKTP++FG TDLVCCR 
Sbjct  1    MSVAELKERHRAATETVNSLRERLKQKRVQLLDTDVAGYARTQGKTPVTFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVS SQDGR IVWNALTSQKTHAI+LPCAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSVSQDGRFIVWNALTSQKTHAIRLPCAWVMTCAFAPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ DAHLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPVDRDGNLPVSRMLSGHKGYVSSCQYVPDGDAHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADVSR*VGDVQV*YSLXV  681
            C LWDITTGLRTSVFGGE+QSGHTADV R + D++  + L V
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADVLR-LFDIRTGHELQV  221



>ref|XP_007201063.1| hypothetical protein PRUPE_ppa007241mg [Prunus persica]
 gb|EMJ02262.1| hypothetical protein PRUPE_ppa007241mg [Prunus persica]
Length=377

 Score =   355 bits (910),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA++TVNSLRERLKEKR  LLDTDVA YA+SQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASETVNSLRERLKEKRASLLDTDVAGYAKSQGKTPLTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN   D DGN  VSRTLSGHKGYVS+CQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSLCDKDGNLPVSRTLSGHKGYVSSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_010107843.1| Guanine nucleotide-binding protein subunit beta-2 [Morus notabilis]
 gb|EXC17243.1| Guanine nucleotide-binding protein subunit beta-2 [Morus notabilis]
Length=377

 Score =   355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+A T+TVNSLRE+L+++RL LLDTDVA YA+SQG+TP+ FGPTDLVCCR 
Sbjct  1    MSVAELKERHVATTETVNSLREQLRQRRLSLLDTDVAGYAKSQGRTPVRFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVM CAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMNCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  V++TL GH+GYVS+CQYVP ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLPVAKTLIGHRGYVSSCQYVPEEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_008375922.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Malus domestica]
Length=377

 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA+ TVNSLRERLK+KR  LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASDTVNSLRERLKQKRASLLDTDVAEYARSQGKTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN   D DGN  VSRTLSGHKGYVS+CQYVP+ED HLI+ SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSLCDKDGNLPVSRTLSGHKGYVSSCQYVPDEDTHLISGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_004299095.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Fragaria vesca subsp. vesca]
Length=377

 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA++TVNSLRERLK+KR  LLDTDVA YARSQGK  ++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASETVNSLRERLKQKRASLLDTDVAGYARSQGKAALTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNL+ P D DGN  VSRTL+GHKGYVSACQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLSSPCDKDGNLPVSRTLNGHKGYVSACQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHT DV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTGDV  207



>ref|XP_003603911.1| Guanine nucleotide-binding protein subunit beta-1 [Medicago truncatula]
 gb|AES74162.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=378

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH+AAT+TVN+LRERLK++RL LLDTD+A YA+SQG+TP++FGPTD++CCR 
Sbjct  1    MSVTELKERHIAATETVNNLRERLKQRRLSLLDTDIAGYAKSQGRTPVTFGPTDILCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>sp|P93563.1|GBB_SOLTU RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Solanum tuberosum]
 emb|CAA61106.1| GB1 protein [Solanum tuberosum]
Length=377

 Score =   354 bits (908),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YA+ QGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYAKRQGKSPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN P D DG   VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|KDP46245.1| hypothetical protein JCGZ_10085 [Jatropha curcas]
Length=377

 Score =   353 bits (907),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELK RH+AAT+TVN+LRERLK+KRLLLLDTDVA YAR+QGK P+SFGPTDLVCCR 
Sbjct  1    MSVAELKARHVAATETVNTLRERLKQKRLLLLDTDVAGYARAQGKPPVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VS+ LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLPVSKMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|NP_001274886.1| guanine nucleotide-binding protein subunit beta [Solanum tuberosum]
 gb|AAL07488.1|AF414114_1 G protein beta subunit 2 [Solanum tuberosum]
Length=377

 Score =   353 bits (907),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YA++QGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYAKTQGKTPVTFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN P D DG   VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTAD  633
            C LWDITTGLRTSVFGGE+QSGHTAD
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTAD  206



>ref|XP_003527220.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
isoformX1 [Glycine max]
 ref|XP_006581122.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
isoform X2 [Glycine max]
Length=377

 Score =   353 bits (907),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH+AAT+T+NSLRERLKE+RL LLDTD+A YARSQG+ P++FGPTDLVCCR 
Sbjct  1    MSVTELKERHLAATETINSLRERLKERRLSLLDTDIAGYARSQGRAPVTFGPTDLVCCRA  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VS+ LSGHKGYVS+CQYVP+ED HL+T SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPADRDGNLAVSQMLSGHKGYVSSCQYVPDEDTHLVTGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTG RTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGFRTSVFGGEFQSGHTADV  207



>gb|KHN20072.1| Guanine nucleotide-binding protein subunit beta-2 [Glycine soja]
Length=377

 Score =   353 bits (907),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH+AAT+T+NSLRERLKE+RL LLDTD+A YARSQG+ P++FGPTDLVCCR 
Sbjct  1    MSVTELKERHLAATETINSLRERLKERRLSLLDTDIAGYARSQGRAPVTFGPTDLVCCRA  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VS+ LSGHKGYVS+CQYVP+ED HL+T SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPADRDGNLAVSQMLSGHKGYVSSCQYVPDEDTHLVTGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTG RTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGFRTSVFGGEFQSGHTADV  207



>ref|XP_010254875.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X2 [Nelumbo nucifera]
Length=379

 Score =   353 bits (906),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AAT TVN+LRERLK+KR LLLDTDVA YARSQG+TP+SFGPTDLVCCR 
Sbjct  1    MSVAELKERHIAATATVNALRERLKQKRTLLLDTDVAGYARSQGRTPVSFGPTDLVCCRI  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPVDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  CVLWDVTTGQRLSVFGGEFPSGHTADV  207



>ref|XP_004500814.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Cicer arietinum]
Length=378

 Score =   352 bits (903),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH+AAT+TVN+LRERLK++RL LLDTD++ YA+SQG+TP++FGPTD++CCR 
Sbjct  1    MSVTELKERHIAATETVNNLRERLKQRRLSLLDTDISGYAKSQGRTPVTFGPTDILCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_011088384.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Sesamum 
indicum]
Length=377

 Score =   352 bits (902),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERHMAAT+TVNSLR+RL+++RLLLLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATETVNSLRDRLRQQRLLLLDTDVAGYARSQGKTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKV+SLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVHSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN   DNDG+  VSR LSGHKGYVS+CQYVP+ED HLIT+SGD T
Sbjct  121  SVACGGLDSMCSIFNLNTQTDNDGHMPVSRMLSGHKGYVSSCQYVPDEDTHLITASGDHT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHT+DV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTSDV  207



>gb|AEQ61903.1| GTP-binding protein beta subunit [Salvia miltiorrhiza]
Length=377

 Score =   352 bits (902),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERHMAA +TVNSL+ERLK+KRLLLLDTDVA YAR+QG+T +SFGPTDLVCCR 
Sbjct  1    MSVAELKERHMAAAETVNSLKERLKQKRLLLLDTDVAGYARAQGQTRVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGH+GKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHSGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN   D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT+SGD+T
Sbjct  121  SVACGGLDSMCSIFNLNSQTDKDGNPPVSRMLSGHKGYVSSCQYVPDEDTHLITASGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_007042211.1| GTP binding protein beta 1 isoform 1 [Theobroma cacao]
 ref|XP_007042212.1| GTP binding protein beta 1 isoform 1 [Theobroma cacao]
 gb|EOX98042.1| GTP binding protein beta 1 isoform 1 [Theobroma cacao]
 gb|EOX98043.1| GTP binding protein beta 1 isoform 1 [Theobroma cacao]
Length=377

 Score =   351 bits (900),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKER  AAT+TVN+LRERL+++RL L+DTDVA YARSQG++P++FGPTDLVCCR 
Sbjct  1    MSVVELKERLSAATETVNNLRERLRQRRLQLIDTDVAEYARSQGRSPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN P D DGN  VS+TLSGHKGYVS CQYVP+ED H+ITSSGD+T
Sbjct  121  SVACGGLDSMCSIFNLNSPTDRDGNLPVSKTLSGHKGYVSCCQYVPDEDIHIITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_009779361.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
isoform X1 [Nicotiana sylvestris]
Length=380

 Score =   351 bits (900),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAA QTVN+LRERLK+KRL LLDTDVA YARSQGK P+SFGPTDLVCCR 
Sbjct  4    MSVTELKERHMAANQTVNTLRERLKQKRLHLLDTDVAGYARSQGKAPVSFGPTDLVCCRI  63

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP G 
Sbjct  64   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPFGH  123

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D +GN  +SR LSGHKGYVSACQYVP+E+ H+IT SGD+T
Sbjct  124  SVACGGLDSVCSIFNLNSPTDKEGNLPLSRMLSGHKGYVSACQYVPDEEGHMITGSGDQT  183

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGH+ADV
Sbjct  184  CILWDITTGLRTSVFGGEFQSGHSADV  210



>ref|XP_009609408.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Nicotiana tomentosiformis]
Length=380

 Score =   350 bits (899),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERHMAA QTVN+LRERLK+KRL LLDTDVA YARSQG TP+SFGPTDLVCCR 
Sbjct  4    MSVTELKERHMAANQTVNTLRERLKQKRLHLLDTDVAGYARSQGITPVSFGPTDLVCCRI  63

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGH+GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  64   LQGHSGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPIGQ  123

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D +GN  +SR LSGHKGYVSACQYVP+ED H+IT SGD+T
Sbjct  124  SVACGGLDSVCSIFNLNSPTDKEGNLPLSRMLSGHKGYVSACQYVPDEDGHVITGSGDQT  183

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGG++QSGH+ADV
Sbjct  184  CILWDITTGLRTSVFGGDFQSGHSADV  210



>ref|XP_010028582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Eucalyptus grandis]
 gb|KCW55345.1| hypothetical protein EUGRSUZ_I01264 [Eucalyptus grandis]
Length=377

 Score =   350 bits (898),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH AAT+TVNSLRERLK+KR+ LLDTDVA YAR+QGKTP++FG TDLVCCR 
Sbjct  1    MSVAELKERHRAATETVNSLRERLKQKRVQLLDTDVAGYARTQGKTPVTFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVS SQDGR IVWNALTSQKTHAI+LPCAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSVSQDGRFIVWNALTSQKTHAIRLPCAWVMTCAFAPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ DAHLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPVDRDGNLPVSRMLSGHKGYVSSCQYVPDGDAHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|AAM97354.1| G protein beta subunit [Pisum sativum]
Length=377

 Score =   350 bits (897),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVA++KERH+AAT+TVN+LRERLK++RL LLDTD+A YARSQG+ P++ GPTD++CCR 
Sbjct  1    MSVADVKERHIAATETVNNLRERLKQRRLSLLDTDIAGYARSQGRAPVTLGPTDILCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_010690896.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Beta vulgaris subsp. vulgaris]
Length=391

 Score =   350 bits (898),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +1

Query  1    EGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  180
            E + KMSVAELKERH AA + VNSLRE+LK++R  LLDTDVA++A SQGK  +SFG TDL
Sbjct  10   EKREKMSVAELKERHTAAIEQVNSLREQLKQRRRHLLDTDVASFAASQGKATVSFGQTDL  69

Query  181  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  360
            VCCR LQGH+GKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF
Sbjct  70   VCCRTLQGHSGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  129

Query  361  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  540
            SPTGQSVACGGLDSVCSIFNLN P D +GN  VS+TLSGHKGYVS CQY+P+EDAHLITS
Sbjct  130  SPTGQSVACGGLDSVCSIFNLNSPTDREGNLPVSKTLSGHKGYVSCCQYIPDEDAHLITS  189

Query  541  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            SGD+TC LWD TTGLRTSVFGGE+QSGHT+DV
Sbjct  190  SGDQTCILWDTTTGLRTSVFGGEFQSGHTSDV  221



>ref|XP_010263695.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X2 [Nelumbo nucifera]
Length=337

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELK+RH+AAT TVN+LRE+LK+KR+LLLDTDVA YARSQG+TP+SFGPTDLVCCR 
Sbjct  1    MSVAELKKRHIAATATVNALREQLKQKRILLLDTDVAGYARSQGRTPVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWN+LTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNSLTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSICSIFNLNSPNDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TT  R SVFGGE+ SGHTADV
Sbjct  181  CILWDVTTAQRLSVFGGEFPSGHTADV  207



>ref|XP_009345730.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Pyrus x bretschneideri]
Length=377

 Score =   348 bits (894),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+ A+ TV SLRERLK+KR  LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVVASDTVKSLRERLKQKRASLLDTDVAGYARSQGKTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN   D DGN  VSRTL GHKGYVS+CQYVP+ED HLI+ SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSLCDKDGNLPVSRTLGGHKGYVSSCQYVPDEDTHLISGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>gb|KDO49094.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis]
Length=379

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SV+ELKERH AA +TVNSLRERLK+KR  LLD DVA Y+RSQG+ P+SFGPTDLVCCR L
Sbjct  4    SVSELKERHAAAIETVNSLRERLKQKRQQLLDVDVAGYSRSQGRAPVSFGPTDLVCCRTL  63

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH GKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS
Sbjct  64   QGHAGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  123

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED HLITSSGD+TC
Sbjct  124  VACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSSGDQTC  183

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  184  VLWDITTGLRTSVFGGEFQSGHTADV  209



>ref|XP_009374178.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Pyrus 
x bretschneideri]
Length=378

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 191/208 (92%), Gaps = 1/208 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA+ TVNSLRERLK+KR  LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASDTVNSLRERLKQKRASLLDTDVAGYARSQGKTPLTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  VSRTL+GHKGYVS+CQYVP+EDAHLIT SGD T
Sbjct  121  SVACGGLDSACSIFNLNSLCDKDGNLPVSRTLNGHKGYVSSCQYVPDEDAHLITGSGDHT  180

Query  556  CGLWDITTGLRTSVFGGEYQSG-HTADV  636
            C LWDITTGLRTSVFGGE+QSG HTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGRHTADV  208



>ref|XP_006423250.1| hypothetical protein CICLE_v10028655mg [Citrus clementina]
 ref|XP_006487153.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Citrus sinensis]
 gb|ESR36490.1| hypothetical protein CICLE_v10028655mg [Citrus clementina]
Length=379

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SV+ELKERH AA +TVNSLRERLK+KR  LLD DVA Y+RSQG+ P+SFGPTDLVCCR L
Sbjct  4    SVSELKERHAAAIETVNSLRERLKQKRQQLLDVDVAGYSRSQGRAPVSFGPTDLVCCRTL  63

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH GKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS
Sbjct  64   QGHAGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  123

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED HLITSSGD+TC
Sbjct  124  VACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSSGDQTC  183

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  184  VLWDITTGLRTSVFGGEFQSGHTADV  209



>gb|KDO49095.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis]
Length=388

 Score =   349 bits (895),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SV+ELKERH AA +TVNSLRERLK+KR  LLD DVA Y+RSQG+ P+SFGPTDLVCCR L
Sbjct  4    SVSELKERHAAAIETVNSLRERLKQKRQQLLDVDVAGYSRSQGRAPVSFGPTDLVCCRTL  63

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH GKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS
Sbjct  64   QGHAGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  123

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED HLITSSGD+TC
Sbjct  124  VACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSSGDQTC  183

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  184  VLWDITTGLRTSVFGGEFQSGHTADV  209



>gb|AAD33959.1|AF145976_1 G protein beta subunit [Pisum sativum]
Length=377

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVA++KERH+AAT+TVN+LRERL   RL LLDTD+A YARSQG+ P++FGPTD++CCR 
Sbjct  1    MSVADVKERHIAATETVNNLRERLSRDRLSLLDTDIAGYARSQGRAPVTFGPTDILCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPLDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVF GE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFLGEFQSGHTADV  207



>gb|KDO49093.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis]
Length=389

 Score =   348 bits (894),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SV+ELKERH AA +TVNSLRERLK+KR  LLD DVA Y+RSQG+ P+SFGPTDLVCCR L
Sbjct  4    SVSELKERHAAAIETVNSLRERLKQKRQQLLDVDVAGYSRSQGRAPVSFGPTDLVCCRTL  63

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH GKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS
Sbjct  64   QGHAGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  123

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED HLITSSGD+TC
Sbjct  124  VACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSSGDQTC  183

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  184  VLWDITTGLRTSVFGGEFQSGHTADV  209



>ref|XP_010263694.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X1 [Nelumbo nucifera]
Length=376

 Score =   347 bits (891),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELK+RH+AAT TVN+LRE+LK+KR+LLLDTDVA YARSQG+TP+SFGPTDLVCCR 
Sbjct  1    MSVAELKKRHIAATATVNALREQLKQKRILLLDTDVAGYARSQGRTPVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWN+LTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNSLTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  121  SVACGGLDSICSIFNLNSPNDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TT  R SVFGGE+ SGHTADV
Sbjct  181  CILWDVTTAQRLSVFGGEFPSGHTADV  207



>ref|XP_011092783.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Sesamum indicum]
Length=379

 Score =   346 bits (887),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 193/208 (93%), Gaps = 1/208 (0%)
 Frame = +1

Query  16   MSV-AELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCR  192
            MSV AELKERH AAT+T+N L+++LK+KRLLLLDTDVA YARSQGKTP++FGPTDLVCCR
Sbjct  1    MSVLAELKERHTAATETLNGLKDKLKQKRLLLLDTDVAGYARSQGKTPVTFGPTDLVCCR  60

Query  193  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  372
             LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP G
Sbjct  61   TLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPGG  120

Query  373  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
            QSVACGGLDSVCSIFNLN P + DGN  VSR L+GHKGYVS+CQYVP+E+ HLIT+SGD+
Sbjct  121  QSVACGGLDSVCSIFNLNSPNNKDGNLPVSRMLTGHKGYVSSCQYVPDEETHLITASGDQ  180

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWDITTGLRTSVFGGE+QSGHT DV
Sbjct  181  TCVLWDITTGLRTSVFGGEFQSGHTGDV  208



>ref|XP_010530843.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Tarenaya hassleriana]
Length=377

 Score =   345 bits (885),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELK+RH AAT+TVN+LRERL++KRL LLDTDVA Y+ +QG+TP++FGPTDLVCCR 
Sbjct  1    MSVSELKDRHAAATETVNNLRERLRQKRLQLLDTDVAGYSAAQGRTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS TGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSSTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN   D DGN  VSR LSGH+GYVS CQY+PNED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSTTDKDGNLPVSRMLSGHRGYVSCCQYIPNEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLKTSVFGGEFQSGHTADV  207



>ref|XP_003541055.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1-like 
[Glycine max]
 gb|KHN25368.1| Guanine nucleotide-binding protein subunit beta-2 [Glycine soja]
Length=377

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH AAT TVN+LR RLK+KRL LLDTDV+ YARSQG+TP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHSAATDTVNNLRHRLKQKRLSLLDTDVSGYARSQGRTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGL+TS+FGGE+QSGHTADV
Sbjct  181  CVLWDITTGLKTSIFGGEFQSGHTADV  207



>ref|XP_003537878.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Glycine max]
 gb|KHN39779.1| Guanine nucleotide-binding protein subunit beta-2 [Glycine soja]
Length=377

 Score =   343 bits (881),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH AAT TVN+LR RLK+KRL LLDTD++ YARSQG+TP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHSAATDTVNNLRHRLKQKRLSLLDTDISGYARSQGRTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLKTSVFGGEFQSGHTADV  207



>ref|XP_010254874.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X1 [Nelumbo nucifera]
Length=387

 Score =   344 bits (882),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 190/215 (88%), Gaps = 8/215 (4%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTD--------VATYARSQGKTPISFGP  171
            MSVAELKERH+AAT TVN+LRERLK+KR LLLDTD         A YARSQG+TP+SFGP
Sbjct  1    MSVAELKERHIAATATVNALRERLKQKRTLLLDTDGSSSCYSHFAGYARSQGRTPVSFGP  60

Query  172  TDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT  351
            TDLVCCR LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT
Sbjct  61   TDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT  120

Query  352  CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL  531
            CAFSP GQSVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HL
Sbjct  121  CAFSPNGQSVACGGLDSVCSIFNLNSPVDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHL  180

Query  532  ITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            ITSSGD+TC LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  ITSSGDQTCVLWDVTTGQRLSVFGGEFPSGHTADV  215



>gb|AFK33707.1| unknown [Lotus japonicus]
Length=377

 Score =   342 bits (877),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH+ A +TVN+LRERLK+KRL LLDTD++ YA+SQG+ P++FGPTD++CCR 
Sbjct  1    MSVTELKERHLTAAETVNNLRERLKQKRLSLLDTDISGYAKSQGRAPVTFGPTDILCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVY+LDWT EKNRIVS SQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYALDWTSEKNRIVSTSQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN   D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSSTDRDGNLNVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHTADV  207



>ref|XP_006856030.1| hypothetical protein AMTR_s00059p00065870 [Amborella trichopoda]
 gb|ERN17497.1| hypothetical protein AMTR_s00059p00065870 [Amborella trichopoda]
Length=377

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKE+H+AAT TVNSLRERLK+KRL LLDTDVA YA+S GKTP+SFGPTDLVCCR 
Sbjct  1    MSVAELKEKHLAATATVNSLRERLKQKRLQLLDTDVAGYAKSIGKTPVSFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTG+VYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGRVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  VSR LSGHKGYVS CQYVP+ D HLITSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSQTDKDGNLPVSRILSGHKGYVSCCQYVPDGDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  CILWDVTTGQRLSVFGGEFPSGHTADV  207



>ref|XP_007131843.1| hypothetical protein PHAVU_011G045900g [Phaseolus vulgaris]
 gb|ESW03837.1| hypothetical protein PHAVU_011G045900g [Phaseolus vulgaris]
Length=377

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELK+RH AA  TVN+LR RLK+KRL LLDTD+  YARSQG+TP++FGPTDLVCCR 
Sbjct  1    MSVAELKDRHSAAIDTVNNLRHRLKQKRLSLLDTDICEYARSQGRTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+LN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFHLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLKTSVFGGEFQSGHTADV  207



>gb|AGZ15391.1| G protein beta subunit [Phaseolus vulgaris]
Length=377

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELK+RH AA  TVN+LR RLK+KRL LLDTD+  YARSQG+TP++FGPTDLVCCR 
Sbjct  1    MSVAELKDRHSAAIDTVNNLRHRLKQKRLSLLDTDICEYARSQGRTPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+LN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT SGD+T
Sbjct  121  SVACGGLDSVCSIFHLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLKTSVFGGEFQSGHTADV  207



>ref|XP_008447036.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Cucumis melo]
Length=377

 Score =   338 bits (867),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MS +ELKERH+AA +TVNSL+ERLK+KR  LLDT+VA YARS G+TPISFG TDLVCCR 
Sbjct  1    MSGSELKERHVAAIETVNSLKERLKQKRHSLLDTNVAGYARSLGRTPISFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPC WVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCPWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVA GGLDSVCSIFNLN P D DGN  V+RTLSGHKGY+S+CQYVP+ED HLIT SGD+T
Sbjct  121  SVAGGGLDSVCSIFNLNSPTDRDGNLPVTRTLSGHKGYISSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGH ADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHAADV  207



>ref|XP_004160234.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Cucumis sativus]
Length=330

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MS +ELKERH+AA +TVNSL+ERLK+KR  LLDT+VA YAR+ G+TP+SFG TDLVCCR 
Sbjct  1    MSGSELKERHVAAIETVNSLKERLKQKRHSLLDTNVAGYARTLGRTPVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPC WVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCPWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVA GGLDSVCSIFNLN P D DGN  V+RTL GHKGY+S+CQYVP+ED HLIT SGD+T
Sbjct  121  SVAGGGLDSVCSIFNLNSPTDRDGNLPVTRTLCGHKGYISSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGH ADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHAADV  207



>gb|KJB79197.1| hypothetical protein B456_013G037500 [Gossypium raimondii]
Length=331

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH AA + VN LRERLK++R  LLD DVA YARS G++ ++FGPTDLVCCR 
Sbjct  1    MSVAELKERHAAAIEAVNDLRERLKQRRQQLLDADVAGYARSLGRSQVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE++RIVSASQDGRLIVWNA TSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERDRIVSASQDGRLIVWNAQTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLD +CSIFNLN   D DGN  VS TL+GHKGYVS CQYVP+ED H+ITSSGD+T
Sbjct  121  SVACGGLDGMCSIFNLNSATDRDGNLPVSVTLNGHKGYVSCCQYVPDEDIHIITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADVSR  642
            C LWDITTGLRT+VFGGE+QSGHTADV R
Sbjct  181  CVLWDITTGLRTTVFGGEFQSGHTADVLR  209



>ref|XP_010432411.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Camelina 
sativa]
 ref|XP_010447077.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Camelina 
sativa]
Length=377

 Score =   336 bits (861),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV++LKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG+TP+SFG TDLVCCR 
Sbjct  1    MSVSDLKERHAVATETVNNLRDRLRQRRLQLLDTDVARYSAAQGRTPVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+L+   D DG   VSR LSGHKGYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CILWDVTTGLKTSVFGGEFQSGHTADV  207



>gb|KHG07839.1| Guanine nucleotide-binding subunit beta-2 [Gossypium arboreum]
Length=377

 Score =   335 bits (859),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            M VAELKERH AA + VN LRERLK++R  LLDTDVA YARS G++ ++FGPTDLVCCR 
Sbjct  1    MPVAELKERHAAAIEAVNDLRERLKQRRQQLLDTDVAGYARSHGRSQVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE++RIVSASQDGRLIVWNA TSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERDRIVSASQDGRLIVWNAQTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS+CSIFNLN   D DGN  VS TL+GHKGYVS CQYVP+ED H+ITSSGD+T
Sbjct  121  SVACGGLDSMCSIFNLNSATDRDGNLPVSVTLNGHKGYVSCCQYVPDEDIHIITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRT+VFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTTVFGGEFQSGHTADV  207



>ref|XP_010526922.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Tarenaya hassleriana]
Length=292

 Score =   332 bits (851),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELK+RH AA +TV++LRERL++KRL LLDTDV  Y+  Q +TP+SF PTDLVCCR 
Sbjct  1    MSVAELKDRHAAALETVSNLRERLRQKRLHLLDTDVVGYSTVQKRTPVSFEPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+N IVSASQDGRL+VWNALTSQKTHAIKLPCAWVM CAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNWIVSASQDGRLVVWNALTSQKTHAIKLPCAWVMACAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN   D DGN  VSR LSGHKGYVS CQY+PNED HLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFNLNSTTDKDGNIPVSRMLSGHKGYVSCCQYIPNEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGL+TSVFGGE+QSGH+ADV
Sbjct  181  CVLWDITTGLKTSVFGGEFQSGHSADV  207



>ref|XP_004150413.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Cucumis sativus]
 gb|KGN44348.1| hypothetical protein Csa_7G267960 [Cucumis sativus]
Length=377

 Score =   334 bits (856),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MS +ELKERH+AA +TVNSL+ERLK+KR  LLDT+VA YAR+ G+TP+SFG TDLVCCR 
Sbjct  1    MSGSELKERHVAAIETVNSLKERLKQKRHSLLDTNVAGYARTLGRTPVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPC WVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCPWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVA GGLDSVCSIFNLN P D DGN  V+RTL GHKGY+S+CQYVP+ED HLIT SGD+T
Sbjct  121  SVAGGGLDSVCSIFNLNSPTDRDGNLPVTRTLCGHKGYISSCQYVPDEDTHLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGH ADV
Sbjct  181  CVLWDITTGLRTSVFGGEFQSGHAADV  207



>gb|AIS73131.1| heterotrimeric G protein beta subunit 2 [Brassica nigra]
Length=378

 Score =   333 bits (854),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LRERL+++R+ LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRERLRQRRIQLLDTDVAKYSVAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>gb|KJB79195.1| hypothetical protein B456_013G037500 [Gossypium raimondii]
Length=377

 Score =   333 bits (854),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH AA + VN LRERLK++R  LLD DVA YARS G++ ++FGPTDLVCCR 
Sbjct  1    MSVAELKERHAAAIEAVNDLRERLKQRRQQLLDADVAGYARSLGRSQVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE++RIVSASQDGRLIVWNA TSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERDRIVSASQDGRLIVWNAQTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLD +CSIFNLN   D DGN  VS TL+GHKGYVS CQYVP+ED H+ITSSGD+T
Sbjct  121  SVACGGLDGMCSIFNLNSATDRDGNLPVSVTLNGHKGYVSCCQYVPDEDIHIITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRT+VFGGE+QSGHTADV
Sbjct  181  CVLWDITTGLRTTVFGGEFQSGHTADV  207



>ref|XP_010437612.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Camelina sativa]
Length=377

 Score =   333 bits (853),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV++LKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG+TP+SFG TDLVCCR 
Sbjct  1    MSVSDLKERHAVATETVNNLRDRLRQRRLQLLDTDVARYSAAQGRTPVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+L+   D DG   VSR LSGHKGYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CILWDVTTGLKTSVFGGEFQSGHTADV  207



>ref|XP_006412223.1| hypothetical protein EUTSA_v10025475mg [Eutrema salsugineum]
 gb|ESQ53676.1| hypothetical protein EUTSA_v10025475mg [Eutrema salsugineum]
Length=377

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT TVN+LR+RL+++RL LLDTDVA Y+ +QG+TP+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDRLRQRRLQLLDTDVAKYSVAQGRTPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>ref|NP_974683.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
 gb|AEE86380.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
Length=347

 Score =   331 bits (848),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CILWDVTTGLKTSVFGGEFQSGHTADV  207



>gb|ACX43274.1| GTP binding protein beta subunit [Brassica napus]
Length=377

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPNEDAHLITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>dbj|BAJ34135.1| unnamed protein product [Thellungiella halophila]
Length=377

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT TVN+LR+RL+++RL LLDTDVA Y+ +QG+TP+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDRLRQRRLQLLDTDVAKYSVAQGRTPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>gb|KFK30072.1| hypothetical protein AALP_AA7G213100 [Arabis alpina]
Length=379

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            +SV+ELKERH  AT+TVN+LR+RL+++RL LLDTDV+ Y+ +QG++P+SFG TDLVCCR 
Sbjct  3    VSVSELKERHAIATETVNNLRDRLRQRRLQLLDTDVSNYSVAQGRSPVSFGATDLVCCRT  62

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  63   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  122

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+L    D DG   VSR LSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  123  SVACGGLDSVCSIFSLTSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSSGDQT  182

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  183  CVLWDVTTGLKTSVFGGEFQSGHTADV  209



>ref|XP_002867119.1| hypothetical protein ARALYDRAFT_491213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43378.1| hypothetical protein ARALYDRAFT_491213 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CILWDVTTGLKTSVFGGEFQSGHTADV  207



>ref|NP_195172.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
 sp|P49177.1|GBB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta; 
AltName: Full=AGB1; AltName: Full=transducin [Arabidopsis 
thaliana]
 gb|AAA50445.1| GTP binding protein beta subunit [Arabidopsis thaliana]
 emb|CAA18825.1| GTP binding protein beta subunit [Arabidopsis thaliana]
 emb|CAB80163.1| GTP binding protein beta subunit [Arabidopsis thaliana]
 gb|AEE86381.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
Length=377

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CILWDVTTGLKTSVFGGEFQSGHTADV  207



>gb|AAV85721.1| At4g34460 [Arabidopsis thaliana]
Length=375

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CILWDVTTGLKTSVFGGEFQSGHTADV  207



>emb|CDX69061.1| BnaC01g03920D [Brassica napus]
Length=377

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH AAT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAAATETVNNLRDRLRQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDA LITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDARLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>ref|XP_006283934.1| hypothetical protein CARUB_v10005053mg [Capsella rubella]
 gb|EOA16832.1| hypothetical protein CARUB_v10005053mg [Capsella rubella]
Length=377

 Score =   330 bits (846),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT TVN+LR+RL+++RL LLDTDVA+Y+ +QG+TP+SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDRLRQRRLQLLDTDVASYSAAQGRTPVSFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
             VACGGLDSVCSIF+L    D DG   VS+ L+GHKGYVS CQYVPNED HLITSSGD+T
Sbjct  121  LVACGGLDSVCSIFSLTSTADKDGTVPVSKMLTGHKGYVSCCQYVPNEDTHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CILWDVTTGLKTSVFGGEFQSGHTADV  207



>gb|AIO11833.1| heterotrimeric G-protein beta subunit 3 [Brassica rapa]
Length=377

 Score =   329 bits (844),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLQQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDA LITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDARLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>ref|XP_009112299.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Brassica 
rapa]
Length=377

 Score =   329 bits (844),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLQQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDA LITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDARLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>emb|CDX75436.1| BnaA01g02660D [Brassica napus]
Length=377

 Score =   329 bits (844),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDA LITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDARLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>gb|AIO11831.1| heterotrimeric G-protein beta subunit 1 [Brassica rapa]
Length=378

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDV+ Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVSKYSAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSRTLSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRTLSGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHT DV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTGDV  207



>gb|AIS73130.1| heterotrimeric G protein beta subunit 1 [Brassica nigra]
Length=378

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVAKYSVAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPN DAHLITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNGDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTADV  207



>ref|XP_009138296.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Brassica rapa]
Length=378

 Score =   328 bits (842),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDV+ Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVSKYSAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSRTLSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRTLSGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHT DV
Sbjct  181  CVLWDVTTGLKTSVFGGEFQSGHTGDV  207



>gb|AIS73132.1| heterotrimeric G protein beta subunit 3 [Brassica nigra]
Length=377

 Score =   327 bits (839),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVAKYSVAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LW +TTGL+TSVFGGE+QSGHTADV
Sbjct  181  CVLWGVTTGLKTSVFGGEFQSGHTADV  207



>ref|XP_009108730.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Brassica rapa]
Length=378

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 185/208 (89%), Gaps = 1/208 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL ++RL LLDTDVA Y  +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLIQRRLQLLDTDVAKYTAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKV+SLDWTPE NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVHSLDWTPESNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGG-LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
            +VACGG L+SVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPNEDAHLITSSGD+
Sbjct  121  TVACGGLLESVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNEDAHLITSSGDQ  180

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  TCVLWDVTTGLKTSVFGGEFQSGHTADV  208



>ref|XP_008783473.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Phoenix 
dactylifera]
Length=383

 Score =   325 bits (833),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            M VAELKERHMAAT TVN LRERLK++R  LLDTDVA YA+S GKT ISFG TDLVCCR 
Sbjct  1    MYVAELKERHMAATATVNGLRERLKQRRQALLDTDVAGYAKSHGKTAISFGSTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  Q
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLYCAWVMTCAFAPNSQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  L+TSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPVSRILTGHKGYVSSCQYVPDQETRLLTSSGDRT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  CVLWDVTTGQRISVFGGEFPSGHTADV  207



>ref|XP_010942027.1| PREDICTED: guanine nucleotide-binding protein subunit beta isoform 
X3 [Elaeis guineensis]
Length=371

 Score =   323 bits (828),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AAT  VN+LRERLK++R  LLDTDVA YA+S GKT I FG TDLVCCR 
Sbjct  1    MSVAELKERHIAATANVNALRERLKQRRQELLDTDVAGYAKSHGKTAIGFGSTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  +SR L+GHKGYVS+CQ+VP+++  LIT SGD+T
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPISRVLTGHKGYVSSCQFVPDQETRLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  CVLWDVTTGQRISVFGGEFPSGHTADV  207



>ref|XP_009406753.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406754.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Musa 
acuminata subsp. malaccensis]
Length=379

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AAT TVNSLRERLK++R LLLDTDVA +A+SQG++ ISF  TDL+CCR 
Sbjct  1    MSVAELKERHIAATATVNSLRERLKQRRQLLLDTDVAAFAKSQGRSAISFNSTDLICCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLQCPWVMTCAFAPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  VSR L+GHKGYV +CQYVP+++  LITSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPVSRILTGHKGYVYSCQYVPDQETRLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  CVLWDVTTGQRISVFGGEFPSGHTADV  207



>ref|XP_010942026.1| PREDICTED: guanine nucleotide-binding protein subunit beta isoform 
X2 [Elaeis guineensis]
Length=379

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AAT  VN+LRERLK++R  LLDTDVA YA+S GKT I FG TDLVCCR 
Sbjct  1    MSVAELKERHIAATANVNALRERLKQRRQELLDTDVAGYAKSHGKTAIGFGSTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  +SR L+GHKGYVS+CQ+VP+++  LIT SGD+T
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPISRVLTGHKGYVSSCQFVPDQETRLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  CVLWDVTTGQRISVFGGEFPSGHTADV  207



>emb|CDX72483.1| BnaC07g45050D [Brassica napus]
Length=885

 Score =   337 bits (864),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVNSLR++L+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  508  MSVSELKERHAVATETVNSLRDKLRQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  567

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  568  LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  627

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSRTLSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  628  TVACGGLDSVCSIFSLSSTADKDGTVPVSRTLSGHRGYVSCCQYVPNEDAHLITSSGDQT  687

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHT DV
Sbjct  688  CVLWDVTTGLKTSVFGGEFQSGHTGDV  714



>ref|XP_010942025.1| PREDICTED: guanine nucleotide-binding protein subunit beta isoform 
X1 [Elaeis guineensis]
Length=392

 Score =   323 bits (827),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AAT  VN+LRERLK++R  LLDTDVA YA+S GKT I FG TDLVCCR 
Sbjct  1    MSVAELKERHIAATANVNALRERLKQRRQELLDTDVAGYAKSHGKTAIGFGSTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  +SR L+GHKGYVS+CQ+VP+++  LIT SGD+T
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPISRVLTGHKGYVSSCQFVPDQETRLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  CVLWDVTTGQRISVFGGEFPSGHTADV  207



>gb|AIO11832.1| heterotrimeric G-protein beta subunit 2 [Brassica rapa]
Length=378

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT TVN+LR++L ++RL LLDTDVA Y   QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDKLIQRRLQLLDTDVAKYTAGQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKV+SLDWTPE NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVHSLDWTPESNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  376  SVACGG-LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
            +VACGG L+SVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPNEDAHLIT SGD+
Sbjct  121  TVACGGLLESVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNEDAHLITGSGDQ  180

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  181  TCVLWDVTTGLKTSVFGGEFQSGHTADV  208



>ref|NP_001078491.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
 gb|AEE86382.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
Length=372

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 5/207 (2%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTD A     QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDAA-----QGRTRVSFGATDLVCCRT  55

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  56   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  115

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  116  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQT  175

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  176  CILWDVTTGLKTSVFGGEFQSGHTADV  202



>ref|XP_004982214.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Setaria italica]
Length=427

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDVA Y+++QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRREMLLDTDVARYSKAQGRTPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP++++ LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQESRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>ref|XP_004982216.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X3 [Setaria italica]
Length=380

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDVA Y+++QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRREMLLDTDVARYSKAQGRTPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP++++ LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQESRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>gb|ACF86117.1| unknown [Zea mays]
Length=380

 Score =   320 bits (819),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDVA Y++SQG+ P+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRETLLDTDVARYSKSQGRVPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMACAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADVSR  642
             LWD+TTG R S+FGGE+ SGHTADV R
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADVQR  210



>ref|XP_009416786.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=379

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AAT TVNSLRERLK+++ LL+DTD+A Y RSQG++ ISFG TDLVCCR 
Sbjct  1    MSVAELKERHIAATATVNSLRERLKQRQQLLVDTDMAAYGRSQGRSAISFGSTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL C WV+TCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLQCPWVVTCAFAPNGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGL+S CSIFNLN   D DGN  VS+ L+GHKGYV +CQYVP+++  LITSSGD+T
Sbjct  121  SVACGGLNSACSIFNLNSQVDRDGNIPVSQILTGHKGYVYSCQYVPDQETRLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  CILWDVTTGQRISVFGGEFPSGHTADV  207



>ref|XP_004982215.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X2 [Setaria italica]
Length=396

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDVA Y+++QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRREMLLDTDVARYSKAQGRTPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP++++ LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQESRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>ref|XP_002466691.1| hypothetical protein SORBIDRAFT_01g012370 [Sorghum bicolor]
 gb|EER93689.1| hypothetical protein SORBIDRAFT_01g012370 [Sorghum bicolor]
Length=380

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDVA Y++SQG+ P+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRETLLDTDVARYSKSQGRLPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>gb|EEC75892.1| hypothetical protein OsI_12941 [Oryza sativa Indica Group]
Length=380

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDV  Y+R+QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>sp|Q40687.1|GBB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Oryza sativa Japonica Group]
 emb|CAA61889.1| g protein B subunit [Oryza sativa Japonica Group]
 gb|AAP44640.1| guanine nucleotide-binding protein beta subunit [Oryza sativa 
Japonica Group]
 gb|ABF98102.1| Guanine nucleotide-binding protein beta subunit, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAH01349.1| unnamed protein product [Oryza sativa Japonica Group]
Length=380

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDV  Y+R+QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>gb|AEE69019.1| heterotrimeric G protein beta subunit [Oryza sativa Japonica 
Group]
Length=378

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDV  Y+R+QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>ref|NP_001105365.1| guanine nucleotide-binding protein subunit beta [Zea mays]
 sp|P49178.1|GBB_MAIZE RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Zea mays]
 gb|AAA50446.1| GTP binding protein beta subunit [Zea mays]
 tpg|DAA50558.1| TPA: guanine nucleotide-binding protein subunit beta [Zea mays]
Length=380

 Score =   317 bits (813),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDVA Y++SQG+ P+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRETLLDTDVARYSKSQGRVPVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMACAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>emb|CDY45313.1| BnaA03g52860D [Brassica napus]
Length=892

 Score =   332 bits (850),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDV+ Y+ +QG++P+ FG TDLVCCR 
Sbjct  515  MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVSKYSAAQGRSPVKFGATDLVCCRT  574

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  575  LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  634

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF+L+   D DG   VSRTLSGH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct  635  TVACGGLDSVCSIFSLSSTADKDGTVPVSRTLSGHRGYVSCCQYVPNEDAHLITSSGDQT  694

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTGL+TSVFGGE+QSGHT DV
Sbjct  695  CVLWDVTTGLKTSVFGGEFQSGHTGDV  721



>gb|ABR17717.1| unknown [Picea sitchensis]
Length=377

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAEL+ERH+AAT  VN+LRER+K+KR  LLDTDVATYA + G+TPISF  TDLVCCR 
Sbjct  1    MSVAELRERHVAATAKVNALRERIKDKRRQLLDTDVATYASNNGRTPISFSFTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF LN   D DG+   SR LSGH+GYVS+CQYVP+ D H+IT SGD+T
Sbjct  121  AVACGGLDSVCSIFQLNSQIDRDGHLPASRILSGHRGYVSSCQYVPDGDTHVITGSGDRT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C  WD+TTG R ++FGGE+  GHTADV
Sbjct  181  CVQWDVTTGQRIAIFGGEFPLGHTADV  207



>gb|ADL27745.1| G protein beta subunit [Oryza sativa Indica Group]
Length=380

 Score =   315 bits (807),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDV  Y+R+QG+TP+SF PTDLVCCR  
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTP  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>ref|XP_009381288.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   315 bits (806),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MS +ELK+RH+AAT TVN+LR+RL +KR  LLDTDVA YA+SQG+T ++F  TDLVCCR 
Sbjct  1    MSFSELKDRHVAATATVNTLRDRLNQKRQQLLDTDVAGYAKSQGRTAVNFSSTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLI+WNALTSQKTHAIKLPCAWVMTCAF+P G 
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIIWNALTSQKTHAIKLPCAWVMTCAFAPNGH  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+C++V ++D  LIT SGD+T
Sbjct  121  SVACGGLDSECSIFNLNSQVDRDGNIPVSRVLTGHKGYVSSCEFVRDQDTRLITGSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWD+TTG R SVFGGE+ SGHT+DV
Sbjct  181  CVLWDVTTGQRISVFGGEFPSGHTSDV  207



>ref|XP_010935069.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X3 [Elaeis guineensis]
Length=383

 Score =   315 bits (806),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA  TVN LRERLK++R  LLDTDV  YA+S GKT IS G TDLVCCR 
Sbjct  1    MSVAELKERHIAAKATVNGLRERLKQRRQALLDTDVVGYAKSHGKTAISLGSTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            +QGHTGKVYSLDW PE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  Q
Sbjct  61   MQGHTGKVYSLDWAPERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPYSQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDS CSIFNLN   D DGN  +SR L+GHKGYVS+CQYVP++++ LITSSGD+T
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPISRILTGHKGYVSSCQYVPDQESRLITSSGDQT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTAD  633
            C LWD++TG R SVFGGE+ SGHTAD
Sbjct  181  CVLWDVSTGQRISVFGGEFPSGHTAD  206



>gb|AHJ60245.1| heterotrimeric G-protein beta subunit [Picea abies]
Length=377

 Score =   314 bits (804),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAEL+ERH+ AT  VN+LRER+K+KR  LLDTDVATYA + G+TPISF  TDLVCCR 
Sbjct  1    MSVAELRERHVVATAKVNALRERIKDKRRQLLDTDVATYASNNGRTPISFSFTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            +VACGGLDSVCSIF LN   D DG+   SR LSGH+GYVS+CQYVP+ D H+IT SGD+T
Sbjct  121  AVACGGLDSVCSIFQLNSQIDRDGHLPASRILSGHRGYVSSCQYVPDGDTHVITGSGDRT  180

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C  WD+TTG R ++FGGE+  GHTADV
Sbjct  181  CVQWDVTTGQRIAIFGGEFPLGHTADV  207



>ref|XP_009416784.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416785.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=385

 Score =   313 bits (802),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 182/213 (85%), Gaps = 6/213 (3%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AAT TVNSLRERLK+++ LL+DTD+A Y RSQG++ ISFG TDLVCCR 
Sbjct  1    MSVAELKERHIAATATVNSLRERLKQRQQLLVDTDMAAYGRSQGRSAISFGSTDLVCCRT  60

Query  196  LQGHTGK------VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCA  357
            LQGHTGK      VYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL C WV+TCA
Sbjct  61   LQGHTGKFQDICQVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLQCPWVVTCA  120

Query  358  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT  537
            F+P GQSVACGGL+S CSIFNLN   D DGN  VS+ L+GHKGYV +CQYVP+++  LIT
Sbjct  121  FAPNGQSVACGGLNSACSIFNLNSQVDRDGNIPVSQILTGHKGYVYSCQYVPDQETRLIT  180

Query  538  SSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            SSGD+TC LWD+TTG R SVFGGE+ SGHTADV
Sbjct  181  SSGDQTCILWDVTTGQRISVFGGEFPSGHTADV  213



>gb|EMT27863.1| hypothetical protein F775_27280 [Aegilops tauschii]
Length=364

 Score =   312 bits (799),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDV  Y+++QG+T +SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQTLLDTDVEKYSKAQGRTAVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNL+   D DGN  VSR L+GHKGYVS+CQYVP+++  LIT SGD+TC
Sbjct  123  VACGGLDSACSIFNLSSQADRDGNMPVSRVLTGHKGYVSSCQYVPDQETRLITGSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>ref|XP_003561442.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Brachypodium 
distachyon]
Length=380

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVA+LKE+H AAT +VNSLRERL+++R LLLDTDV  Y+++QG+T +SF  TDLVCCR L
Sbjct  3    SVADLKEKHAAATASVNSLRERLRQRRQLLLDTDVERYSKAQGRTAVSFNQTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LIT SGD+TC
Sbjct  123  VACGGLDSACSIFNLNSQVDRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITGSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>pdb|3J60|GG Chain g, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC10503.1| G protein beta subunit [Triticum aestivum]
Length=380

 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDV  Y+++QG+T +SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQTLLDTDVEKYSKAQGRTAVSFNPTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMECAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGLDS CSIFNL+   D DGN  VSR L+GHKGY S+CQYVP+++  LIT SGD+TC
Sbjct  123  VACGGLDSACSIFNLSSQADRDGNMPVSRVLTGHKGYASSCQYVPDQETRLITGSGDQTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FG E+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGSEFPSGHTADV  208



>ref|XP_010526923.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X2 [Tarenaya hassleriana]
Length=250

 Score =   299 bits (765),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  148  KTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIK  327
            +TP+SF PTDLVCCR LQGHTGKVYSLDWTPE+N IVSASQDGRL+VWNALTSQKTHAIK
Sbjct  3    RTPVSFEPTDLVCCRTLQGHTGKVYSLDWTPERNWIVSASQDGRLVVWNALTSQKTHAIK  62

Query  328  LPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQY  507
            LPCAWVM CAFSPTGQSVACGGLDSVCSIFNLN   D DGN  VSR LSGHKGYVS CQY
Sbjct  63   LPCAWVMACAFSPTGQSVACGGLDSVCSIFNLNSTTDKDGNIPVSRMLSGHKGYVSCCQY  122

Query  508  VPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            +PNED HLITSSGD+TC LWDITTGL+TSVFGGE+QSGH+ADV
Sbjct  123  IPNEDTHLITSSGDQTCVLWDITTGLKTSVFGGEFQSGHSADV  165



>emb|CAN73515.1| hypothetical protein VITISV_027042 [Vitis vinifera]
Length=366

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 177/207 (86%), Gaps = 11/207 (5%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERHMAAT+TVNSLRERLK+KRLLLLDTDVA YAR+QGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATETVNSLRERLKQKRLLLLDTDVAGYARAQGKSPVTFGPTDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNAL   +            +C  +  GQ
Sbjct  61   LQGHTGKVYSLDWTTEKNRIVSASQDGRLIVWNALNKPEN-----------SCHKAAFGQ  109

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT  555
            SVACGGLDSVCSIFNLN P D DGN  +S+ LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct  110  SVACGGLDSVCSIFNLNSPTDKDGNLAISKMLSGHKGYVSSCQYVPDEDTHLITSSGDQT  169

Query  556  CGLWDITTGLRTSVFGGEYQSGHTADV  636
            C LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  170  CVLWDITTGLRTSVFGGEFQSGHTADV  196



>gb|AFK40354.1| unknown [Medicago truncatula]
Length=177

 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV ELKERH+AAT+TVN+LRERLK++RL LLDTD+A YA+SQG+TP++FGPTD++CCR 
Sbjct  1    MSVTELKERHIAATETVNNLRERLKQRRLSLLDTDIAGYAKSQGRTPVTFGPTDILCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGK+YSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKIYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT  537
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLIT  174



>gb|EEE63415.1| hypothetical protein OsJ_18227 [Oryza sativa Japonica Group]
Length=350

 Score =   296 bits (757),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = +1

Query  112  DTDVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW  291
            DTDV  Y+R+QG+TP+SF PTDLVCCR LQGH+GKVYSLDWTPEKN IVSASQDGRLIVW
Sbjct  4    DTDVERYSRTQGRTPVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVW  63

Query  292  NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL  471
            NALTSQKTHAIKL C WVMTCAF+P GQSVACGGLDS CSIFNLN   D DGN  VSR L
Sbjct  64   NALTSQKTHAIKLHCPWVMTCAFAPNGQSVACGGLDSACSIFNLNSQADRDGNIPVSRIL  123

Query  472  SGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            +GHKGYVS+CQYVP+++  LITSSGD+TC LWD+TTG R S+FGGE+ SGHTADV
Sbjct  124  TGHKGYVSSCQYVPDQETRLITSSGDQTCVLWDVTTGQRISIFGGEFPSGHTADV  178



>gb|AAC39373.1| G protein beta subunit [Avena fatua]
Length=380

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  198
            SVAELKERH AAT +VNSLRERL+++R  LLDTDV  Y+++QG+T +SF  TDLVCCR L
Sbjct  3    SVAELKERHAAATASVNSLRERLRQRRQTLLDTDVEKYSKAQGRTAVSFNQTDLVCCRTL  62

Query  199  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  378
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WV+TCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVITCAFAPNGQS  122

Query  379  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            VACGGL+S CSIFNLN   D +GN  VS+ L+G KGYV +CQYVP+++  +IT SGD TC
Sbjct  123  VACGGLNSACSIFNLNSQVDRNGNMPVSKLLTGPKGYVLSCQYVPDQETRMITGSGDPTC  182

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWD+TTG R S+FGGE+ SGHTADV
Sbjct  183  VLWDVTTGQRISIFGGEFPSGHTADV  208



>ref|XP_010935070.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X4 [Elaeis guineensis]
Length=376

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 177/251 (71%), Gaps = 45/251 (18%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA  TVN LRERLK++R  LLDTDV  YA+S GKT IS G TDLVCCR 
Sbjct  1    MSVAELKERHIAAKATVNGLRERLKQRRQALLDTDVVGYAKSHGKTAISLGSTDLVCCRT  60

Query  196  LQGHTGKVY---------------------------------------------SLDWTP  240
            +QGHTGKVY                                             SLDW P
Sbjct  61   MQGHTGKVYVRIAELEKPDVMRKYRGKDVSNDCLSHNAHKKKCVKLSWFAAKVYSLDWAP  120

Query  241  EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFN  420
            E+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  QSVACGGLDS CSIFN
Sbjct  121  ERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPYSQSVACGGLDSACSIFN  180

Query  421  LNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVF  600
            LN   D DGN  +SR L+GHKGYVS+CQYVP++++ LITSSGD+TC LWD++TG R SVF
Sbjct  181  LNSQVDRDGNIPISRILTGHKGYVSSCQYVPDQESRLITSSGDQTCVLWDVSTGQRISVF  240

Query  601  GGEYQSGHTAD  633
            GGE+ SGHTAD
Sbjct  241  GGEFPSGHTAD  251



>ref|XP_010935068.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X2 [Elaeis guineensis]
Length=390

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 177/251 (71%), Gaps = 45/251 (18%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA  TVN LRERLK++R  LLDTDV  YA+S GKT IS G TDLVCCR 
Sbjct  1    MSVAELKERHIAAKATVNGLRERLKQRRQALLDTDVVGYAKSHGKTAISLGSTDLVCCRT  60

Query  196  LQGHTGKVY---------------------------------------------SLDWTP  240
            +QGHTGKVY                                             SLDW P
Sbjct  61   MQGHTGKVYVRIAELEKPDVMRKYRGKDVSNDCLSHNAHKKKCVKLSWFAAKVYSLDWAP  120

Query  241  EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFN  420
            E+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  QSVACGGLDS CSIFN
Sbjct  121  ERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPYSQSVACGGLDSACSIFN  180

Query  421  LNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVF  600
            LN   D DGN  +SR L+GHKGYVS+CQYVP++++ LITSSGD+TC LWD++TG R SVF
Sbjct  181  LNSQVDRDGNIPISRILTGHKGYVSSCQYVPDQESRLITSSGDQTCVLWDVSTGQRISVF  240

Query  601  GGEYQSGHTAD  633
            GGE+ SGHTAD
Sbjct  241  GGEFPSGHTAD  251



>ref|XP_010935067.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Elaeis guineensis]
Length=428

 Score =   293 bits (751),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 177/251 (71%), Gaps = 45/251 (18%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSVAELKERH+AA  TVN LRERLK++R  LLDTDV  YA+S GKT IS G TDLVCCR 
Sbjct  1    MSVAELKERHIAAKATVNGLRERLKQRRQALLDTDVVGYAKSHGKTAISLGSTDLVCCRT  60

Query  196  LQGHTGKVY---------------------------------------------SLDWTP  240
            +QGHTGKVY                                             SLDW P
Sbjct  61   MQGHTGKVYVRIAELEKPDVMRKYRGKDVSNDCLSHNAHKKKCVKLSWFAAKVYSLDWAP  120

Query  241  EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFN  420
            E+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  QSVACGGLDS CSIFN
Sbjct  121  ERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPYSQSVACGGLDSACSIFN  180

Query  421  LNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVF  600
            LN   D DGN  +SR L+GHKGYVS+CQYVP++++ LITSSGD+TC LWD++TG R SVF
Sbjct  181  LNSQVDRDGNIPISRILTGHKGYVSSCQYVPDQESRLITSSGDQTCVLWDVSTGQRISVF  240

Query  601  GGEYQSGHTAD  633
            GGE+ SGHTAD
Sbjct  241  GGEFPSGHTAD  251



>gb|EMS45783.1| Guanine nucleotide-binding protein subunit beta [Triticum urartu]
Length=1344

 Score =   288 bits (736),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = +1

Query  121   VATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL  300
             V  Y+++QG+T +SF PTDLVCCR LQGH+GKVYSLDWTPEKN IVSASQDGRLIVWNAL
Sbjct  1005  VEKYSKAQGRTAVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNAL  1064

Query  301   TSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGH  480
             TSQKTHAIKL C WVMTCAF+P GQSVACGGLDS CSIFNL+   D DGN  VSR L+GH
Sbjct  1065  TSQKTHAIKLHCPWVMTCAFAPNGQSVACGGLDSACSIFNLSSQADRDGNMPVSRVLTGH  1124

Query  481   KGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             KGYVS+CQYVP+++  LIT SGD+TC LWD+TTG R S+FGGE+ SGHTADV
Sbjct  1125  KGYVSSCQYVPDQETRLITGSGDQTCVLWDVTTGQRISIFGGEFPSGHTADV  1176



>ref|XP_009779362.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
isoform X2 [Nicotiana sylvestris]
Length=337

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +1

Query  217  VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGL  396
            VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP G SVACGGL
Sbjct  28   VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPFGHSVACGGL  87

Query  397  DSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDIT  576
            DSVCSIFNLN P D +GN  +SR LSGHKGYVSACQYVP+E+ H+IT SGD+TC LWDIT
Sbjct  88   DSVCSIFNLNSPTDKEGNLPLSRMLSGHKGYVSACQYVPDEEGHMITGSGDQTCILWDIT  147

Query  577  TGLRTSVFGGEYQSGHTADV  636
            TGLRTSVFGGE+QSGH+ADV
Sbjct  148  TGLRTSVFGGEFQSGHSADV  167



>ref|NP_849494.2| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
 gb|AEE86379.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
Length=315

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +1

Query  214  KVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGG  393
            +VYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGG
Sbjct  5    QVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGG  64

Query  394  LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI  573
            LDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSSGD+TC LWD+
Sbjct  65   LDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDV  124

Query  574  TTGLRTSVFGGEYQSGHTADV  636
            TTGL+TSVFGGE+QSGHTADV
Sbjct  125  TTGLKTSVFGGEFQSGHTADV  145



>emb|CDX76284.1| BnaA08g11160D [Brassica napus]
Length=344

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 154/208 (74%), Gaps = 31/208 (15%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH  AT TVN+LR++L ++RL LLDTDVA Y   QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDKLIQRRLQLLDTDVAKYTAGQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKV+SLDWTPE NRIVSASQDGRLI                              
Sbjct  61   LQGHTGKVHSLDWTPESNRIVSASQDGRLI------------------------------  90

Query  376  SVACGGL-DSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
            +VACGGL +SVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPNEDAHLITSSGD+
Sbjct  91   TVACGGLLESVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNEDAHLITSSGDQ  150

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWD+TTGL+TSVFGGE+QSGHTADV
Sbjct  151  TCVLWDVTTGLKTSVFGGEFQSGHTADV  178



>emb|CDY46247.1| BnaC03g66080D [Brassica napus]
Length=348

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 155/208 (75%), Gaps = 31/208 (15%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  195
            MSV+ELKERH AAT+TVN+LR+RL ++RL LLDTDVA Y  +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAAATETVNNLRDRLIQRRLQLLDTDVAKYTAAQGRSPVKFGATDLVCCRT  60

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            LQGHTGKV+SLDWT E NRIVSASQDGRLI                              
Sbjct  61   LQGHTGKVHSLDWTLESNRIVSASQDGRLI------------------------------  90

Query  376  SVACGGL-DSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
            +VACGGL DSVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPN+DAHLITSSGD+
Sbjct  91   TVACGGLLDSVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNDDAHLITSSGDQ  150

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWD+TTGL+ SVFGGE+QSGHTADV
Sbjct  151  TCVLWDVTTGLKISVFGGEFQSGHTADV  178



>ref|XP_001753169.1| GPB1 heterotrimeric G protein beta subunit protein [Physcomitrella 
patens]
 emb|CAD21857.2| putative heterotrimeric G protein beta subunit [Physcomitrella 
patens]
 gb|EDQ82210.1| GPB1 heterotrimeric G protein beta subunit protein [Physcomitrella 
patens]
Length=377

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 152/209 (73%), Gaps = 4/209 (2%)
 Frame = +1

Query  16   MSVAE-LKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCR  192
            MSVA+ ++ER+  +   V SLRE+L EKR  LLDTD   +  +     ISF    +VC R
Sbjct  1    MSVADSVRERYEVSKAEVQSLREQLHEKRASLLDTDGGPFIPADFVVVISF--VFMVCVR  58

Query  193  NLQGHTGKVYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
             LQGHTGK+YSLDW   E +RIVSASQDGRLIVWNA++SQKT+++KL CAWV   A SP 
Sbjct  59   TLQGHTGKIYSLDWAYRETSRIVSASQDGRLIVWNAISSQKTYSLKLACAWVKAAAISPG  118

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G +VACGGLD+VCSIFNL+  PD +GN  VS TL+GH GY+S+C+Y+P ++ H++TSSGD
Sbjct  119  GNTVACGGLDNVCSIFNLSSVPDKEGNLPVSGTLAGHTGYLSSCKYMPTQEKHIVTSSGD  178

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC  WD+ T    +VFGG+  +GHT DV
Sbjct  179  HTCRFWDVETQCCIAVFGGDILTGHTGDV  207



>ref|XP_002967710.1| hypothetical protein SELMODRAFT_440157 [Selaginella moellendorffii]
 gb|EFJ31057.1| hypothetical protein SELMODRAFT_440157 [Selaginella moellendorffii]
Length=375

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 142/208 (68%), Gaps = 4/208 (2%)
 Frame = +1

Query  16   MSVAELKERHMAATQ-TVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCR  192
            M+V  + +R + A Q  V+ LR  L+  R  L DT +A YAR+ G+  I F        R
Sbjct  1    MAVNGVSQRDILAAQDEVDRLRSALQATRRRLQDTTLAEYARAHGRGDIGFAADRFKSRR  60

Query  193  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  372
             L GHTGKVY+LDW+ E++ IVSASQDGRLIVWNA+TSQKTHAIKL C WVM CAFSP G
Sbjct  61   MLSGHTGKVYALDWS-ERDTIVSASQDGRLIVWNAMTSQKTHAIKLLCPWVMACAFSPDG  119

Query  373  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
            ++VACGGLD++ SIF L    D+ GN   S  L+GHKGY+S C+YVP + A ++TSSGD 
Sbjct  120  ETVACGGLDNLVSIFRLR-SFDSTGNHAPSAVLTGHKGYISCCRYVPRK-AQILTSSGDH  177

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWD+      S FG E  SGHT+DV
Sbjct  178  TCILWDVEAQRHISQFGSESSSGHTSDV  205



>ref|XP_002964323.1| hypothetical protein SELMODRAFT_142121 [Selaginella moellendorffii]
 gb|EFJ34656.1| hypothetical protein SELMODRAFT_142121 [Selaginella moellendorffii]
Length=375

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = +1

Query  112  DTDVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW  291
            DT +A YAR+ G+  I F        R L GHTGKVY+LDW+ E++ IVSASQDGRLIVW
Sbjct  34   DTTLAEYARTHGRGDIGFAADRFKSRRMLSGHTGKVYALDWS-ERDTIVSASQDGRLIVW  92

Query  292  NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL  471
            NA+TSQKTHAIKL C WVM CAFSP G++VACGGLD++ SIF L    D+ GN   S  L
Sbjct  93   NAMTSQKTHAIKLLCPWVMACAFSPDGETVACGGLDNLVSIFRLR-SFDSTGNHAPSAVL  151

Query  472  SGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            +GHKGY+S C+YVP + A ++TSSGD TC LWD+      + FG E  SGHT+DV
Sbjct  152  TGHKGYISCCRYVPRK-AQVLTSSGDHTCILWDVEAQRHIAQFGSESSSGHTSDV  205



>gb|KDO49096.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis]
Length=267

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  346  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  525
            MTCAFSPTGQSVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED 
Sbjct  1    MTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDT  60

Query  526  HLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            HLITSSGD+TC LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  61   HLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTADV  97



>gb|KEH36360.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=268

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +1

Query  346  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  525
            MTCAFSPTGQSVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED 
Sbjct  1    MTCAFSPTGQSVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDT  60

Query  526  HLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            HLIT SGD+TC LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  61   HLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTADV  97



>gb|KCW55346.1| hypothetical protein EUGRSUZ_I01264 [Eucalyptus grandis]
Length=267

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +1

Query  346  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  525
            MTCAF+P GQSVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ DA
Sbjct  1    MTCAFAPNGQSVACGGLDSVCSIFNLNSPVDRDGNLPVSRMLSGHKGYVSSCQYVPDGDA  60

Query  526  HLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            HLIT SGD+TC LWDITTGLRTSVFGGE+QSGHTADV
Sbjct  61   HLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTADV  97



>ref|XP_001757493.1| GPB2 heterotrimeric G protein beta subunit protein [Physcomitrella 
patens]
 gb|EDQ77550.1| GPB2 heterotrimeric G protein beta subunit protein [Physcomitrella 
patens]
Length=252

 Score =   166 bits (421),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = +1

Query  217  VYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGG  393
            +YSLDW   E +RIVS SQDGRLIVWNA++SQKTH+ KL CAWVM  A SP+G +VACGG
Sbjct  12   IYSLDWAYRETSRIVSTSQDGRLIVWNAISSQKTHSFKLACAWVMAAAISPSGNTVACGG  71

Query  394  LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI  573
            LD+VCSIFNL+  PD + N  VS TL+GH GY+S C+Y+P ++ H++TSS D TC LWD 
Sbjct  72   LDNVCSIFNLSSAPDKEDNLPVSGTLTGHAGYLSCCKYIPTQEEHIVTSSEDHTCRLWDA  131

Query  574  TTGLR  588
             T  R
Sbjct  132  VTKGR  136



>gb|KJB79196.1| hypothetical protein B456_013G037500 [Gossypium raimondii]
 gb|KJB79198.1| hypothetical protein B456_013G037500 [Gossypium raimondii]
Length=267

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +1

Query  346  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  525
            MTCAFSPTGQSVACGGLD +CSIFNLN   D DGN  VS TL+GHKGYVS CQYVP+ED 
Sbjct  1    MTCAFSPTGQSVACGGLDGMCSIFNLNSATDRDGNLPVSVTLNGHKGYVSCCQYVPDEDI  60

Query  526  HLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            H+ITSSGD+TC LWDITTGLRT+VFGGE+QSGHTADV
Sbjct  61   HIITSSGDQTCVLWDITTGLRTTVFGGEFQSGHTADV  97



>gb|AGH70128.1| guanine nucleotide-binding protein beta 1, partial [Placozoa 
sp. H4]
Length=189

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 109/158 (69%), Gaps = 10/158 (6%)
 Frame = +1

Query  163  FGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW  342
             G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +W
Sbjct  40   IGRIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDSYTTNKIHAIPLRSSW  99

Query  343  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED  522
            VMTCA++P+G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C++V  +D
Sbjct  100  VMTCAYAPSGNFVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFV--DD  154

Query  523  AHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             +++TSSGD TCGLWDI TG +T+ F     +GHT DV
Sbjct  155  TNIVTSSGDMTCGLWDIETGHQTTSF-----TGHTGDV  187



>ref|XP_009166447.1| hypothetical protein T265_13295, partial [Opisthorchis viverrini]
 gb|KER29817.1| hypothetical protein T265_13295, partial [Opisthorchis viverrini]
Length=165

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  5    RTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS  64

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +D+ ++TSSGD
Sbjct  65   GNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFI--DDSQIVTSSGD  119

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TCGLWDI TG + + F     +GHT DV
Sbjct  120  VTCGLWDIETGQQIANF-----TGHTGDV  143



>gb|EJU00042.1| guanine nucleotide binding protein beta subunit 2 [Dacryopinax 
sp. DJM-731 SS1]
Length=350

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 8/149 (5%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R+L+GH  K+Y++ W  +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+
Sbjct  57   RSLKGHLAKIYAMHWAQDKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPS  116

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL   PD +G S V + LS H GY+S C+++  +D  ++TSSGD
Sbjct  117  GNFVACGGLDNICSIYNLRQRPDTNGKSNV-KELSAHTGYLSCCRFI--DDRKIVTSSGD  173

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI  G R   F     S HT DV
Sbjct  174  MTCMLWDIEAGTRIQEF-----SDHTGDV  197



>gb|KDE07792.1| guanine nucleotide-binding protein subunit beta [Microbotryum 
violaceum p1A1 Lamole]
 gb|KDE07793.1| guanine nucleotide-binding protein subunit beta, variant [Microbotryum 
violaceum p1A1 Lamole]
Length=346

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 132/208 (63%), Gaps = 16/208 (8%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCR  192
            MS  E++E+  AA +   +L+E+++ KR  L DT + + A      P I+  P      R
Sbjct  1    MSATEIQEKIAAARREAENLKEKIRAKREQLADTSLRSMAHEIDPLPRIAMRPR-----R  55

Query  193  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  372
             L+GH  K+Y++ W+ +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G
Sbjct  56   TLKGHLAKIYAMHWSQDKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSG  115

Query  373  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
              VACGGLD+VCSI+NL      +G + V+R LS H GY+S C+++   D  ++TSSGD 
Sbjct  116  NFVACGGLDNVCSIYNLR---SKEGTAKVARELSAHTGYLSCCRFL--NDRQVLTSSGDM  170

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWD+  G+R   F     + HT DV
Sbjct  171  TCMLWDVDAGVRVIEF-----NDHTGDV  193



>emb|CCD58560.1| unnamed protein product [Schistosoma mansoni]
Length=315

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 10/157 (6%)
 Frame = +1

Query  166  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  345
            G   L   R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WV
Sbjct  41   GRIQLRTRRTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWV  100

Query  346  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  525
            MTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +D+
Sbjct  101  MTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFL--DDS  155

Query  526  HLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             ++TSSGD TCGLWDI TG + + F     +GHT DV
Sbjct  156  QIVTSSGDVTCGLWDIETGQQVATF-----TGHTGDV  187



>gb|AAW26990.1| SJCHGC05537 protein [Schistosoma japonicum]
Length=340

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 10/157 (6%)
 Frame = +1

Query  166  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  345
            G   L   R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WV
Sbjct  41   GRIQLRTRRTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWV  100

Query  346  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  525
            MTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +D+
Sbjct  101  MTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFI--DDS  155

Query  526  HLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             ++TSSGD TCGLWDI TG + + F     +GHT DV
Sbjct  156  QIVTSSGDVTCGLWDIETGQQVATF-----TGHTGDV  187



>emb|CCA67815.1| related to G-protein beta subunit Bpp1 [Piriformospora indica 
DSM 11827]
Length=349

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 127/208 (61%), Gaps = 13/208 (6%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCR  192
            MS  +++ER  +A +  +SL+E+++ K+    DT +   A      P I   P      R
Sbjct  1    MSANDIQERIASARREADSLKEKIRAKKEATADTSLRAMAAEVETLPRIVMKPR-----R  55

Query  193  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  372
             L+GH  K+Y++ W  +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G
Sbjct  56   ALKGHLAKIYAMHWAADKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSG  115

Query  373  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
              VACGGLD++CSI+NL       G+   +R LS H GY+S C+++   D  ++TSSGD 
Sbjct  116  NFVACGGLDNICSIYNLRSKEGGIGSVKGARELSAHSGYLSCCRFI--NDRQIVTSSGDM  173

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWDI  G+R   F     S HT DV
Sbjct  174  TCMLWDIEAGVRVMEF-----SDHTGDV  196



>ref|XP_002127296.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Ciona intestinalis]
Length=347

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 110/159 (69%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            + G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  46   AIGRVQMRTRRTLRGHLAKIYAMHWGTDSRHVVSASQDGKLILWDSYTTNKVHAIPLRSS  105

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CS++NL      +GN  VSR L+GH GY+S C+++  +
Sbjct  106  WVMTCAYAPSGSFVACGGLDNICSVYNL---KTREGNVRVSRELNGHTGYLSCCRFL--D  160

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D  ++TSSGD TC LWDI TG++T+ F     +GHT DV
Sbjct  161  DTRIVTSSGDMTCALWDIETGMQTTAF-----TGHTGDV  194



>gb|ACI34200.1| Guanine nucleotide-binding protein GI/GS/GT subunit beta-1 [Salmo 
salar]
Length=340

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 107/149 (72%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++V  +D+ ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFV--DDSQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>emb|CDQ76873.1| unnamed protein product [Oncorhynchus mykiss]
Length=333

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 107/149 (72%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  42   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  101

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD+VCSI+NL      +GN  VSR L+GH GY+S C++V  +D  ++TSSGD
Sbjct  102  GNYVACGGLDNVCSIYNLKT---REGNVRVSRELAGHTGYLSCCRFV--DDTKIVTSSGD  156

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             +C LWDI TG++T+ F     +GHT DV
Sbjct  157  TSCALWDIETGMQTTTF-----AGHTGDV  180



>gb|ACI33136.1| Guanine nucleotide-binding protein GI/GS/GT subunit beta-1 [Salmo 
salar]
 gb|ACI34279.1| Guanine nucleotide-binding protein GI/GS/GT subunit beta-1 [Salmo 
salar]
Length=340

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 107/149 (72%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++V  +D+ ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFV--DDSQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>emb|CDQ88615.1| unnamed protein product [Oncorhynchus mykiss]
Length=340

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 107/149 (72%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++V  +D+ ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFV--DDSQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_006740020.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Leptonychotes weddellii]
Length=340

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 107/149 (72%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWD+ TGL+T+ F     +GHT DV
Sbjct  164  TTCALWDVETGLQTTTF-----TGHTGDV  187



>gb|KIM28934.1| hypothetical protein M408DRAFT_328991 [Serendipita vermifera 
MAFF 305830]
Length=349

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 128/208 (62%), Gaps = 13/208 (6%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCR  192
            MS  +++ER  +A +  +SL+E+++ K+    DT +   A      P I   P      R
Sbjct  1    MSANDIQERIASARREADSLKEKIRAKKEATADTSLRAMAGEVETLPRIVMKPR-----R  55

Query  193  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  372
            +L+GH  K+Y++ W  +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA++P+G
Sbjct  56   SLKGHLAKIYAMHWAADKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYAPSG  115

Query  373  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK  552
              VACGGLD++CSI+NL       G+   +R LS H GY+S C+++   D  ++TSSGD 
Sbjct  116  NFVACGGLDNICSIYNLRSKEGGIGSVKGARELSAHSGYLSCCRFI--NDRQIVTSSGDM  173

Query  553  TCGLWDITTGLRTSVFGGEYQSGHTADV  636
            TC LWDI  G+R   F     S HT DV
Sbjct  174  TCMLWDIEAGVRVMEF-----SDHTGDV  196



>ref|XP_010782136.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Notothenia coriiceps]
 ref|XP_010782137.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Notothenia coriiceps]
Length=340

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++V  +D  +ITSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFV--DDNQIITSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_009032026.1| hypothetical protein HELRODRAFT_91325 [Helobdella robusta]
 gb|ESN89861.1| hypothetical protein HELRODRAFT_91325 [Helobdella robusta]
Length=341

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKMHAIPLRSSWVMTCAYAPS  109

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR LSGH GY+S C+++  +D  ++TSSGD
Sbjct  110  GNYVACGGLDNICSIYSLKT---REGNVRVSRELSGHNGYLSCCRFL--DDNQIVTSSGD  164

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     SGHT DV
Sbjct  165  MTCALWDIETGQQTTSF-----SGHTGDV  188



>ref|XP_004349142.1| guanine nucleotide-binding protein beta subunit [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE91226.1| guanine nucleotide-binding protein beta subunit [Capsaspora owczarzaki 
ATCC 30864]
Length=341

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 102/147 (69%), Gaps = 5/147 (3%)
 Frame = +1

Query  166  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  345
            G   L   R L+GH  KVY++ W  ++ RIVSA+QDG+LI+W+A    K HAI L  +WV
Sbjct  42   GRIQLKNRRTLKGHLAKVYAMQWANDRRRIVSAAQDGKLIIWDAFKMHKHHAIALRSSWV  101

Query  346  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  525
            MTCA+SP+GQ VACGGLD+VC+++++    D    + + RTLSGH G++S C+++PNE  
Sbjct  102  MTCAYSPSGQFVACGGLDNVCTLYSIREGED----ARIYRTLSGHDGFISCCRFLPNE-R  156

Query  526  HLITSSGDKTCGLWDITTGLRTSVFGG  606
             +IT+SGD TC LWDI TG R   F G
Sbjct  157  QIITASGDATCVLWDIETGERLKAFTG  183


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 60/128 (47%), Gaps = 8/128 (6%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L GH G +    + P + +I++AS D   ++W+  T ++  A        ++   SP 
Sbjct  137  RTLSGHDGFISCCRFLPNERQIITASGDATCVLWDIETGERLKAFTGHAGECLSVNVSPD  196

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G +   G  D  C I+++        +    +  +GH+  V+A  Y PN +A   + S D
Sbjct  197  GSTFVSGSSDGTCRIWDVR-------SGRCVQWFNGHESDVNAVVYFPNGEA-FGSGSDD  248

Query  550  KTCGLWDI  573
             TC L+D+
Sbjct  249  DTCRLFDL  256



>ref|XP_009013973.1| hypothetical protein HELRODRAFT_75178 [Helobdella robusta]
 gb|ESO08184.1| hypothetical protein HELRODRAFT_75178 [Helobdella robusta]
Length=340

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGFTTNKMHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR LSGH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYSL---KTREGNVRVSRELSGHNGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  MTCALWDIETGQQTTSF-----NGHTGDV  187



>gb|AAG31060.1|AF277161_1 G-protein B1 subunit [Ambystoma tigrinum]
Length=340

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  +ITSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFI--DDNQIITSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>emb|CCX14452.1| Similar to Guanine nucleotide-binding protein subunit beta; acc. 
no. O14435 [Pyronema omphalodes CBS 100304]
Length=346

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 135/205 (66%), Gaps = 13/205 (6%)
 Frame = +1

Query  22   VAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQ  201
            ++++++R  AA +   +L+ R+K K+  L D D+   A+   +T      T++   +NL+
Sbjct  1    MSDIQDRIAAARREAENLKARIKAKKEELADADLRQVAK---ETLEPLPRTNMKVRKNLK  57

Query  202  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV  381
            GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  V
Sbjct  58   GHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNFV  117

Query  382  ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG  561
            ACGGLD++CS++NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD TC 
Sbjct  118  ACGGLDNICSVYNLST---RDGPTRVARELSGHSGYLSCCRFI--NDRRILTSSGDMTCM  172

Query  562  LWDITTGLRTSVFGGEYQSGHTADV  636
            LWDI TG + + F     S H  DV
Sbjct  173  LWDIDTGAKITEF-----SDHLGDV  192



>ref|XP_010873676.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Esox lucius]
 ref|XP_010873677.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Esox lucius]
 ref|XP_010873678.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Esox lucius]
 ref|XP_010873679.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Esox lucius]
Length=340

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++V  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFV--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_007237084.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Astyanax mexicanus]
 ref|XP_007237085.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Astyanax mexicanus]
 ref|XP_007237086.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Astyanax mexicanus]
Length=340

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++V  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFV--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>gb|EZF44104.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum CBS 100081]
Length=257

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSSGD  172

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI +G + + F     + H  DV
Sbjct  173  MTCILWDIESGAKITEF-----ADHLGDV  196



>gb|EZF68383.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
soudanense CBS 452.61]
Length=260

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSSGD  172

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI +G + + F     + H  DV
Sbjct  173  MTCILWDIESGAKITEF-----ADHLGDV  196



>ref|XP_002113727.1| G protein beta 1 subunit [Trichoplax adhaerens]
 gb|EDV24201.1| G protein beta 1 subunit [Trichoplax adhaerens]
Length=341

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 107/149 (72%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDSYTTNKIHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D +++TSSGD
Sbjct  109  GNYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFI--DDTNIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TCGLWDI TG +T+ F     +GHT DV
Sbjct  164  MTCGLWDIETGHQTTSF-----TGHTGDV  187



>gb|AAW25818.1| unknown [Schistosoma japonicum]
Length=225

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 105/155 (68%), Gaps = 10/155 (6%)
 Frame = +1

Query  172  TDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT  351
            T L   R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMT
Sbjct  43   TQLRSRRTLRGHLAKIYAMHWCSDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMT  102

Query  352  CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL  531
            CA+SP+G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C++V   D+ +
Sbjct  103  CAYSPSGNYVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFV--NDSQI  157

Query  532  ITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            +T+SGD TC LWDI TG + + F     +GHT DV
Sbjct  158  VTTSGDGTCALWDIETGQQIASF-----TGHTGDV  187



>gb|EZF28331.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
interdigitale H6]
 gb|EZF54801.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum CBS 288.86]
 gb|EZF65419.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum CBS 289.86]
 gb|EZF97452.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum MR1459]
 gb|KDB28245.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum D6]
Length=275

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSSGD  172

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI +G + + F     + H  DV
Sbjct  173  MTCILWDIESGAKITEF-----ADHLGDV  196



>ref|XP_003132597.2| PREDICTED: guanine nucleotide-binding protein subunit beta-4, 
partial [Sus scrofa]
 gb|EHB15370.1| Guanine nucleotide-binding protein subunit beta-4, partial [Heterocephalus 
glaber]
Length=233

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS  98

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct  99   WVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFL--D  153

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D+ ++TSSGD TC LWDI T  +T+ F     +GH+ DV
Sbjct  154  DSQIVTSSGDTTCALWDIETAQQTTTF-----TGHSGDV  187



>gb|EZF25118.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum MR850]
Length=262

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSSGD  172

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI +G + + F     + H  DV
Sbjct  173  MTCILWDIESGAKITEF-----ADHLGDV  196



>gb|EZG11290.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum CBS 202.88]
Length=276

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSSGD  172

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI +G + + F     + H  DV
Sbjct  173  MTCILWDIESGAKITEF-----ADHLGDV  196



>gb|EZF79069.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum MR1448]
Length=272

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSSGD  172

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI +G + + F     + H  DV
Sbjct  173  MTCILWDIESGAKITEF-----ADHLGDV  196



>gb|KIK07337.1| hypothetical protein K443DRAFT_673598 [Laccaria amethystina LaAM-08-1]
Length=349

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 128/205 (62%), Gaps = 17/205 (8%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SL+E+++ KR    DT +   A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAESLKEKIRAKRESSADTSLRAMAAEVDALPRIVMRPR-----RALRG  61

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  62   HLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNFVA  121

Query  385  CGGLDSVCSIFNLNLPPDNDG-NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG  561
            CGGLD++CSI+NLN   + DG N+  +R LS H GY+S C+++   D  ++TSSGD TC 
Sbjct  122  CGGLDNICSIYNLN---NKDGANAKGARELSAHSGYLSCCRFIS--DRQIVTSSGDMTCM  176

Query  562  LWDITTGLRTSVFGGEYQSGHTADV  636
            LWDI +G R   F     S HT DV
Sbjct  177  LWDIESGARVVEF-----SDHTGDV  196



>ref|XP_005796981.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Xiphophorus maculatus]
 ref|XP_007550642.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Poecilia formosa]
 ref|XP_007550649.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Poecilia formosa]
 ref|XP_007550658.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Poecilia formosa]
 ref|XP_007550661.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Poecilia formosa]
 ref|XP_008406900.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Poecilia reticulata]
 ref|XP_008406901.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Poecilia reticulata]
Length=340

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_003017524.1| hypothetical protein ARB_04406 [Arthroderma benhamiae CBS 112371]
 gb|EFE36879.1| hypothetical protein ARB_04406 [Arthroderma benhamiae CBS 112371]
Length=240

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  5    RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  64

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  65   GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSSGD  119

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI +G + + F     + H  DV
Sbjct  120  MTCILWDIESGAKITEF-----ADHLGDV  143



>ref|XP_004068666.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Oryzias latipes]
Length=340

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_003962986.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Takifugu rubripes]
Length=340

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_003455365.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Oreochromis niloticus]
 ref|XP_005459918.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Oreochromis niloticus]
 ref|XP_005459919.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Oreochromis niloticus]
 ref|XP_005730798.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Pundamilia nyererei]
 ref|XP_005730799.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Pundamilia nyererei]
 ref|XP_005730800.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Pundamilia nyererei]
 ref|XP_005938186.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Haplochromis burtoni]
 ref|XP_005938187.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Haplochromis burtoni]
 ref|XP_005938188.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Haplochromis burtoni]
 ref|XP_006785423.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Neolamprologus brichardi]
 ref|XP_006785424.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Neolamprologus brichardi]
 ref|XP_006785425.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Neolamprologus brichardi]
Length=340

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_003973377.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Takifugu rubripes]
Length=340

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_005724603.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Pundamilia nyererei]
 ref|XP_005724604.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Pundamilia nyererei]
 ref|XP_005724605.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Pundamilia nyererei]
 ref|XP_005724606.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X4 [Pundamilia nyererei]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_008317802.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Cynoglossus semilaevis]
 ref|XP_008317803.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Cynoglossus semilaevis]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_003448366.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Oreochromis niloticus]
 ref|XP_005453557.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Oreochromis niloticus]
 ref|XP_005453558.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Oreochromis niloticus]
 ref|XP_005453559.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X4 [Oreochromis niloticus]
 ref|XP_005453560.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X5 [Oreochromis niloticus]
 ref|XP_006783221.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Neolamprologus brichardi]
 ref|XP_006783222.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Neolamprologus brichardi]
 ref|XP_006783223.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Neolamprologus brichardi]
 ref|XP_006783224.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X4 [Neolamprologus brichardi]
 ref|XP_006783225.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X5 [Neolamprologus brichardi]
 ref|XP_006783226.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X6 [Neolamprologus brichardi]
 ref|XP_008287387.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Stegastes partitus]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_004548729.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Maylandia zebra]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|NP_997774.1| guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 
[Danio rerio]
 sp|Q6PH57.1|GBB1_DANRE RecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1; AltName: Full=Transducin beta chain 1 [Danio 
rerio]
 gb|AAH56708.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
1 [Danio rerio]
 gb|AAH71277.1| Gnb1 protein [Danio rerio]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>gb|ACY66435.1| guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 
[Scylla paramamosain]
Length=264

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 110/166 (66%), Gaps = 12/166 (7%)
 Frame = +1

Query  139  SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTH  318
            + G  PI  G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K H
Sbjct  34   TSGMEPI--GRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSYTTNKVH  91

Query  319  AIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSA  498
            AI L  +WVMTCA++P+G  VACGGLD++CSI++L      +GN  VSR L GH GY+S 
Sbjct  92   AIPLRSSWVMTCAYAPSGSYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSC  148

Query  499  CQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            C++V  +D  ++TSSGD TC LWDI TG + + F     +GHT DV
Sbjct  149  CRFV--DDNQIVTSSGDMTCALWDIETGQQCTQF-----TGHTGDV  187



>ref|XP_010729805.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Larimichthys crocea]
 ref|XP_010729806.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Larimichthys crocea]
 ref|XP_010729807.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Larimichthys crocea]
 ref|XP_010729808.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Larimichthys crocea]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_008283304.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Stegastes partitus]
 ref|XP_008316647.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Cynoglossus semilaevis]
 ref|XP_008316648.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Cynoglossus semilaevis]
 ref|XP_010732274.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Larimichthys crocea]
 ref|XP_010732275.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Larimichthys crocea]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_006642037.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Lepisosteus oculatus]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_010169104.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Caprimulgus carolinensis]
Length=340

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_011117389.1| hypothetical protein AOL_s00004g438 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53779.1| hypothetical protein AOL_s00004g438 [Arthrobotrys oligospora 
ATCC 24927]
Length=348

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 133/204 (65%), Gaps = 13/204 (6%)
 Frame = +1

Query  25   AELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQG  204
            ++L++R  AA +    L+E++K K+  L D D+   A+ Q +   +   T +   R L+G
Sbjct  3    SDLQDRITAARREAEGLKEKIKRKKDELADADLRQLAKEQVE---ALPRTLMKNRRTLKG  59

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+YS+ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  VA
Sbjct  60   HLAKIYSMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNYVA  119

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CS++NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD TC L
Sbjct  120  CGGLDNICSVYNLSA---RDGPTRVARELSGHSGYLSCCRFL--NDRRILTSSGDMTCML  174

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI TG R + F     + H  DV
Sbjct  175  WDIDTGARITDF-----ADHLGDV  193



>ref|XP_009065631.1| hypothetical protein LOTGIDRAFT_236462 [Lottia gigantea]
 gb|ESO83599.1| hypothetical protein LOTGIDRAFT_236462 [Lottia gigantea]
Length=341

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +
Sbjct  40   SIGRIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSS  99

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +
Sbjct  100  WVMTCAYAPSGSYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFI--D  154

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D  ++TSSGD TC LWDI TG +T+ F     +GHT DV
Sbjct  155  DNQIVTSSGDMTCALWDIETGQQTTSF-----TGHTGDV  188



>gb|EFX00034.1| guanine nucleotide-binding protein beta subunit [Grosmannia clavigera 
kw1407]
Length=320

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 104/149 (70%), Gaps = 9/149 (6%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSSGD  180

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC  WDI TG R   F     + H  DV
Sbjct  181  MTCMKWDIETGTRVVEF-----ADHLGDV  204


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 70/150 (47%), Gaps = 14/150 (9%)
 Frame = +1

Query  166  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  345
            GPT +   R L GH G +    +  +++ I+++S D   + W+  T  +          V
Sbjct  148  GPTRVA--RELSGHAGYLSCCRFINDRS-ILTSSGDMTCMKWDIETGTRVVEFADHLGDV  204

Query  346  MTCAFSPTGQ-SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED  522
            M+ + +PT Q +   G  D+   ++++             +T +GH+  ++A Q+ P  D
Sbjct  205  MSISLNPTNQNTFISGACDAFAKLWDIRA-------GKAVQTFAGHESDINAIQFFP--D  255

Query  523  AH-LITSSGDKTCGLWDITTGLRTSVFGGE  609
             H  +T S D TC L+DI      +V+G E
Sbjct  256  GHSFVTGSDDATCRLFDIRADRELNVYGSE  285



>gb|KDQ31285.1| hypothetical protein PLEOSDRAFT_1088718 [Pleurotus ostreatus 
PC15]
Length=350

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 129/209 (62%), Gaps = 18/209 (9%)
 Frame = +1

Query  19   SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRN  195
            S  +++ER  AA +   SL+E+++ KR    DT +   A      P I   P      R 
Sbjct  4    SQGDIQERIAAARREAESLKEKIRAKRESSADTSLRAMAAEVDPLPRIVMRPR-----RA  58

Query  196  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  375
            L+GH  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G 
Sbjct  59   LKGHLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGN  118

Query  376  SVACGGLDSVCSIFNLNLPPDNDGNSTV--SRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
             VACGGLD++CSI+NLN   + D  ++V  +R LS H GY+S C+++   D  ++TSSGD
Sbjct  119  FVACGGLDNICSIYNLN---NKDAGASVRGARELSAHSGYLSCCRFI--NDRQIVTSSGD  173

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI  G+R   F     S HT DV
Sbjct  174  MTCMLWDIEAGVRVVEF-----SDHTGDV  197



>gb|KEF53104.1| guanine nucleotide-binding protein subunit beta [Exophiala aquamarina 
CBS 119918]
Length=308

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSSGD
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSSGD  174

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC +WDI TG + + F     + H  DV
Sbjct  175  MTCMMWDIETGSKVTEF-----ADHLGDV  198



>ref|XP_005800197.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Xiphophorus maculatus]
 ref|XP_007571274.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Poecilia formosa]
 ref|XP_008411302.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Poecilia reticulata]
 ref|XP_008411303.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Poecilia reticulata]
 ref|XP_008411304.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1 [Poecilia reticulata]
Length=340

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_011419294.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Crassostrea 
gigas]
 ref|XP_011419295.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Crassostrea 
gigas]
 gb|EKC28852.1| Guanine nucleotide-binding protein subunit beta [Crassostrea 
gigas]
Length=341

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS  109

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct  110  GSYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFI--DDNQIVTSSGD  164

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  165  MTCALWDIETGQQTTAF-----TGHTGDV  188



>emb|CBY09724.1| unnamed protein product [Oikopleura dioica]
Length=379

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  88   RTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS  147

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
               VACGGLD++CSI+NL      +G   VSR L GH GY+S C+++  +D+ +ITSSGD
Sbjct  148  ANFVACGGLDNICSIYNLKTK---EGTVRVSRELPGHTGYLSCCRFI--DDSQIITSSGD  202

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TCGLWDI TG +T+ F      GHT DV
Sbjct  203  MTCGLWDIETGQQTTAF-----VGHTGDV  226



>ref|XP_007422850.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X1 [Python bivittatus]
 ref|XP_007422851.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X2 [Python bivittatus]
 ref|XP_007422852.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X3 [Python bivittatus]
 ref|XP_007422853.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X4 [Python bivittatus]
 ref|XP_007422854.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X5 [Python bivittatus]
 ref|XP_007422855.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X6 [Python bivittatus]
 ref|XP_007422856.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X7 [Python bivittatus]
Length=340

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  39   SVGRIQMRTRRTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS  98

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct  99   WVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFL--D  153

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D  ++TSSGD TC LWDI TG +T+ F     +GHT DV
Sbjct  154  DNQIVTSSGDTTCALWDIETGQQTTAF-----TGHTGDV  187



>ref|XP_001176793.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform 1 [Strongylocentrotus purpuratus]
 ref|XP_003724746.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Strongylocentrotus purpuratus]
Length=341

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 112/166 (67%), Gaps = 12/166 (7%)
 Frame = +1

Query  139  SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTH  318
            +Q   P+  G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K H
Sbjct  35   TQNMDPV--GRIQMRTRRTLRGHLAKIYAMHWGTDSRNLVSASQDGKLIVWDSYTTNKVH  92

Query  319  AIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSA  498
            AI L  +WVMTCA++PTG  VACGGLD++CSI++L      +GN  VSR L GH GY+S 
Sbjct  93   AIPLRSSWVMTCAYAPTGSFVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSC  149

Query  499  CQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            C+++  +D  ++TSSGD +CGLWDI TG +T+ F     +GHT DV
Sbjct  150  CRFI--DDNQIVTSSGDMSCGLWDIETGQQTTGF-----TGHTGDV  188



>gb|ETE67977.1| Guanine nucleotide-binding protein subunit beta-4 [Ophiophagus 
hannah]
Length=340

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  39   SVGRIQMRTRRTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS  98

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct  99   WVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFL--D  153

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D  ++TSSGD TC LWDI TG +T+ F     +GHT DV
Sbjct  154  DNQIVTSSGDTTCALWDIETGQQTTAF-----TGHTGDV  187



>gb|ELT98472.1| hypothetical protein CAPTEDRAFT_124853 [Capitella teleta]
Length=341

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDSFTTNKVHAIPLRSSWVMTCAYAPS  109

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct  110  GSYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFL--DDNQIVTSSGD  164

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  165  MTCALWDIETGQQTTSF-----AGHTGDV  188



>ref|XP_011107440.1| hypothetical protein H072_1448 [Dactylellina haptotyla CBS 200.50]
 gb|EPS44559.1| hypothetical protein H072_1448 [Dactylellina haptotyla CBS 200.50]
Length=347

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 133/204 (65%), Gaps = 13/204 (6%)
 Frame = +1

Query  25   AELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQG  204
            ++L++R  AA +    L+E++K K+  L D D+   A+ Q +   +   T +   + L+G
Sbjct  3    SDLQDRITAARREAEGLKEKIKRKKDELADADLRQLAKDQVE---ALPRTHMKQRKTLKG  59

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+YS+ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  VA
Sbjct  60   HLAKIYSMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNYVA  119

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CS++NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD TC L
Sbjct  120  CGGLDNICSVYNLSA---RDGPTRVARELSGHSGYLSCCRFL--NDRRILTSSGDMTCML  174

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI TG R + F     + H  DV
Sbjct  175  WDIDTGARITDF-----ADHLGDV  193



>ref|XP_009864056.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-3 isoform X2 [Apaloderma vittatum]
Length=327

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 106/148 (72%), Gaps = 10/148 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  36   RTLRGHLAKIYAMHWSTDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPS  95

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR LSGH GY+S C+++  +D +++TSSGD
Sbjct  96   GNFVACGGLDNMCSIYSL---KSREGNVKVSRELSGHTGYLSCCRFL--DDNNIVTSSGD  150

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTAD  633
             TCGLWDI TG + +VF      GHT D
Sbjct  151  TTCGLWDIETGQQKTVF-----LGHTGD  173



>dbj|GAA51958.1| guanine nucleotide binding protein (G protein) beta 1 [Clonorchis 
sinensis]
Length=503

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  212  RTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS  271

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +D+ ++TSSGD
Sbjct  272  GNYVACGGLDNICSIYNL---KTREGNVRVSRELPGHTGYLSCCRFI--DDSQIVTSSGD  326

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TCGLWDI TG + + F     +GHT DV
Sbjct  327  VTCGLWDIETGQQIANF-----TGHTGDV  350



>ref|XP_005069787.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
[Mesocricetus auratus]
Length=340

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS  98

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct  99   WVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFL--D  153

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D  +ITSSGD TC LWDI TG +T+ F     +GH+ DV
Sbjct  154  DGQIITSSGDTTCALWDIETGQQTTTF-----AGHSGDV  187



>emb|CBY35900.1| unnamed protein product [Oikopleura dioica]
Length=374

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  83   RTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS  142

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
               VACGGLD++CSI+NL      +G   VSR L GH GY+S C+++  +D+ +ITSSGD
Sbjct  143  ANFVACGGLDNICSIYNLKTK---EGTVRVSRELPGHTGYLSCCRFI--DDSQIITSSGD  197

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TCGLWDI TG +T+ F      GHT DV
Sbjct  198  MTCGLWDIETGQQTTAF-----VGHTGDV  221



>gb|KDR85626.1| hypothetical protein GALMADRAFT_218719 [Galerina marginata CBS 
339.88]
Length=349

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 128/205 (62%), Gaps = 17/205 (8%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SL+E+++ KR    DT +   A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAESLKEKIRAKRESSADTSLRAMAAEVDALPRIVMRPR-----RALRG  61

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  62   HLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNFVA  121

Query  385  CGGLDSVCSIFNLNLPPDNDG-NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG  561
            CGGLD++CSI++LN   + DG N+  +R LS H GY+S C+++   D  ++TSSGD TC 
Sbjct  122  CGGLDNICSIYSLN---NKDGTNAKGARELSAHSGYLSCCRFI--NDRQIVTSSGDMTCM  176

Query  562  LWDITTGLRTSVFGGEYQSGHTADV  636
            LWDI  G+R   F     S HT DV
Sbjct  177  LWDIEAGVRVVEF-----SDHTGDV  196



>gb|ACI34147.1| Guanine nucleotide-binding protein GI/GS/GT subunit beta-1 [Salmo 
salar]
 emb|CDQ73377.1| unnamed protein product [Oncorhynchus mykiss]
Length=340

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTC+++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCSYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++V  +D  +ITSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFV--DDNQIITSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GH+ DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHSGDV  187



>ref|XP_003509126.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
[Cricetulus griseus]
 ref|XP_007607108.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
[Cricetulus griseus]
Length=340

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS  98

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct  99   WVMTCAYAPSGNYVACGGLDNICSIYNL---KTREGNVRVSRELPGHTGYLSCCRFL--D  153

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D  +ITSSGD TC LWDI TG +T+ F     +GH+ DV
Sbjct  154  DGQIITSSGDTTCALWDIETGQQTTTF-----AGHSGDV  187



>ref|XP_009864055.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-3 isoform X1 [Apaloderma vittatum]
 gb|KFP74531.1| Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 
[Apaloderma vittatum]
Length=340

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 106/148 (72%), Gaps = 10/148 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWSTDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR LSGH GY+S C+++  +D +++TSSGD
Sbjct  109  GNFVACGGLDNMCSIYSL---KSREGNVKVSRELSGHTGYLSCCRFL--DDNNIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTAD  633
             TCGLWDI TG + +VF      GHT D
Sbjct  164  TTCGLWDIETGQQKTVF-----LGHTGD  186



>emb|CBY34556.1| unnamed protein product [Oikopleura dioica]
Length=378

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  87   RTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS  146

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
               VACGGLD++CSI+NL      +G   VSR L GH GY+S C+++  +D+ +ITSSGD
Sbjct  147  ANFVACGGLDNICSIYNLKTK---EGTVRVSRELPGHTGYLSCCRFI--DDSQIITSSGD  201

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TCGLWDI TG +T+ F      GHT DV
Sbjct  202  MTCGLWDIETGQQTTAF-----VGHTGDV  225



>ref|XP_005343822.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
[Microtus ochrogaster]
Length=340

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS  98

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct  99   WVMTCAYAPSGNYVACGGLDNICSIYNL---KTREGNVRVSRELPGHTGYLSCCRFL--D  153

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D  +ITSSGD TC LWDI TG +T+ F     +GH+ DV
Sbjct  154  DGQIITSSGDTTCALWDIETGQQTTTF-----AGHSGDV  187



>gb|KII94026.1| hypothetical protein PLICRDRAFT_413480 [Plicaturopsis crispa 
FD-325 SS-3]
Length=350

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 125/204 (61%), Gaps = 14/204 (7%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SL+E+++ KR    DT +   A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAESLKEKIRAKRESSADTSLRAMAAEVDSLPRIVMRPR-----RALKG  61

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA++P+G  VA
Sbjct  62   HLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYAPSGNLVA  121

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CSI+NLN   +   N   +R LS H GY+S C+++   D  ++TSSGD TC L
Sbjct  122  CGGLDNICSIYNLN-SKEGGSNLKGARELSAHSGYLSCCRFI--NDRQIVTSSGDMTCML  178

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI  G+R   F     S HT DV
Sbjct  179  WDIEAGVRVVEF-----SDHTGDV  197



>ref|XP_010894390.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like [Esox lucius]
Length=340

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTC+++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCSYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++V  +D  +ITSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFV--DDNQIITSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GH+ DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHSGDV  187



>ref|XP_004570997.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Maylandia zebra]
 ref|XP_004570998.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Maylandia zebra]
 ref|XP_004570999.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X3 [Maylandia zebra]
Length=340

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             +C LWDI TG +T+ F     +GHT DV
Sbjct  164  TSCALWDIETGQQTTTF-----AGHTGDV  187



>dbj|BAF63410.1| G-protein beta subunit 1 [Cyprinus carpio]
Length=340

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             +C LWDI TG +T+ F     +GHT DV
Sbjct  164  TSCALWDIETGQQTTTF-----AGHTGDV  187



>gb|AGY52593.1| G protein B subunit [Crassostrea angulata]
Length=341

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS  109

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct  110  GSYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFL--DDNQIVTSSGD  164

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  165  MTCALWDIETGQQTTAF-----TGHTGDV  188



>emb|CBY37164.1| unnamed protein product [Oikopleura dioica]
Length=387

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  96   RTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS  155

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
               VACGGLD++CSI+NL      +G   VSR L GH GY+S C+++  +D+ +ITSSGD
Sbjct  156  ANFVACGGLDNICSIYNLKTK---EGTVRVSRELPGHTGYLSCCRFI--DDSQIITSSGD  210

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TCGLWDI TG +T+ F      GHT DV
Sbjct  211  MTCGLWDIETGQQTTAF-----VGHTGDV  234



>gb|EWC48535.1| guanine nucleotide-binding protein subunit beta [Drechslerella 
stenobrocha 248]
Length=347

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 131/203 (65%), Gaps = 13/203 (6%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQGH  207
            +L++R   A +    L++++K K+  L D D+   A+ Q +   +   T++   R L+GH
Sbjct  4    DLQDRISQARREAEGLKDKIKRKKDELADADMRQLAKEQVE---ALPRTNMKNRRTLKGH  60

Query  208  TGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVAC  387
              K+YS+ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  VAC
Sbjct  61   LAKIYSMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNYVAC  120

Query  388  GGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLW  567
            GGLD++CS++NL      DG + V+R LSGH GY+S C+++   D  ++TSSGD TC LW
Sbjct  121  GGLDNICSVYNL---AARDGPTRVARELSGHSGYLSCCRFL--NDRRILTSSGDMTCMLW  175

Query  568  DITTGLRTSVFGGEYQSGHTADV  636
            DI TG R + F     + H  DV
Sbjct  176  DIDTGARITDF-----ADHLGDV  193



>gb|AFA34431.1| G protein B subunit [Ostrea edulis]
Length=341

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS  109

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct  110  GSYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFL--DDNQIVTSSGD  164

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  165  MTCALWDIETGQQTTAF-----TGHTGDV  188



>ref|XP_006971195.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
[Peromyscus maniculatus bairdii]
Length=304

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  3    SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS  62

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct  63   WVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFL--D  117

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D  +ITSSGD TC LWDI TG +T+ F     +GH+ DV
Sbjct  118  DGQIITSSGDTTCALWDIETGQQTTTF-----AGHSGDV  151



>ref|NP_001098323.1| guanine nucleotide-binding protein beta subunit [Oryzias latipes]
 dbj|BAC55158.1| guanine nucleotide-binding protein beta subunit [Oryzias latipes]
Length=340

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNL---KTREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             +C LWDI TG +T+ F     +GHT DV
Sbjct  164  TSCALWDIETGQQTTTF-----AGHTGDV  187



>ref|XP_003230593.2| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-2, partial [Anolis carolinensis]
Length=272

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++   D  +ITSSGD
Sbjct  109  GNYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFL--NDNQIITSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     SGH+ DV
Sbjct  164  TTCALWDIETGQQTTTF-----SGHSGDV  187


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 9/128 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L GHTG +    +  + N+I+++S D    +W+  T Q+T         VM+ + SP 
Sbjct  137  RELPGHTGYLSCCRFLND-NQIITSSGDTTCALWDIETGQQTTTFSGHSGDVMSLSLSPD  195

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
             ++   G  D+   ++++        +S   +T +GH+  ++A  + PN +A   T S D
Sbjct  196  MRTFVSGACDASIKLWDIR-------DSMCRQTFTGHESDINAVCFFPNGNA-FTTGSDD  247

Query  550  KTCGLWDI  573
             TC L+D+
Sbjct  248  ATCRLFDL  255



>ref|XP_006454225.1| guanine nucleotide binding protein beta subunit 2 [Agaricus bisporus 
var. bisporus H97]
 ref|XP_007325287.1| hypothetical protein AGABI1DRAFT_81726 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM83994.1| hypothetical protein AGABI1DRAFT_81726 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51242.1| guanine nucleotide binding protein beta subunit 2 [Agaricus bisporus 
var. bisporus H97]
Length=357

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SL+E+++ K+    DT +   A      P I   P      R L+G
Sbjct  13   DIQERIAAARREAESLKEKIRAKKETSADTSLRAMAAEVDPLPRIVMRPR-----RALRG  67

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  68   HLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNYVA  127

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CSI++LN   D   N+  +R LS H GY+S C+++   D  ++TSSGD TC L
Sbjct  128  CGGLDNICSIYSLN-NKDGGTNARGARELSAHSGYLSCCRFI--NDRQIVTSSGDMTCML  184

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI  G+R   F     S HT DV
Sbjct  185  WDIEAGVRVIEF-----SDHTGDV  203



>ref|XP_007390873.1| hypothetical protein PHACADRAFT_248083 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM61460.1| hypothetical protein PHACADRAFT_248083 [Phanerochaete carnosa 
HHB-10118-sp]
Length=349

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 126/204 (62%), Gaps = 15/204 (7%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SL+E+++ KR    DT +   A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAESLKEKIRAKRESTADTSLRAMAAEVDSLPRIVMRPR-----RALRG  61

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  62   HLAKIYAMHWATDRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNFVA  121

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CSI+NLN   +  GN   +R LS H GY+S C+++   D  ++TSSGD TC L
Sbjct  122  CGGLDNICSIYNLN-AKEATGNKG-ARELSAHSGYLSCCRFI--NDRQIVTSSGDMTCML  177

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI  G+R   F     S HT DV
Sbjct  178  WDIEAGVRVVEF-----SDHTGDV  196



>ref|XP_002411384.1| THO complex subunit, putative [Ixodes scapularis]
 gb|EEC13508.1| THO complex subunit, putative [Ixodes scapularis]
Length=340

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA++PT
Sbjct  49   RTLRGHLAKIYAMHWGSDSRYLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYAPT  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C++V  +D  ++TSSGD
Sbjct  109  GSYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFV--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG + + F     +GHT DV
Sbjct  164  MTCALWDIETGQQCTSF-----TGHTGDV  187



>gb|KIO06877.1| hypothetical protein M404DRAFT_998299 [Pisolithus tinctorius 
Marx 270]
Length=349

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 124/204 (61%), Gaps = 15/204 (7%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +    L+E+++  R    DT + T A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAEILKEKIRASREASADTSLRTMAADIDTLPRIVMRPR-----RALKG  61

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W+ ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  62   HLAKIYAMHWSADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNFVA  121

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CSI+NLN    N      +R LS H GY+S C+++   D  ++TSSGD TC L
Sbjct  122  CGGLDNICSIYNLNSRDANGARG--ARELSAHSGYLSCCRFI--NDRQIVTSSGDMTCML  177

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI  G+R   F     S HT DV
Sbjct  178  WDIEAGVRVVEF-----SDHTGDV  196



>gb|AAH15920.1| GNB3 protein [Homo sapiens]
Length=297

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 104/148 (70%), Gaps = 10/148 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR LS H GY+S C+++  +D +++TSSGD
Sbjct  109  GNFVACGGLDNMCSIYNL---KSREGNVKVSRELSAHTGYLSCCRFL--DDNNIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTAD  633
             TC LWDI TG + +VF      GHT D
Sbjct  164  TTCALWDIETGQQKTVF-----VGHTGD  186



>ref|XP_002795766.1| guanine nucleotide-binding protein subunit beta [Paracoccidioides 
sp. 'lutzii' Pb01]
Length=347

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSSGD
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFV--NDRRIITSSGD  174

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI +G + + F     + H  DV
Sbjct  175  MTCMLWDIESGTKVTEF-----ADHLGDV  198


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 12/137 (9%)
 Frame = +1

Query  166  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  345
            GPT +   R L GHTG +    +  ++ RI+++S D   ++W+  +  K          V
Sbjct  142  GPTRVA--RELSGHTGYLSCCRFVNDR-RIITSSGDMTCMLWDIESGTKVTEFADHLGDV  198

Query  346  MTCAFSPTGQSV-ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED  522
            M+ + +PT  +V   G  D+   ++++       G S   +T SGH+  ++A Q+ P+ +
Sbjct  199  MSISINPTNNNVFVSGACDAFAKLWDIRA-----GKSV--QTFSGHESDINAIQFFPDGN  251

Query  523  AHLITSSGDKTCGLWDI  573
            A   T S D TC L+DI
Sbjct  252  A-FGTGSDDTTCRLFDI  267



>ref|XP_003037057.1| guanine nucleotide binding protein beta subunit 2 [Schizophyllum 
commune H4-8]
 gb|EFJ02155.1| guanine nucleotide binding protein beta subunit 2 [Schizophyllum 
commune H4-8]
Length=349

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 127/205 (62%), Gaps = 17/205 (8%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SL+E+++ K+    DT +   A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAESLKEKIRAKKESSADTSLRAMAAEVDALPRIVMRPR-----RALRG  61

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  62   HLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNFVA  121

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTV-SRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG  561
            CGGLD++CSI+NL    + +GNS   +R LS H GY+S C+++   D  ++TSSGD TC 
Sbjct  122  CGGLDNICSIYNLQ---NKEGNSVRGARELSAHSGYLSCCRFL--NDRQIVTSSGDMTCM  176

Query  562  LWDITTGLRTSVFGGEYQSGHTADV  636
            LWDI  G+R   F     S HT DV
Sbjct  177  LWDIEAGVRVVEF-----SDHTGDV  196



>ref|XP_007721690.1| guanine nucleotide-binding protein subunit beta [Capronia coronata 
CBS 617.96]
 gb|EXJ94196.1| guanine nucleotide-binding protein subunit beta [Capronia coronata 
CBS 617.96]
Length=353

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSSGD
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSSGD  174

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG + + F     + H  DV
Sbjct  175  MTCMLWDIETGSKVTEF-----ADHLGDV  198



>ref|XP_007733470.1| guanine nucleotide-binding protein subunit beta [Capronia epimyces 
CBS 606.96]
 ref|XP_009153110.1| guanine nucleotide-binding protein subunit beta [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY52649.1| guanine nucleotide-binding protein subunit beta [Exophiala dermatitidis 
NIH/UT8656]
 gb|EXJ84485.1| guanine nucleotide-binding protein subunit beta [Capronia epimyces 
CBS 606.96]
Length=353

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSSGD
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSSGD  174

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG + + F     + H  DV
Sbjct  175  MTCMLWDIETGSKVTEF-----ADHLGDV  198



>gb|EYC12356.1| hypothetical protein Y032_0047g1438 [Ancylostoma ceylanicum]
Length=312

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 104/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GSFVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG + + F     +GHT DV
Sbjct  164  MTCALWDIETGQQCTAF-----TGHTGDV  187



>ref|XP_002473929.1| candidate G-protein beta subunit [Postia placenta Mad-698-R]
 gb|EED80889.1| candidate G-protein beta subunit [Postia placenta Mad-698-R]
Length=350

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 125/204 (61%), Gaps = 15/204 (7%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SLRE+++ +R    DT +   A      P I   P      R L+G
Sbjct  8    DIQERIAAARREAESLREKIRARRESSADTSLRAMAAEVAALPRIVMRPR-----RALRG  62

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  63   HLAKIYAMHWATDRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNYVA  122

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CSI+NL+    N  N   +R LS H GY+S C+++   D  ++TSSGD TC L
Sbjct  123  CGGLDNICSIYNLHSKEGN--NVKGARELSAHSGYLSCCRFL--NDRQIVTSSGDMTCML  178

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI  G+R   F     S HT DV
Sbjct  179  WDIEAGVRVVEF-----SDHTGDV  197



>ref|XP_007807978.1| G protein beta subunit [Metarhizium acridum CQMa 102]
 gb|EFY92367.1| G protein beta subunit [Metarhizium acridum CQMa 102]
Length=294

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 104/149 (70%), Gaps = 9/149 (6%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  125  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSSGD  180

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC  WDI TG + + F     + H  DV
Sbjct  181  MTCMKWDIETGQKVTEF-----ADHLGDV  204


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 14/148 (9%)
 Frame = +1

Query  166  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  345
            GPT +   R L GH G +    +  +++ I+++S D   + W+  T QK          V
Sbjct  148  GPTRVA--RELSGHAGYLSCCRFINDRS-ILTSSGDMTCMKWDIETGQKVTEFADHLGDV  204

Query  346  MTCAFSPTGQ-SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED  522
            M+ + +PT Q +   G  D+   ++++             +T +GH+  ++A Q+ P  D
Sbjct  205  MSISLNPTNQNTFISGACDAFAKLWDIRA-------GKAVQTFAGHESDINAIQFFP--D  255

Query  523  AH-LITSSGDKTCGLWDITTGLRTSVFG  603
             H  +T S D TC L+DI      +V+G
Sbjct  256  GHSFVTGSDDATCRLFDIRADRELNVYG  283



>gb|KDQ14498.1| hypothetical protein BOTBODRAFT_55346 [Botryobasidium botryosum 
FD-172 SS1]
Length=349

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 128/206 (62%), Gaps = 16/206 (8%)
 Frame = +1

Query  25   AELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQG  204
            A+ +ER  AA +   SLRE+++ K+    D+ +   A      P       +   R L+G
Sbjct  5    ADFQERIAAARREAESLREKIRTKKDATADSSLRAMAAEVDALP----RIVMRQRRALRG  60

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W+ +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  61   HLAKIYAMHWSADKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNLVA  120

Query  385  CGGLDSVCSIFNLNLPPDNDGN--STVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC  558
            CGGLD++CSI+NL    + DGN  S  +R LS H GY+S C+++   D  ++TSSGD TC
Sbjct  121  CGGLDNICSIYNLR---NRDGNAVSRGARELSAHSGYLSCCRFL--NDRQIVTSSGDMTC  175

Query  559  GLWDITTGLRTSVFGGEYQSGHTADV  636
             LWDI  G+RT  F     S HT DV
Sbjct  176  ILWDIEAGVRTMEF-----SDHTGDV  196



>gb|KFG82472.1| G protein beta subunit [Metarhizium anisopliae]
Length=318

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 104/149 (70%), Gaps = 9/149 (6%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  125  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSSGD  180

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC  WDI TG + + F     + H  DV
Sbjct  181  MTCMKWDIETGQKVTEF-----ADHLGDV  204


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 14/150 (9%)
 Frame = +1

Query  166  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  345
            GPT +   R L GH G +    +  +++ I+++S D   + W+  T QK          V
Sbjct  148  GPTRVA--RELSGHAGYLSCCRFINDRS-ILTSSGDMTCMKWDIETGQKVTEFADHLGDV  204

Query  346  MTCAFSPTGQ-SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED  522
            M+ + +PT Q +   G  D+   ++++             +T +GH+  ++A Q+ P  D
Sbjct  205  MSISLNPTNQNTFISGACDAFAKLWDIRA-------GKAVQTFAGHESDINAIQFFP--D  255

Query  523  AH-LITSSGDKTCGLWDITTGLRTSVFGGE  609
             H  +T S D TC L+DI      +V+G E
Sbjct  256  GHSFVTGSDDATCRLFDIRADRELNVYGSE  285



>gb|KIP11721.1| hypothetical protein PHLGIDRAFT_17891 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=349

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 126/204 (62%), Gaps = 15/204 (7%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SL+E+++ KR    DT +   A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAESLKEKIRAKRESSADTSLRAMAAEVDSLPRIVMRPR-----RALRG  61

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA++P+G  VA
Sbjct  62   HLAKIYAMHWATDRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYAPSGNFVA  121

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CSI+NLN   +  GN   +R LS H GY+S C+++   D  ++TSSGD TC L
Sbjct  122  CGGLDNICSIYNLN-AKEGTGNKG-ARELSAHSGYLSCCRFI--NDRQIVTSSGDMTCML  177

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI  G+R   F     S HT DV
Sbjct  178  WDIEAGVRVVEF-----SDHTGDV  196



>gb|KIW11996.1| guanine nucleotide-binding protein subunit beta [Exophiala spinifera]
Length=351

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSSGD
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSSGD  174

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG + + F     + H  DV
Sbjct  175  MTCMLWDIETGSKVTEF-----ADHLGDV  198



>ref|XP_007001778.1| G-protein beta subunit GPB1 [Tremella mesenterica DSM 1558]
 gb|EIW73507.1| G-protein beta subunit GPB1 [Tremella mesenterica DSM 1558]
Length=354

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 18/213 (8%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCR  192
            MS +E++E+  AA +  + L++++K  +    DT +   A      P +S  P      R
Sbjct  1    MSQSEIQEKIAAARREADQLKDKIKAAKDQTADTSLRAMANDTPPLPRMSMKPR-----R  55

Query  193  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  372
             L+GH  KVY+L W  +K  IVSASQDG+LIVW+A T+ K HAI L  +WVMTCA++P+G
Sbjct  56   TLKGHLAKVYALHWAADKRHIVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYAPSG  115

Query  373  QSVACGGLDSVCSIFNLNLP-PDNDGNST----VSRTLSGHKGYVSACQYVPNEDAHLIT  537
              VACGGLD++CSI++L    P     +T    V+R LS H GY+S C+++   D  +IT
Sbjct  116  NFVACGGLDNICSIYSLRGSGPGGQAAATGQVKVARELSAHSGYLSCCRFI--NDRQIIT  173

Query  538  SSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            +SGD TC LWD+  G+RT  F     + HT DV
Sbjct  174  ASGDMTCMLWDVEQGVRTMEF-----NDHTGDV  201



>ref|XP_006183833.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
[Camelus ferus]
 ref|XP_006210677.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
[Vicugna pacos]
 ref|XP_010946113.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X1 [Camelus bactrianus]
 ref|XP_010974553.1| PREDICTED: guanine nucleotide-binding protein subunit beta-4 
isoform X1 [Camelus dromedarius]
Length=340

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 109/159 (69%), Gaps = 10/159 (6%)
 Frame = +1

Query  160  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA  339
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct  39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS  98

Query  340  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE  519
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct  99   WVMTCAYAPSGNYVACGGLDNICSIYNL---KTREGNVRVSRELPGHTGYLSCCRFL--D  153

Query  520  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            D+ ++TSSGD TC LWDI T  +T++F     +GH+ DV
Sbjct  154  DSQIVTSSGDTTCALWDIETAQQTTIF-----TGHSGDV  187



>ref|XP_005927503.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X1 [Haplochromis burtoni]
 ref|XP_005927504.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-1-like isoform X2 [Haplochromis burtoni]
Length=340

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            + L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   QTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ F     +GHT DV
Sbjct  164  TTCALWDIETGQQTTTF-----AGHTGDV  187



>gb|KEZ45296.1| hypothetical protein SAPIO_CDS2093 [Scedosporium apiospermum]
Length=359

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 133/212 (63%), Gaps = 11/212 (5%)
 Frame = +1

Query  1    EGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  180
            +G   +S   ++ R   A +   +L++R+K K+  L DT + + A+ Q   PIS     +
Sbjct  4    QGPNDVSPEAMQARIQQARREAENLKDRIKRKKDELADTTLRSVAQ-QAHEPISKNQM-M  61

Query  181  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  360
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  361  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  540
            SP+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  +ITS
Sbjct  122  SPSGNYVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSIITS  177

Query  541  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADV  636
            SGD TC  WDI TG +   F     + H  DV
Sbjct  178  SGDMTCIQWDIETGQKVIDF-----TDHLGDV  204



>ref|XP_005802948.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-2-like [Xiphophorus maculatus]
 ref|XP_007563220.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-2-like [Poecilia formosa]
Length=340

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKIHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+ L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct  109  GNYVACGGLDNICSIYCLKT---REGNVRVSRELPGHTGYLSCCRFI--DDNQIITSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI T  +T+VF     SGHT DV
Sbjct  164  TTCALWDIETSQQTTVF-----SGHTGDV  187


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (49%), Gaps = 9/137 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L GHTG +    +  + N+I+++S D    +W+  TSQ+T         VM+ + SP 
Sbjct  137  RELPGHTGYLSCCRFI-DDNQIITSSGDTTCALWDIETSQQTTVFSGHTGDVMSLSLSPD  195

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
             ++   G  D+   ++++        +S   +T +GH+  ++A  + PN  A   T S D
Sbjct  196  LRTFVSGACDASAKLWDIR-------DSMCRQTFTGHESDINASCFFPNGSA-FATGSDD  247

Query  550  KTCGLWDITTGLRTSVF  600
             TC L+D+      S++
Sbjct  248  ATCRLFDLRADQELSIY  264



>gb|KIL01011.1| hypothetical protein PAXRUDRAFT_7786 [Paxillus rubicundulus Ve08.2h10]
Length=349

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 123/204 (60%), Gaps = 15/204 (7%)
 Frame = +1

Query  28   ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  204
            +++ER  AA +   SL+E+++  R    DT +   A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAESLKEKIRASREASADTSLRAMAAEVDTLPRIVMRPR-----RALKG  61

Query  205  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  384
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  62   HLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNFVA  121

Query  385  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL  564
            CGGLD++CSI+NLN    N      +R LS H GY+S C+++   D  ++TSSGD TC L
Sbjct  122  CGGLDNICSIYNLNSREANGVRG--ARELSAHSGYLSCCRFI--NDRQIVTSSGDMTCML  177

Query  565  WDITTGLRTSVFGGEYQSGHTADV  636
            WDI  G+R   F     S HT DV
Sbjct  178  WDIEAGVRVVEF-----SDHTGDV  196



>ref|XP_006132712.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-2 isoform X1 [Pelodiscus sinensis]
Length=337

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  46   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS  105

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct  106  GNYVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFL--DDNQIITSSGD  160

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T+ FG     GH+ DV
Sbjct  161  TTCALWDIETGQQTTTFG-----GHSGDV  184



>ref|XP_002075419.1| GK15234 [Drosophila willistoni]
 gb|EDW86405.1| GK15234 [Drosophila willistoni]
Length=340

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 105/149 (70%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct  109  GSYVACGGLDNMCSIYNL---KTREGNVRVSRELPGHGGYLSCCRFL--DDNQIVTSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             +CGLWDI TGL+ + F      GHT DV
Sbjct  164  MSCGLWDIETGLQVTSF-----LGHTGDV  187



>ref|NP_001013515.1| guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 
[Danio rerio]
 gb|AAH91666.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2 [Danio rerio]
 gb|AAI64377.1| Gnb2 protein [Danio rerio]
Length=340

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKIHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct  109  GNFVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFI--DDNQIITSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T++F     SGH+ DV
Sbjct  164  TTCALWDIETGQQTTLF-----SGHSGDV  187



>ref|XP_007786191.1| Guanine nucleotide-binding protein subunit beta [Endocarpon pusillum 
Z07020]
 gb|ERF76491.1| Guanine nucleotide-binding protein subunit beta [Endocarpon pusillum 
Z07020]
Length=353

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 133/209 (64%), Gaps = 17/209 (8%)
 Frame = +1

Query  16   MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARS--QGKTPISFGPTDLVCC  189
            +S  +++ R  AA +    L++R+K K+  L DT ++  A S  +    I   P      
Sbjct  5    LSGEQMQARIQAARREAEGLKDRIKRKKDELADTSLSQVAHSSTEALPRIGMKPR-----  59

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct  120  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHAGYLSCCRFI--NDRKILTSSGD  174

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC +WDI TG + + F     + H  DV
Sbjct  175  MTCMMWDIETGSKVTEF-----ADHLGDV  198



>ref|XP_005165361.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-2 isoform X1 [Danio rerio]
Length=344

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct  49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKIHAIPLRSSWVMTCAYAPS  108

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct  109  GNFVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFI--DDNQIITSSGD  163

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG +T++F     SGH+ DV
Sbjct  164  TTCALWDIETGQQTTLF-----SGHSGDV  187



>gb|KIW40198.1| guanine nucleotide-binding protein subunit beta [Exophiala oligosperma]
Length=353

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 10/149 (7%)
 Frame = +1

Query  190  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  369
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  370  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD  549
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSSGD
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSSGD  174

Query  550  KTCGLWDITTGLRTSVFGGEYQSGHTADV  636
             TC LWDI TG + + F     + H  DV
Sbjct  175  MTCMLWDIETGSKVTEF-----ADHLGDV  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060