BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039G18

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002311190.1|  cytokinesis defective 1 family protein             301   8e-98   Populus trichocarpa [western balsam poplar]
ref|XP_004240924.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    301   1e-97   Solanum lycopersicum
ref|XP_011076786.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    300   1e-97   Sesamum indicum [beniseed]
ref|XP_009592609.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    300   2e-97   Nicotiana tomentosiformis
ref|XP_007218178.1|  hypothetical protein PRUPE_ppa007618mg             300   3e-97   Prunus persica
ref|XP_006338820.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    300   3e-97   Solanum tuberosum [potatoes]
gb|KDO35843.1|  hypothetical protein CISIN_1g046608mg                   295   3e-97   Citrus sinensis [apfelsine]
ref|XP_011035050.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    299   4e-97   Populus euphratica
ref|XP_006435610.1|  hypothetical protein CICLE_v10033733mg             299   4e-97   Citrus clementina [clementine]
gb|KDO69184.1|  hypothetical protein CISIN_1g018060mg                   299   4e-97   Citrus sinensis [apfelsine]
gb|ADV59923.1|  putative GDP-mannose pyrophosphorylase                  299   4e-97   Citrus unshiu [satsuma mandarin]
ref|XP_009594230.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    298   6e-97   Nicotiana tomentosiformis
gb|KJB74050.1|  hypothetical protein B456_011G269100                    298   8e-97   Gossypium raimondii
emb|CBI31615.3|  unnamed protein product                                295   9e-97   Vitis vinifera
ref|NP_001234025.1|  GDP-mannose pyrophosphorylase                      298   1e-96   Solanum lycopersicum
ref|NP_001275205.1|  GDP-mannose pyrophosphorylase                      298   1e-96   Solanum tuberosum [potatoes]
ref|XP_006486418.1|  PREDICTED: probable mannose-1-phosphate guan...    298   1e-96   Citrus sinensis [apfelsine]
gb|ACN38266.1|  GDP-D-mannose pyrophosphorylase                         297   2e-96   Actinidia latifolia
ref|XP_009759296.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    296   4e-96   Nicotiana sylvestris
ref|XP_011036070.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    296   4e-96   Populus euphratica
ref|XP_008371997.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    296   6e-96   Malus domestica [apple tree]
ref|NP_001276240.1|  mannose-1-phosphate guanylyltransferase 1-like     296   7e-96   Glycine max [soybeans]
ref|XP_003544186.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    296   8e-96   
ref|XP_004307574.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    295   1e-95   Fragaria vesca subsp. vesca
ref|NP_001276259.1|  mannose-1-phosphate guanylyltransferase 1-like     295   1e-95   
gb|AGI78460.1|  GDP-D-mannose pyrophosphorylase                         295   1e-95   Camellia sinensis [black tea]
gb|KHN13115.1|  Mannose-1-phosphate guanylyltransferase 1               295   1e-95   Glycine soja [wild soybean]
gb|ABI48955.1|  GDP-D-mannose pyrophosphorylase                         295   2e-95   Viola baoshanensis
ref|XP_010095035.1|  Mannose-1-phosphate guanylyltransferase 1          295   2e-95   Morus notabilis
gb|ABB53473.1|  GDP-mannose pyrophosphorylase                           295   2e-95   Malpighia glabra [acerola]
ref|XP_009797660.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    295   2e-95   Nicotiana sylvestris
gb|AIN40499.1|  GDP-D-mannose pyrophosphorylase                         295   2e-95   Ziziphus jujuba [Chinese jujube]
dbj|BAB62108.1|  GDP-D-mannose pyrophosphorylase                        295   2e-95   Nicotiana tabacum [American tobacco]
ref|NP_001234084.1|  GDP-mannose pyrophosphorylase                      295   2e-95   
ref|XP_009343927.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    294   3e-95   Pyrus x bretschneideri [bai li]
ref|XP_007141846.1|  hypothetical protein PHAVU_008G230600g             294   3e-95   Phaseolus vulgaris [French bean]
ref|XP_002282422.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    294   3e-95   Vitis vinifera
ref|XP_002316262.1|  cytokinesis defective 1 family protein             294   3e-95   Populus trichocarpa [western balsam poplar]
ref|XP_006429173.1|  hypothetical protein CICLE_v10012040mg             293   6e-95   
ref|XP_008441398.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    293   6e-95   Cucumis melo [Oriental melon]
ref|XP_002524227.1|  mannose-1-phosphate guanyltransferase, putative    293   6e-95   Ricinus communis
ref|XP_010088589.1|  Mannose-1-phosphate guanylyltransferase 1          293   7e-95   Morus notabilis
ref|XP_010256792.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    293   8e-95   Nelumbo nucifera [Indian lotus]
ref|XP_007009211.1|  Glucose-1-phosphate adenylyltransferase fami...    293   9e-95   Theobroma cacao [chocolate]
ref|XP_004490906.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    293   1e-94   Cicer arietinum [garbanzo]
ref|XP_006601845.1|  PREDICTED: uncharacterized protein LOC100818...    293   1e-94   
ref|XP_011085013.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    292   1e-94   Sesamum indicum [beniseed]
gb|KDP44883.1|  hypothetical protein JCGZ_01383                         293   1e-94   Jatropha curcas
ref|XP_007026922.1|  Glucose-1-phosphate adenylyltransferase fami...    292   2e-94   
ref|NP_181507.1|  GDP-mannose pyrophosphorylase/ mannose-1-pyroph...    292   2e-94   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19947.1|  hypothetical protein MIMGU_mgv1a008833mg                292   2e-94   Erythranthe guttata [common monkey flower]
ref|XP_002879816.1|  hypothetical protein ARALYDRAFT_483004             292   2e-94   
ref|XP_010505663.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    292   2e-94   Camelina sativa [gold-of-pleasure]
ref|XP_003616475.1|  Mannose-1-phosphate guanyltransferase              291   3e-94   Medicago truncatula
ref|XP_006493574.1|  PREDICTED: probable mannose-1-phosphate guan...    291   3e-94   Citrus sinensis [apfelsine]
ref|XP_006294448.1|  hypothetical protein CARUB_v10023461mg             292   3e-94   
gb|ACW84415.1|  GDP-D-mannose pyrophosphorylase                         291   4e-94   Glycine max [soybeans]
ref|NP_001240188.1|  mannose-1-phosphate guanylyltransferase 1-like     291   4e-94   Glycine max [soybeans]
gb|KHN17882.1|  Mannose-1-phosphate guanylyltransferase 1               291   4e-94   Glycine soja [wild soybean]
emb|CAC35355.1|  GDP-mannose pyrophosphorylase                          291   8e-94   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001242262.1|  uncharacterized protein LOC100818016               291   8e-94   
emb|CDY07636.1|  BnaA03g18750D                                          292   8e-94   Brassica napus [oilseed rape]
ref|XP_010691388.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    290   1e-93   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010262630.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    290   1e-93   Nelumbo nucifera [Indian lotus]
ref|XP_002308180.1|  hypothetical protein POPTR_0006s09130g             290   1e-93   Populus trichocarpa [western balsam poplar]
ref|XP_010067451.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    290   1e-93   Eucalyptus grandis [rose gum]
ref|XP_006411211.1|  hypothetical protein EUTSA_v10016850mg             290   1e-93   Eutrema salsugineum [saltwater cress]
ref|XP_003600761.1|  Mannose-1-phosphate guanyltransferase              290   1e-93   
gb|KJB76777.1|  hypothetical protein B456_012G106900                    290   2e-93   Gossypium raimondii
gb|KHG16049.1|  Mannose-1-phosphate guanyltransferase                   290   2e-93   Gossypium arboreum [tree cotton]
ref|XP_009141836.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    289   3e-93   Brassica rapa
emb|CDP16056.1|  unnamed protein product                                289   3e-93   Coffea canephora [robusta coffee]
emb|CDY07033.1|  BnaA04g22820D                                          289   3e-93   
ref|XP_010529799.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    289   3e-93   Tarenaya hassleriana [spider flower]
ref|XP_011016812.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    288   4e-93   Populus euphratica
emb|CDP00140.1|  unnamed protein product                                289   4e-93   Coffea canephora [robusta coffee]
ref|XP_007009213.1|  Glucose-1-phosphate adenylyltransferase fami...    288   6e-93   
emb|CDX93234.1|  BnaC04g46620D                                          288   6e-93   
ref|XP_009133383.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    288   6e-93   Brassica rapa
ref|XP_007009215.1|  Glucose-1-phosphate adenylyltransferase fami...    288   6e-93   
gb|KDO69185.1|  hypothetical protein CISIN_1g018060mg                   288   7e-93   Citrus sinensis [apfelsine]
ref|XP_004138454.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    288   9e-93   Cucumis sativus [cucumbers]
ref|XP_007026924.1|  Glucose-1-phosphate adenylyltransferase fami...    288   1e-92   
ref|XP_008785513.1|  PREDICTED: probable mannose-1-phosphate guan...    287   2e-92   
ref|XP_010923222.1|  PREDICTED: probable mannose-1-phosphate guan...    286   3e-92   Elaeis guineensis
gb|KDO48143.1|  hypothetical protein CISIN_1g0201131mg                  283   4e-92   Citrus sinensis [apfelsine]
ref|XP_002310933.1|  cytokinesis defective 1 family protein             286   4e-92   Populus trichocarpa [western balsam poplar]
gb|ACK87007.1|  GDP-mannose pyrophosphorylase                           286   5e-92   Carica papaya [mamon]
ref|XP_010931208.1|  PREDICTED: probable mannose-1-phosphate guan...    286   7e-92   Elaeis guineensis
ref|XP_006340997.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    286   7e-92   Solanum tuberosum [potatoes]
ref|XP_008777609.1|  PREDICTED: probable mannose-1-phosphate guan...    285   9e-92   Phoenix dactylifera
gb|EPS66224.1|  hypothetical protein M569_08552                         285   9e-92   Genlisea aurea
gb|ACN66754.1|  GMP                                                     285   2e-91   Carica papaya [mamon]
ref|XP_008803133.1|  PREDICTED: probable mannose-1-phosphate guan...    284   2e-91   Phoenix dactylifera
ref|XP_011033044.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    284   4e-91   Populus euphratica
ref|XP_009601713.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    283   6e-91   Nicotiana tomentosiformis
ref|XP_009143286.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    283   8e-91   Brassica rapa
ref|XP_010937548.1|  PREDICTED: probable mannose-1-phosphate guan...    282   1e-90   Elaeis guineensis
ref|NP_001142215.1|  hypothetical protein                               282   2e-90   Zea mays [maize]
emb|CDX74832.1|  BnaA05g05780D                                          282   2e-90   
ref|XP_004246437.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    282   2e-90   Solanum lycopersicum
ref|XP_009387284.1|  PREDICTED: probable mannose-1-phosphate guan...    282   2e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004984923.1|  PREDICTED: probable mannose-1-phosphate guan...    281   3e-90   Setaria italica
ref|XP_006649823.1|  PREDICTED: probable mannose-1-phosphate guan...    281   6e-90   Oryza brachyantha
gb|AHX59161.1|  GDP-mannose pyrophosphorylase                           275   7e-90   
gb|EAY89395.1|  hypothetical protein OsI_10901                          280   1e-89   Oryza sativa Indica Group [Indian rice]
ref|XP_004970565.1|  PREDICTED: probable mannose-1-phosphate guan...    280   1e-89   Setaria italica
ref|XP_003558261.1|  PREDICTED: probable mannose-1-phosphate guan...    280   1e-89   Brachypodium distachyon [annual false brome]
ref|XP_006846372.1|  hypothetical protein AMTR_s00012p00262630          280   2e-89   Amborella trichopoda
ref|XP_009407514.1|  PREDICTED: probable mannose-1-phosphate guan...    280   2e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049673.1|  Os03g0268400                                       279   2e-89   
ref|NP_001044795.1|  Os01g0847200                                       279   3e-89   
ref|XP_008801635.1|  PREDICTED: probable mannose-1-phosphate guan...    279   3e-89   Phoenix dactylifera
ref|XP_009388596.1|  PREDICTED: probable mannose-1-phosphate guan...    279   3e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT31032.1|  Mannose-1-phosphate guanyltransferase beta              279   3e-89   
emb|CDM85018.1|  unnamed protein product                                279   3e-89   Triticum aestivum [Canadian hard winter wheat]
gb|ABR15468.1|  GDP-mannose pyrophosphorylase                           279   3e-89   Pinus taeda
sp|Q6Z9A3.1|GMPP3_ORYSJ  RecName: Full=Probable mannose-1-phospha...    279   3e-89   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977599.1|  PREDICTED: probable mannose-1-phosphate guan...    278   4e-89   Setaria italica
ref|NP_001142302.1|  uncharacterized protein LOC100274471               278   4e-89   Zea mays [maize]
ref|XP_003564604.1|  PREDICTED: probable mannose-1-phosphate guan...    278   6e-89   Brachypodium distachyon [annual false brome]
gb|ABR17757.1|  unknown                                                 278   6e-89   Picea sitchensis
gb|AFL69832.1|  mannose-1-phosphate guanyltransferase 3                 278   8e-89   Oryza sativa Indica Group [Indian rice]
ref|XP_006645004.1|  PREDICTED: probable mannose-1-phosphate guan...    278   8e-89   Oryza brachyantha
gb|AFL69830.1|  mannose-1-phosphate guanyltransferase 1                 278   1e-88   Oryza sativa Indica Group [Indian rice]
gb|AFL69833.1|  mannose-1-phosphate guanyltransferase 4                 278   1e-88   Oryza sativa Indica Group [Indian rice]
ref|XP_010554624.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    277   2e-88   Tarenaya hassleriana [spider flower]
ref|XP_002456631.1|  hypothetical protein SORBIDRAFT_03g039740          277   2e-88   Sorghum bicolor [broomcorn]
ref|XP_009412560.1|  PREDICTED: probable mannose-1-phosphate guan...    276   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHB17740.1|  GDP-mannose pyrophosphorylase                           276   2e-88   Pogonatherum paniceum
ref|XP_006846369.1|  hypothetical protein AMTR_s00012p00262290          276   3e-88   Amborella trichopoda
dbj|BAJ95730.1|  predicted protein                                      276   4e-88   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010534527.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    276   4e-88   Tarenaya hassleriana [spider flower]
ref|XP_008674826.1|  PREDICTED: probable mannose-1-phosphate guan...    276   5e-88   
gb|ABK24420.1|  unknown                                                 275   1e-87   Picea sitchensis
ref|XP_001782193.1|  predicted protein                                  275   1e-87   
gb|AHX74219.1|  GDP-mannose pyrophosphorylase                           274   2e-87   
ref|XP_001769404.1|  predicted protein                                  273   3e-87   
gb|ABR15469.1|  GDP-mannose pyrophosphorylase                           273   8e-87   Pinus taeda
gb|ABK24789.1|  unknown                                                 272   1e-86   Picea sitchensis
ref|XP_009791580.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    271   3e-86   Nicotiana sylvestris
ref|XP_002974469.1|  hypothetical protein SELMODRAFT_267755             270   1e-85   Selaginella moellendorffii
ref|XP_002990832.1|  hypothetical protein SELMODRAFT_185648             270   1e-85   Selaginella moellendorffii
ref|XP_008801637.1|  PREDICTED: probable mannose-1-phosphate guan...    268   5e-85   Phoenix dactylifera
gb|AFK47417.1|  unknown                                                 267   1e-84   Lotus japonicus
ref|XP_007163469.1|  hypothetical protein PHAVU_001G236800g             259   2e-84   Phaseolus vulgaris [French bean]
ref|XP_002966693.1|  hypothetical protein SELMODRAFT_168373             266   3e-84   Selaginella moellendorffii
emb|CDY20480.1|  BnaC04g05640D                                          264   1e-83   Brassica napus [oilseed rape]
gb|KFK29636.1|  hypothetical protein AALP_AA7G159400                    263   2e-82   Arabis alpina [alpine rockcress]
emb|CDX90770.1|  BnaA03g24500D                                          261   3e-82   
ref|NP_191118.1|  probable mannose-1-phosphate guanylyltransferase 2    259   9e-82   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72252.1|  BnaC07g42740D                                          259   2e-81   
ref|XP_010432971.1|  PREDICTED: probable mannose-1-phosphate guan...    258   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009134205.1|  PREDICTED: probable mannose-1-phosphate guan...    258   4e-81   Brassica rapa
ref|XP_010412788.1|  PREDICTED: probable mannose-1-phosphate guan...    258   5e-81   Camelina sativa [gold-of-pleasure]
emb|CDY39219.1|  BnaA03g50310D                                          257   6e-81   Brassica napus [oilseed rape]
ref|XP_009137936.1|  PREDICTED: probable mannose-1-phosphate guan...    256   2e-80   Brassica rapa
gb|EMT15706.1|  Mannose-1-phosphate guanyltransferase beta              254   2e-80   
ref|XP_010438164.1|  PREDICTED: probable mannose-1-phosphate guan...    255   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010941227.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    254   1e-79   Elaeis guineensis
emb|CDY39215.1|  BnaA03g50270D                                          253   1e-79   Brassica napus [oilseed rape]
emb|CAB79775.1|  GDP-mannose pyrophosphorylase like protein             254   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799379.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    253   3e-79   Phoenix dactylifera
dbj|BAP75927.1|  GDP-mannose pyrophosphorylase                          252   6e-79   Moringa oleifera [maranga]
ref|XP_010438160.1|  PREDICTED: probable mannose-1-phosphate guan...    252   6e-79   Camelina sativa [gold-of-pleasure]
gb|EMS68890.1|  Mannose-1-phosphate guanyltransferase beta              253   1e-78   Triticum urartu
ref|XP_010427339.1|  PREDICTED: probable mannose-1-phosphate guan...    251   2e-78   
ref|XP_010275250.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    249   1e-77   Nelumbo nucifera [Indian lotus]
ref|XP_006412681.1|  hypothetical protein EUTSA_v10025578mg             247   6e-77   Eutrema salsugineum [saltwater cress]
ref|XP_002952855.1|  hypothetical protein VOLCADRAFT_81984              246   2e-76   Volvox carteri f. nagariensis
gb|ACN88684.2|  GDP-D-mannose pyrophosphorylase                         244   4e-76   Malus domestica [apple tree]
ref|XP_001695916.1|  GDP-D-mannose pyrophosphorylase                    244   1e-75   Chlamydomonas reinhardtii
gb|KDP38962.1|  hypothetical protein JCGZ_00719                         243   1e-75   Jatropha curcas
emb|CDY05114.1|  BnaC03g29120D                                          236   6e-74   
ref|XP_003610574.1|  Mannose-1-phosphate guanyltransferase              238   2e-73   
emb|CDX90771.1|  BnaA03g24510D                                          237   5e-73   
gb|AGO64472.1|  GDP-D-mannose pyrophosphorylase                         229   3e-72   Rosa roxburghii [chestnut rose]
ref|XP_005652260.1|  GDP-D-mannose pyrophosphorylase                    233   2e-71   Coccomyxa subellipsoidea C-169
ref|XP_004368238.1|  GDPmannose pyrophosphorylase                       231   1e-70   Acanthamoeba castellanii str. Neff
gb|AET14212.1|  GDP-D-mannose pyrophosphorylase                         229   3e-70   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_005851739.1|  hypothetical protein CHLNCDRAFT_133102             228   3e-69   Chlorella variabilis
ref|XP_011399603.1|  Mannose-1-phosphate guanyltransferase              227   6e-69   Auxenochlorella protothecoides
gb|AGC69739.1|  mannose-1-phosphate guanylyltransferase                 226   9e-69   Tieghemostelium lacteum
ref|XP_003287195.1|  mannose-1-phosphate guanylyltransferase            225   3e-68   Dictyostelium purpureum
ref|XP_637125.1|  mannose-1-phosphate guanylyltransferase               224   5e-68   Dictyostelium discoideum AX4
ref|XP_009537794.1|  hypothetical protein PHYSODRAFT_319613             224   5e-68   Phytophthora sojae
ref|XP_010432972.1|  PREDICTED: probable mannose-1-phosphate guan...    223   1e-67   
ref|XP_006408596.1|  hypothetical protein EUTSA_v10002042mg             222   1e-67   
dbj|BAN16547.1|  ADB2008858                                             222   6e-67   Acytostelium subglobosum
ref|XP_008903956.1|  hypothetical protein PPTG_09918                    221   7e-67   Phytophthora parasitica INRA-310
ref|XP_002899327.1|  mannose-1-phosphate guanyltransferase beta, ...    221   1e-66   Phytophthora infestans T30-4
emb|CCA19060.1|  mannose1phosphate guanyltransferase beta putative      220   2e-66   Albugo laibachii Nc14
ref|XP_011019240.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    219   2e-66   Populus euphratica
emb|CEJ05128.1|  Putative Mannose-1-phosphate guanyltransferase         217   3e-66   Rhizopus microsporus
ref|XP_007790760.1|  putative mannose-1-phosphate guanyltransfera...    213   3e-66   
ref|XP_002174350.1|  mannose-1-phosphate guanyltransferase Mpg1         219   3e-66   Schizosaccharomyces japonicus yFS275
ref|XP_004353971.1|  mannose-1-phosphate guanylyltransferase            219   4e-66   Cavenderia fasciculata
ref|XP_004347896.1|  mannose-1-phosphate guanyltransferase beta         219   6e-66   Capsaspora owczarzaki ATCC 30864
gb|EPY51214.1|  mannose-1-phosphate guanyltransferase Mpg1              219   7e-66   Schizosaccharomyces cryophilus OY26
gb|EFA80657.1|  mannose-1-phosphate guanylyltransferase                 218   1e-65   Heterostelium album PN500
ref|XP_006284084.1|  hypothetical protein CARUB_v10005214mg             218   1e-65   
ref|NP_194786.1|  Glucose-1-phosphate adenylyltransferase family ...    217   1e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CEG73578.1|  Putative Mannose-1-phosphate guanyltransferase         218   2e-65   Rhizopus microsporus
gb|EGA87676.1|  Psa1p                                                   214   2e-65   Saccharomyces cerevisiae VL3
gb|EGA75738.1|  Psa1p                                                   214   2e-65   Saccharomyces cerevisiae AWRI796
gb|EGA59462.1|  Psa1p                                                   214   2e-65   Saccharomyces cerevisiae FostersB
ref|XP_005706305.1|  mannose-1-phosphate guanylyltransferase            217   3e-65   Galdieria sulphuraria
emb|CEI86119.1|  Putative Mannose-1-phosphate guanyltransferase         218   3e-65   Rhizopus microsporus
ref|XP_447012.1|  hypothetical protein                                  217   3e-65   [Candida] glabrata
dbj|GAM18590.1|  hypothetical protein SAMD00019534_017650               217   4e-65   Acytostelium subglobosum LB1
dbj|BAO41930.1|  mannose-1-phosphate guanyltransferase                  217   4e-65   Kluyveromyces marxianus DMKU3-1042
gb|EJU01665.1|  mannose-1-phosphate guanylyltransferase                 217   5e-65   Dacryopinax primogenitus
gb|EIE84524.1|  mannose-1-phosphate guanyltransferase                   216   5e-65   Rhizopus delemar RA 99-880
dbj|BAA13790.1|  unnamed protein product                                216   5e-65   Schizosaccharomyces pombe
gb|EIE79690.1|  mannose-1-phosphate guanyltransferase                   216   6e-65   Rhizopus delemar RA 99-880
ref|NP_588405.1|  mannose-1-phosphate guanyltransferase Mpg1            216   6e-65   
emb|CDR44464.1|  CYFA0S14e02960g1_1                                     216   6e-65   Cyberlindnera fabianii
emb|CCX14363.1|  Similar to Mannose-1-phosphate guanyltransferase...    216   6e-65   Pyronema omphalodes CBS 100304
ref|XP_001642832.1|  hypothetical protein Kpol_414p7                    216   7e-65   Vanderwaltozyma polyspora DSM 70294
gb|KIV83904.1|  mannose-1-phosphate guanyltransferase                   216   8e-65   Exophiala sideris
ref|NP_010228.1|  mannose-1-phosphate guanylyltransferase               216   1e-64   Saccharomyces cerevisiae S288C
ref|XP_006682149.1|  hypothetical protein BATDEDRAFT_20856              216   1e-64   Batrachochytrium dendrobatidis JAM81
gb|EPX73569.1|  mannose-1-phosphate guanyltransferase Mpg1              216   1e-64   Schizosaccharomyces octosporus yFS286
ref|XP_011102864.1|  psa1p                                              215   1e-64   
ref|XP_011273620.1|  Mannose-1-phosphate guanyltransferase              215   2e-64   Wickerhamomyces ciferrii
ref|XP_009650791.1|  mannose-1-phosphate guanyltransferase              215   2e-64   Verticillium dahliae VdLs.17
gb|KIW41620.1|  mannose-1-phosphate guanyltransferase, variant          215   2e-64   Exophiala oligosperma
emb|CEP07577.1|  hypothetical protein                                   215   2e-64   Parasitella parasitica
emb|CDH17206.1|  Mannose-1-phosphate guanyltransferase                  214   3e-64   Zygosaccharomyces bailii ISA1307
gb|EIE85443.1|  mannose-1-phosphate guanyltransferase                   214   3e-64   Rhizopus delemar RA 99-880
gb|KIW14322.1|  mannose-1-phosphate guanyltransferase                   214   3e-64   Exophiala spinifera
ref|XP_002151296.1|  mannose-1-phosphate guanylyltransferase            214   3e-64   Talaromyces marneffei ATCC 18224
emb|CDF91365.1|  ZYBA0S11-01222g1_1                                     214   3e-64   Zygosaccharomyces bailii CLIB 213
ref|XP_002670915.1|  predicted protein                                  215   4e-64   Naegleria gruberi strain NEG-M
gb|KFY75477.1|  hypothetical protein V499_04519                         214   4e-64   Pseudogymnoascus sp. VKM F-103
gb|KFY61094.1|  hypothetical protein V496_05148                         214   4e-64   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ELR08715.1|  mannose-1-phosphate guanyltransferase                   214   4e-64   Pseudogymnoascus destructans 20631-21
emb|CEI86118.1|  Putative Mannose-1-phosphate guanyltransferase         216   4e-64   Rhizopus microsporus
gb|AAA69677.1|  mannose-1-phosphate guanyltransferase                   214   5e-64   Saccharomyces cerevisiae [brewer's yeast]
gb|KFY85514.1|  hypothetical protein V500_08352                         214   5e-64   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFX86865.1|  hypothetical protein V490_08766                         214   5e-64   Pseudogymnoascus sp. VKM F-3557
ref|NP_986146.1|  AFR599Wp                                              214   5e-64   Eremothecium gossypii ATCC 10895
ref|XP_001247805.1|  hypothetical protein CIMG_01576                    214   5e-64   Coccidioides immitis RS
gb|KJB76118.1|  hypothetical protein B456_012G072800                    213   6e-64   Gossypium raimondii
ref|XP_003714211.1|  mannose-1-phosphate guanyltransferase              214   6e-64   Magnaporthe oryzae 70-15
ref|XP_002374260.1|  mannose-1-phosphate guanylyltransferase            214   7e-64   Aspergillus flavus NRRL3357
emb|CCK70177.1|  hypothetical protein KNAG_0D04310                      214   7e-64   Kazachstania naganishii CBS 8797
gb|AGO10911.1|  AaceriAFR599Wp                                          214   7e-64   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_003065665.1|  mannose-1-phosphate guanyltransferase, putative    214   7e-64   Coccidioides posadasii C735 delta SOWgp
gb|KFA61058.1|  hypothetical protein S40285_06340                       214   8e-64   Stachybotrys chlorohalonata IBT 40285
ref|XP_001401863.1|  mannose-1-phosphate guanyltransferase              214   8e-64   Aspergillus niger CBS 513.88
gb|KFY30807.1|  hypothetical protein V494_08049                         214   8e-64   Pseudogymnoascus sp. VKM F-4513 (FW-928)
emb|CEP10265.1|  hypothetical protein                                   213   8e-64   Parasitella parasitica
dbj|GAD97068.1|  mannose-1-phosphate guanyltransferase, putative        213   8e-64   Byssochlamys spectabilis No. 5
ref|XP_009154013.1|  mannose-1-phosphate guanyltransferase              214   9e-64   Exophiala dermatitidis NIH/UT8656
dbj|GAN07474.1|  conserved hypothetical protein                         213   9e-64   Mucor ambiguus
emb|CCI41880.1|  unnamed protein product                                224   9e-64   Albugo candida
gb|EPB86770.1|  mannose-1-phosphate guanyltransferase                   213   9e-64   Mucor circinelloides f. circinelloides 1006PhL
gb|KIW58406.1|  mannose-1-phosphate guanyltransferase                   213   9e-64   Exophiala xenobiotica
dbj|GAM82195.1|  hypothetical protein ANO11243_001740                   213   9e-64   fungal sp. No.11243
emb|CDH48439.1|  mannose-1-phosphate guanyltransferase                  213   1e-63   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002495260.1|  ZYRO0B07150p                                       213   1e-63   Zygosaccharomyces rouxii
emb|CDS03573.1|  Putative Mannose-1-phosphate guanyltransferase         213   1e-63   Lichtheimia ramosa
ref|XP_454190.1|  hypothetical protein                                  213   1e-63   Kluyveromyces lactis
gb|EHN03270.1|  Psa1p                                                   213   1e-63   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EPB82783.1|  mannose-1-phosphate guanyltransferase                   213   1e-63   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN08793.1|  conserved hypothetical protein                         213   1e-63   Mucor ambiguus
gb|KFY19685.1|  hypothetical protein V491_04283                         213   1e-63   Pseudogymnoascus sp. VKM F-3775
dbj|GAM41645.1|  mannose-1-phosphate guanyltransferase                  213   2e-63   Talaromyces cellulolyticus
gb|KFH62576.1|  mannose-1-phosphate guanyltransferase                   213   2e-63   Mortierella verticillata NRRL 6337
gb|KFY24564.1|  hypothetical protein V493_05165                         213   2e-63   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_445459.1|  hypothetical protein                                  213   2e-63   [Candida] glabrata
ref|XP_007784388.1|  mannose-1-phosphate guanyltransferase              213   2e-63   Coniosporium apollinis CBS 100218
ref|XP_009216053.1|  mannose-1-phosphate guanyltransferase              213   2e-63   Gaeumannomyces tritici R3-111a-1
emb|CCG83440.1|  Mannose-1-phosphate guanylyltransferase                213   2e-63   Taphrina deformans PYCC 5710
ref|XP_003681594.1|  hypothetical protein TDEL_0E01400                  212   2e-63   Torulaspora delbrueckii
gb|KFH70136.1|  mannose-1-phosphate guanyltransferase                   213   2e-63   Mortierella verticillata NRRL 6337
ref|XP_005279714.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    211   2e-63   Chrysemys picta bellii
sp|Q5B1J4.2|MPG1_EMENI  RecName: Full=Mannose-1-phosphate guanylt...    212   2e-63   Aspergillus nidulans FGSC A4
gb|KEY70742.1|  hypothetical protein S7711_03238                        212   2e-63   
ref|XP_002553315.1|  KLTH0D13948p                                       212   3e-63   
gb|KIW41619.1|  mannose-1-phosphate guanyltransferase                   213   3e-63   
ref|XP_002840424.1|  hypothetical protein                               212   3e-63   
gb|EKG18392.1|  hypothetical protein MPH_04393                          212   3e-63   
ref|XP_005279713.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    210   3e-63   
emb|CEP60435.1|  LALA0S01e10814g1_1                                     212   4e-63   
ref|XP_002840397.1|  hypothetical protein                               212   4e-63   
emb|CDO94334.1|  unnamed protein product                                212   4e-63   
ref|XP_006689599.1|  mannose-1-phosphate guanyltransferase              212   4e-63   
ref|XP_007288932.1|  mannose-1-phosphate guanyltransferase              211   5e-63   
gb|EPZ31169.1|  Mannose-1-phosphate guanyltransferase                   211   5e-63   
gb|ERS98065.1|  mannose-1-phosphate guanyltransferase                   211   6e-63   
emb|CDS14169.1|  Putative Mannose-1-phosphate guanyltransferase         211   6e-63   
ref|XP_004203570.1|  Piso0_001182                                       211   6e-63   
ref|XP_003650465.1|  hypothetical protein THITE_2169612                 211   6e-63   
gb|KIW02373.1|  mannose-1-phosphate guanyltransferase                   211   8e-63   
ref|XP_005279711.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    211   9e-63   
gb|EHK44358.1|  putative mannose-1-phosphate guanylyltransferase        211   9e-63   
gb|AGL46676.1|  GDP-mannose pyrophosphorylase                           211   9e-63   
ref|XP_003170792.1|  mannose-1-phosphate guanyltransferase              211   9e-63   
emb|CDM36708.1|  Mannose-1-phosphate guanyltransferase                  211   9e-63   
gb|EMG49043.1|  Mannose-1-phosphate guanyltransferase                   211   1e-62   
ref|XP_005279712.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    211   1e-62   
gb|ESA01850.1|  hypothetical protein GLOINDRAFT_256407                  211   1e-62   
ref|XP_003958483.1|  hypothetical protein KAFR_0G03160                  211   1e-62   
ref|XP_007725958.1|  mannose-1-phosphate guanyltransferase              211   1e-62   
ref|XP_007589492.1|  putative mannose-1-phosphate guanyltransfera...    211   1e-62   
ref|XP_002683492.1|  predicted protein                                  211   1e-62   
gb|KIV97142.1|  mannose-1-phosphate guanyltransferase, variant 3        210   1e-62   
ref|XP_003645297.1|  hypothetical protein Ecym_2782                     210   1e-62   
ref|XP_001946280.2|  PREDICTED: mannose-1-phosphate guanyltransfe...    211   1e-62   
ref|XP_006966629.1|  mannose-1-phosphate guanyltransferase              210   1e-62   
gb|EGU80538.1|  hypothetical protein FOXB_08998                         210   1e-62   
ref|XP_003868406.1|  Srb1 protein                                       210   1e-62   
sp|Q4U3E8.1|MPG1_ASPFU  RecName: Full=Mannose-1-phosphate guanylt...    210   1e-62   
ref|XP_001266878.1|  mannose-1-phosphate guanylyltransferase            211   1e-62   
ref|XP_958811.1|  mannose-1-phosphate guanyltransferase                 210   1e-62   
ref|XP_007416726.1|  hypothetical protein MELLADRAFT_73277              210   1e-62   
gb|KIV97140.1|  mannose-1-phosphate guanyltransferase, variant 1        210   1e-62   
ref|XP_004178122.1|  hypothetical protein TBLA_0A08130                  210   1e-62   
ref|XP_001483241.1|  mannose-1-phosphate guanyltransferase              210   1e-62   
emb|CCE42239.1|  hypothetical protein CPAR2_807880                      210   2e-62   
ref|XP_007804518.1|  Mannose-1-phosphate guanyltransferase              210   2e-62   
ref|XP_009261432.1|  hypothetical protein FPSE_10040                    210   2e-62   
gb|EER39809.1|  mannose-1-phosphate guanyltransferase                   208   2e-62   
ref|XP_001272013.1|  mannose-1-phosphate guanylyltransferase            210   2e-62   
ref|XP_007416573.1|  hypothetical protein MELLADRAFT_112114             209   3e-62   
ref|XP_007915413.1|  putative mannose-1-phosphate guanyltransfera...    209   3e-62   
ref|XP_003853791.1|  hypothetical protein MYCGRDRAFT_108572             209   3e-62   
gb|KIX05331.1|  mannose-1-phosphate guanyltransferase                   210   3e-62   
ref|XP_001637465.1|  predicted protein                                  209   3e-62   
ref|XP_003684339.1|  hypothetical protein TPHA_0B02325                  209   3e-62   
gb|KHJ35688.1|  putative mannose-1-phosphate guanyltransferase          209   3e-62   
ref|XP_007416733.1|  hypothetical protein MELLADRAFT_45596              209   3e-62   
gb|EZF26089.1|  mannose-1-phosphate guanyltransferase                   209   3e-62   
gb|KIL89588.1|  hypothetical protein FAVG1_07168                        209   3e-62   
ref|XP_003684195.1|  hypothetical protein TPHA_0B00890                  209   4e-62   
gb|ESZ99359.1|  mannose-1-phosphate guanyltransferase                   209   4e-62   
gb|ELU15028.1|  hypothetical protein CAPTEDRAFT_154984                  209   4e-62   
emb|CDK29954.1|  unnamed protein product                                209   4e-62   
ref|XP_007674996.1|  hypothetical protein BAUCODRAFT_146867             209   4e-62   
gb|EMD93443.1|  hypothetical protein COCHEDRAFT_1171155                 209   4e-62   
ref|XP_003330316.1|  mannose-1-phosphate guanyltransferase              209   4e-62   
emb|CDS14396.1|  Putative Mannose-1-phosphate guanyltransferase         209   4e-62   
gb|EME45421.1|  hypothetical protein DOTSEDRAFT_52701                   209   5e-62   
gb|EYE92195.1|  mannose-1-phosphate guanyltransferase                   209   5e-62   
sp|Q9Y725.1|MPG11_CANGA  RecName: Full=Mannose-1-phosphate guanyl...    209   5e-62   
gb|EGD99736.1|  mannose-1-phosphate guanyltransferase                   209   5e-62   
gb|EGC43154.1|  mannose-1-phosphate guanylyltransferase                 209   5e-62   
gb|KHO01810.1|  Mannose-1-phosphate guanyltransferase                   209   5e-62   
ref|XP_002118061.1|  hypothetical protein TRIADDRAFT_33563              209   5e-62   
gb|EEH08109.1|  mannose-1-phosphate guanylyltransferase                 209   5e-62   
ref|XP_001227041.1|  hypothetical protein CHGG_09114                    209   5e-62   
gb|KIV97139.1|  mannose-1-phosphate guanyltransferase                   210   5e-62   
ref|XP_003672349.1|  hypothetical protein NDAI_0J02140                  209   6e-62   
gb|EHK24181.1|  mannose-1-phosphate guanyltransferase                   209   6e-62   
emb|CDH56859.1|  mannose-1-phosphate guanyltransferase                  209   6e-62   
ref|XP_001526390.1|  mannose-1-phosphate guanyltransferase              209   6e-62   
gb|KEQ58368.1|  mannose-1-phosphate guanyltransferase                   209   6e-62   
ref|XP_001544505.1|  mannose-1-phosphate guanyltransferase              209   6e-62   
ref|XP_002419678.1|  GDP-mannose pyrophosphorylase, putative; man...    209   6e-62   
ref|XP_007888693.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    208   7e-62   
ref|XP_001387247.1|  Mannose-1-phosphate guanyltransferase (ATP-m...    209   7e-62   
ref|XP_007873665.1|  hypothetical protein PNEG_01701                    208   7e-62   
ref|XP_002844376.1|  mannose-1-phosphate guanyltransferase              208   7e-62   
ref|XP_003350612.1|  hypothetical protein SMAC_07928                    208   7e-62   
ref|XP_009199022.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   8e-62   
gb|KER00901.1|  hypothetical protein AUEXF2481DRAFT_35153               208   8e-62   
ref|XP_710946.1|  GDP-mannose pyrophosphorylase                         208   8e-62   
ref|XP_003843812.1|  similar to mannose-1-phosphate guanyltransfe...    208   8e-62   
ref|XP_007527319.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    208   8e-62   
ref|XP_001598078.1|  hypothetical protein SS1G_00164                    206   9e-62   
ref|XP_007808986.1|  Mannose-1-phosphate guanyltransferase              208   9e-62   
ref|XP_001906060.1|  hypothetical protein                               208   9e-62   
gb|AAC64911.1|  putative GDP-mannose pyrophosphorylase                  208   9e-62   
gb|AAC64912.1|  putative GDP-mannose pyrophosphorylase                  208   1e-61   
ref|XP_010757055.1|  mannose-1-phosphate guanyltransferase              208   1e-61   
emb|CCF45415.1|  mannose-1-phosphate guanyltransferase                  208   1e-61   
ref|XP_006678904.1|  hypothetical protein BATDEDRAFT_16693              208   1e-61   
gb|KEQ68936.1|  mannose-1-phosphate guanyltransferase                   208   1e-61   
ref|XP_009058578.1|  hypothetical protein LOTGIDRAFT_227532             208   1e-61   
ref|XP_004760688.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   1e-61   
gb|KEQ87376.1|  mannose-1-phosphate guanyltransferase                   208   1e-61   
gb|EXX60943.1|  mannose-1-phosphate guanylyltransferase                 207   1e-61   
ref|XP_006892962.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   1e-61   
ref|XP_009022655.1|  hypothetical protein HELRODRAFT_106916             207   1e-61   
ref|XP_002429803.1|  Mannose-1-phosphate guanyltransferase, putative    207   2e-61   
ref|XP_002493105.1|  GDP-mannose pyrophosphorylase (mannose-1-pho...    207   2e-61   
ref|XP_007376666.1|  mannose-1-phosphate guanyltransferase              207   2e-61   
ref|XP_007527318.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    208   2e-61   
ref|XP_002584611.1|  mannose-1-phosphate guanyltransferase              207   2e-61   
gb|EPS33496.1|  hypothetical protein PDE_08458                          207   2e-61   
gb|KGK39965.1|  hypothetical protein JL09_g896                          207   2e-61   
ref|XP_002564636.1|  Pc22g06040                                         207   2e-61   
ref|XP_009089238.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    208   2e-61   
ref|XP_003053081.1|  predicted protein                                  207   2e-61   
ref|XP_006744594.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   2e-61   
gb|EPE08982.1|  mannose-1-phosphate guanyltransferase                   207   2e-61   
ref|XP_007129912.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   2e-61   
ref|XP_005522264.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   2e-61   
ref|XP_009089239.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   2e-61   
ref|NP_001280244.1|  mannose-1-phosphate guanyltransferase beta         207   3e-61   
gb|KGO78487.1|  Nucleotidyl transferase                                 207   3e-61   
gb|KEF55157.1|  mannose-1-phosphate guanyltransferase                   207   3e-61   
gb|EEH40742.2|  mannose-1-phosphate guanyltransferase                   207   3e-61   
gb|KIM96308.1|  hypothetical protein OIDMADRAFT_44510                   207   3e-61   
ref|XP_007446277.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
ref|XP_007129911.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
ref|XP_004615299.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
gb|EDP50516.1|  mannose-1-phosphate guanylyltransferase                 207   3e-61   
ref|XP_003982282.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
ref|XP_005696010.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   3e-61   
ref|XP_004419768.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
ref|XP_003670001.1|  hypothetical protein NDAI_0D04440                  207   3e-61   
ref|XP_004944488.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
ref|XP_005522263.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
ref|XP_007168787.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
ref|XP_004676214.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
ref|XP_004399306.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   3e-61   
gb|EKV04708.1|  Mannose-1-phosphate guanyltransferase                   207   4e-61   
gb|KEY82064.1|  mannose 1 phosphate guanylyltransferase                 207   4e-61   
ref|XP_003448400.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   4e-61   
gb|EWC45282.1|  mannose-1-phosphate guanyltransferase                   206   4e-61   
ref|XP_004944486.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    208   4e-61   
ref|XP_004284004.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   4e-61   
ref|XP_002758401.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   4e-61   
ref|XP_002920584.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   4e-61   
ref|XP_008061359.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   4e-61   
ref|XP_007738522.1|  mannose-1-phosphate guanyltransferase              207   5e-61   
ref|XP_002622272.1|  mannose-1-phosphate guanylyltransferase            206   5e-61   
ref|XP_004018504.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   5e-61   
ref|XP_004996866.1|  GDP-D-mannose pyrophosphorylase                    207   5e-61   
tpg|DAA16917.1|  TPA: mannose-1-phosphate guanyltransferase beta        206   5e-61   
ref|XP_006960781.1|  mannose-1-phosphate guanylyltransferase            206   5e-61   
gb|KGO38018.1|  Nucleotidyl transferase                                 206   5e-61   
ref|XP_007818345.1|  hypothetical protein MAA_02156                     206   5e-61   
ref|XP_005969337.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   6e-61   
gb|EIF49787.1|  gdp-mannose pyrophosphorylase                           206   6e-61   
ref|XP_007925621.1|  hypothetical protein MYCFIDRAFT_88680              206   6e-61   
ref|XP_003673192.1|  hypothetical protein NCAS_0A02430                  206   6e-61   
ref|XP_003727955.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    206   6e-61   
gb|ENH81504.1|  mannose-1-phosphate guanyltransferase                   206   6e-61   
ref|XP_007594195.1|  mannose-1-phosphate guanyltransferase              206   7e-61   
gb|KID78012.1|  Mannose-1-phosphate guanyltransferase                   206   7e-61   
ref|XP_006909163.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   7e-61   
ref|XP_005969336.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   7e-61   
gb|KIE03647.1|  Mannose-1-phosphate guanyltransferase                   206   7e-61   
ref|XP_004368596.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   7e-61   
ref|XP_005669603.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   8e-61   
ref|XP_007953540.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   8e-61   
ref|XP_008497167.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   8e-61   
ref|XP_006783131.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   8e-61   
gb|KID92963.1|  Mannose-1-phosphate guanyltransferase                   206   8e-61   
ref|XP_008153791.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   8e-61   
ref|XP_006171011.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   8e-61   
ref|XP_006053329.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   9e-61   
emb|CCD51420.1|  similar to mannose-1-phosphate guanyltransferase       206   9e-61   
ref|XP_006196371.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   9e-61   
ref|XP_003936705.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   9e-61   
ref|NP_068806.1|  mannose-1-phosphate guanyltransferase beta isof...    206   9e-61   
sp|Q9Y5P6.2|GMPPB_HUMAN  RecName: Full=Mannose-1-phosphate guanyl...    206   1e-60   
ref|XP_004944487.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    207   1e-60   
gb|ETE70877.1|  Mannose-1-phosphate guanyltransferase beta-A            206   1e-60   
ref|NP_001231470.1|  mannose-1-phosphate guanyltransferase beta         205   1e-60   
ref|XP_003894464.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   1e-60   
ref|NP_001252910.1|  mannose-1-phosphate guanyltransferase beta         205   1e-60   
ref|XP_010967477.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   1e-60   
ref|XP_003639816.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   1e-60   
ref|XP_004581526.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   1e-60   
sp|P0C5I2.1|GMPPB_PIG  RecName: Full=Mannose-1-phosphate guanyltr...    205   1e-60   
ref|XP_006694627.1|  hypothetical protein CTHT_0042260                  205   1e-60   
ref|XP_004664300.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   1e-60   
ref|XP_004903552.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   1e-60   
ref|XP_501519.1|  YALI0C06490p                                          205   1e-60   
gb|ETN74521.1|  mannose-1-phosphate guanylyltransferase                 205   1e-60   
ref|XP_005326986.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   1e-60   
gb|KIX96214.1|  mannose-1-phosphate guanyltransferase                   205   1e-60   
gb|EFX03295.1|  mannose-1-phosphate guanylyltransferase                 205   1e-60   
sp|Q9P8N0.1|MPG1_PICAN  RecName: Full=Mannose-1-phosphate guanylt...    205   1e-60   
ref|XP_011385554.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    206   1e-60   
gb|ESW95927.1|  Mannose-1-phosphate guanyltransferase                   205   1e-60   
ref|XP_003678452.1|  hypothetical protein NCAS_0J01350                  205   1e-60   
ref|XP_003800644.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   1e-60   
ref|XP_008970505.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   1e-60   
ref|XP_751679.1|  mannose-1-phosphate guanylyltransferase               207   1e-60   
ref|XP_005326985.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   1e-60   
ref|XP_004664299.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   1e-60   
gb|KIW74238.1|  mannose-1-phosphate guanyltransferase                   205   2e-60   
ref|XP_005696009.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   2e-60   
gb|EAW65012.1|  GDP-mannose pyrophosphorylase B, isoform CRA_a          206   2e-60   
ref|XP_004715224.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   2e-60   
ref|XP_008497166.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   2e-60   
ref|XP_011432652.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   2e-60   
ref|XP_005696008.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   2e-60   
ref|XP_009443776.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   2e-60   
ref|XP_009199021.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   2e-60   
ref|XP_006196370.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    206   2e-60   
ref|XP_009237280.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   2e-60   
gb|EZF28516.1|  mannose-1-phosphate guanyltransferase                   204   2e-60   
ref|XP_005547197.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    205   2e-60   



>ref|XP_002311190.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEE88557.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=361

 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKLEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFETKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIDFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_004240924.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_004240926.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_004240927.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_010322173.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_010322174.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
Length=361

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKL IKI CSQETEPLGTAGPLALARDKL+DDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLVDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASLMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_011076786.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Sesamum 
indicum]
 ref|XP_011076787.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Sesamum 
indicum]
Length=361

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KLEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_009592609.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009592610.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE  LEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEANLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIAFHKSHGGEASLMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_007218178.1| hypothetical protein PRUPE_ppa007618mg [Prunus persica]
 ref|XP_008233488.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Prunus 
mume]
 ref|XP_008233489.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Prunus 
mume]
 dbj|BAH03298.1| GDP-D-mannose pyrophosphorylase [Prunus persica]
 gb|EMJ19377.1| hypothetical protein PRUPE_ppa007618mg [Prunus persica]
Length=361

 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+A+GV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVSEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            M FLKEFETK+ IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK+
Sbjct  61   MTFLKEFETKVGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_006338820.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006338821.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006338822.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X3 [Solanum tuberosum]
Length=361

 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKL IKI CSQETEPLGTAGPLALARDKL+DD+GEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLVDDAGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASLMVTKVDEPSKYGVVVMEESTG  155



>gb|KDO35843.1| hypothetical protein CISIN_1g046608mg, partial [Citrus sinensis]
Length=256

 Score =   295 bits (756),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KLEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFH+ HGGEASIMVTKVDEPSKYGVVVMEE+ G
Sbjct  121  MIEFHRGHGGEASIMVTKVDEPSKYGVVVMEETMG  155



>ref|XP_011035050.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
 ref|XP_011035125.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
Length=361

 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+ +GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKVIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKLEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFETKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIDFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_006435610.1| hypothetical protein CICLE_v10033733mg [Citrus clementina]
 gb|ESR48850.1| hypothetical protein CICLE_v10033733mg [Citrus clementina]
Length=361

 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI+CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|KDO69184.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=361

 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI+CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|ADV59923.1| putative GDP-mannose pyrophosphorylase [Citrus unshiu]
Length=361

 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI+CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_009594230.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009594231.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
tomentosiformis]
Length=361

 Score =   298 bits (764),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKL IKI CSQETEPLGTAGPLALARDKL+DDSGEPFFVLNSDVIS+YPFKE
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLVDDSGEPFFVLNSDVISDYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEAS+MVTKVDEPSKYGVVV EESTG
Sbjct  121  MIEFHKSHGGEASLMVTKVDEPSKYGVVVTEESTG  155



>gb|KJB74050.1| hypothetical protein B456_011G269100 [Gossypium raimondii]
Length=361

 Score =   298 bits (764),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKL I I CSQETEPLGTAGPLALARDKL+D+SGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFETKLGITITCSQETEPLGTAGPLALARDKLVDESGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>emb|CBI31615.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   295 bits (754),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVSEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL I I CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEES G
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESIG  155



>ref|NP_001234025.1| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
 gb|AAT37498.2| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
Length=361

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE  L IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEASLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIQFHKSHGGEASLMVTKVDEPSKYGVVVMEESTG  155



>ref|NP_001275205.1| GDP-mannose pyrophosphorylase [Solanum tuberosum]
 gb|AAD01737.1| GDP-mannose pyrophosphorylase [Solanum tuberosum]
Length=361

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE  L IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEASLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIQFHKSHGGEASLMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_006486418.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
[Citrus sinensis]
Length=361

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI+CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVME+STG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEDSTG  155



>gb|ACN38266.1| GDP-D-mannose pyrophosphorylase [Actinidia latifolia]
Length=361

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVSEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_009759296.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
 ref|XP_009759297.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
 ref|XP_009759298.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
Length=361

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKL IKI CSQETEPLGTAGPLALARDKL+DDS EPFFVLNSDVIS+YPFKE
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLVDDSAEPFFVLNSDVISDYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEAS+MVTKVDEPSKYGVVV EESTG
Sbjct  121  MIEFHKSHGGEASLMVTKVDEPSKYGVVVTEESTG  155



>ref|XP_011036070.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Populus 
euphratica]
 ref|XP_011036071.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Populus 
euphratica]
Length=361

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKLEIKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKVHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_008371997.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Malus domestica]
 ref|XP_009351402.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Pyrus x 
bretschneideri]
Length=361

 Score =   296 bits (757),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            M FLKEFE K+ IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   MTFLKEFEEKVGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|NP_001276240.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 gb|ACX37458.1| GDP-D-mannose pyrophosphorylase [Glycine max]
 gb|KHN20905.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   296 bits (757),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKNHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_003544186.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Glycine 
max]
Length=374

 Score =   296 bits (758),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKNHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_004307574.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004307575.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETK+ IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFETKVGIKITCSQETEPLGTAGPLALARDKLIDQSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVV+EESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVLEESTG  155



>ref|NP_001276259.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 gb|ACU21199.1| unknown [Glycine max]
Length=361

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|AGI78460.1| GDP-D-mannose pyrophosphorylase [Camellia sinensis]
Length=361

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVSEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEAKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|KHN13115.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|ABI48955.1| GDP-D-mannose pyrophosphorylase [Viola baoshanensis]
Length=361

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKL I I CSQETEPLGTAGPLALARDKL  DSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKQFETKLGITITCSQETEPLGTAGPLALARDKLTGDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_010095035.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
 gb|EXB58141.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
Length=361

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            MI+FHK+HGGEASIMVTKVDEPSKYGVVVMEEST
Sbjct  121  MIDFHKAHGGEASIMVTKVDEPSKYGVVVMEEST  154



>gb|ABB53473.1| GDP-mannose pyrophosphorylase [Malpighia glabra]
 gb|ABX80393.1| GDP-mannose pyrophosphorylase [Malpighia glabra]
Length=361

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL+IKI CSQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEKKLDIKITCSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKNHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_009797660.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009797661.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009797662.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
Length=361

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPE M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEEM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE  L IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEANLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIAFHKSHGGEASLMVTKVDEPSKYGVVVMEESTG  155



>gb|AIN40499.1| GDP-D-mannose pyrophosphorylase [Ziziphus jujuba]
Length=361

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVSEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>dbj|BAB62108.1| GDP-D-mannose pyrophosphorylase [Nicotiana tabacum]
Length=361

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPE M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEEM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE  L IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEANLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIAFHKSHGGEASLMVTKVDEPSKYGVVVMEESTG  155



>ref|NP_001234084.1| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
 gb|ABE03745.2| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
Length=361

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE  L IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEASLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHKSHGGEAS+MVT +DEPSKYGVVVMEESTG
Sbjct  121  MIQFHKSHGGEASLMVTNLDEPSKYGVVVMEESTG  155



>ref|XP_009343927.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Pyrus 
x bretschneideri]
Length=361

 Score =   294 bits (753),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            M FLKEFE K+ IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK+
Sbjct  61   MTFLKEFEEKVGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKGHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_007141846.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 ref|XP_007141847.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 gb|ESW13840.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 gb|ESW13841.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
Length=361

 Score =   294 bits (753),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK HGGEASIMVTKVDEPSKYGVVVME+STG
Sbjct  121  MIEFHKGHGGEASIMVTKVDEPSKYGVVVMEDSTG  155



>ref|XP_002282422.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Vitis vinifera]
Length=361

 Score =   294 bits (753),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVSEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL I I CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEES G
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESIG  155



>ref|XP_002316262.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEF02433.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=361

 Score =   294 bits (753),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKLEIKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK HGGEASIMVTKVDEPSKYGVVV EESTG
Sbjct  121  MIEFHKVHGGEASIMVTKVDEPSKYGVVVTEESTG  155



>ref|XP_006429173.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
 gb|ESR42413.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
Length=361

 Score =   293 bits (751),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KLEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFH+  GGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHRGRGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_008441398.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Cucumis 
melo]
Length=361

 Score =   293 bits (751),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVEEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFEKKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVM+ESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMDESTG  155



>ref|XP_002524227.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]
 gb|EEF38151.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]
Length=361

 Score =   293 bits (751),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL I I CSQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLIDESGDPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_010088589.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
 gb|EXB36730.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
Length=361

 Score =   293 bits (751),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEA +A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEAFKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KLEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSH GEASIMVTKVDEPSKYGVVVM+E+TG
Sbjct  121  MIEFHKSHVGEASIMVTKVDEPSKYGVVVMDETTG  155



>ref|XP_010256792.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nelumbo 
nucifera]
Length=361

 Score =   293 bits (750),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE +L IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEARLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIAFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_007009211.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009212.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009214.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18021.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18022.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18024.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
Length=361

 Score =   293 bits (750),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVIEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE K+ IKI CSQETEPLGTAGPLALARDKLID SG+PFFVLNSDVISEYPFKE
Sbjct  61   LNFLKEFEAKVGIKISCSQETEPLGTAGPLALARDKLIDGSGKPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_004490906.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cicer 
arietinum]
Length=361

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKATGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEAKLGITISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_006601845.1| PREDICTED: uncharacterized protein LOC100818016 isoform X1 [Glycine 
max]
 ref|XP_006601846.1| PREDICTED: uncharacterized protein LOC100818016 isoform X2 [Glycine 
max]
 ref|XP_006601847.1| PREDICTED: uncharacterized protein LOC100818016 isoform X3 [Glycine 
max]
 ref|XP_006601848.1| PREDICTED: uncharacterized protein LOC100818016 isoform X4 [Glycine 
max]
 ref|XP_006601849.1| PREDICTED: uncharacterized protein LOC100818016 isoform X5 [Glycine 
max]
 gb|KHN07601.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEAKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKTHGGEATIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_011085013.1| PREDICTED: LOW QUALITY PROTEIN: mannose-1-phosphate guanylyltransferase 
1-like [Sesamum indicum]
Length=358

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALA+DKLIDDSGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKDFEAKLGITITCSQETEPLGTAGPLALAKDKLIDDSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|KDP44883.1| hypothetical protein JCGZ_01383 [Jatropha curcas]
Length=361

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_007026922.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007026923.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY07424.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY07425.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
Length=361

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPE+M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL+IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEKKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIDFHKGHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|NP_181507.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 ref|NP_001189713.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 sp|O22287.1|GMPP1_ARATH RecName: Full=Mannose-1-phosphate guanylyltransferase 1; AltName: 
Full=GDP-mannose pyrophosphorylase 1; AltName: Full=Protein 
CYTOKINESIS DEFECTIVE 1; AltName: Full=Protein EMBRYO DEFECTIVE 
101; AltName: Full=Protein HYPERSENSITIVE TO AMMONIUM 
ION 1; AltName: Full=Protein SENSITIVE TO OZONE 1; AltName: 
Full=Protein VITAMIN C DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AAK32825.1|AF361812_1 At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAL16129.1|AF428297_1 At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAB87126.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAC78474.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAD04627.1| CYT1 protein [Arabidopsis thaliana]
 gb|AAL09781.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAM65235.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAM91473.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAN31841.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAP21173.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AEC09721.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 gb|AEC09722.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
Length=361

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKLEIKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+EFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MLEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|EYU19947.1| hypothetical protein MIMGU_mgv1a008833mg [Erythranthe guttata]
Length=361

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFESKLAIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHKSHGGEASIMVTKVDEPSKYGVVV EES+G
Sbjct  121  MIAFHKSHGGEASIMVTKVDEPSKYGVVVTEESSG  155



>ref|XP_002879816.1| hypothetical protein ARALYDRAFT_483004 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56075.1| hypothetical protein ARALYDRAFT_483004 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKLEIKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+EFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MLEFHKTHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_010505663.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010505664.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010508973.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010517339.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
Length=361

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKLEIKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+EFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MLEFHKTHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|XP_003616475.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
 gb|AAT58365.1| GMPase [Medicago sativa]
 gb|AES99433.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=361

 Score =   291 bits (746),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKATGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVIS+YP KE
Sbjct  61   LNFLKDFEAKLGITISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISDYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_006493574.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Citrus sinensis]
Length=361

 Score =   291 bits (746),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KLEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFH+  GGEASIMVT VDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHRGRGGEASIMVTNVDEPSKYGVVVMEETTG  155



>ref|XP_006294448.1| hypothetical protein CARUB_v10023461mg, partial [Capsella rubella]
 gb|EOA27346.1| hypothetical protein CARUB_v10023461mg, partial [Capsella rubella]
Length=371

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 153/164 (93%), Gaps = 3/164 (2%)
 Frame = +1

Query  175  RSID---LRMRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVL  345
            RS D    +M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVL
Sbjct  2    RSYDNQGFKMKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVL  61

Query  346  AINYQPEVMMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSD  525
            AINYQPEVM+NFLK+FE KLEIKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSD
Sbjct  62   AINYQPEVMLNFLKDFEAKLEIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSD  121

Query  526  VISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            VISEYP KEM+EFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  122  VISEYPLKEMLEFHKTHGGEASIMVTKVDEPSKYGVVVMEESTG  165



>gb|ACW84415.1| GDP-D-mannose pyrophosphorylase [Glycine max]
Length=361

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKL IKI CSQETEPLGTAGPLALARDKLI DSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLISDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIQFHKTHGGEATIMVTKVDEPSKYGVVVMEETTG  155



>ref|NP_001240188.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 ref|XP_006590281.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X1 [Glycine max]
 gb|ACU21527.1| unknown [Glycine max]
Length=361

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKL IKI CSQETEPLGTAGPLALARDKLI DSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLISDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIQFHKTHGGEATIMVTKVDEPSKYGVVVMEETTG  155



>gb|KHN17882.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFETKL IKI CSQETEPLGTAGPLALARDKLI DSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLISDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIQFHKTHGGEATIMVTKVDEPSKYGVVVMEETTG  155



>emb|CAC35355.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
Length=361

 Score =   291 bits (744),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FETKLEIKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            ++EFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  ILEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>ref|NP_001242262.1| uncharacterized protein LOC100818016 [Glycine max]
 gb|ACU23379.1| unknown [Glycine max]
Length=361

 Score =   291 bits (744),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEAKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGG A+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKTHGGAATIMVTKVDEPSKYGVVVMEETTG  155



>emb|CDY07636.1| BnaA03g18750D [Brassica napus]
Length=401

 Score =   292 bits (747),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 159/184 (86%), Gaps = 8/184 (4%)
 Frame = +1

Query  106  NSDLTFSRFVPQVGGIHSSRLDCRSIDLRMRALILVGGFGTRLRPLTLSVPKPLVEFANK  285
            N    +SRF         S +  +   ++M+ALILVGGFGTRLRPLTLS PKPLV+FANK
Sbjct  20   NISFNYSRF--------RSEISSKERRIKMKALILVGGFGTRLRPLTLSFPKPLVDFANK  71

Query  286  PMILHQIEALRAVGVTEVVLAINYQPEVMMNFLKEFETKLEIKIMCSQETEPLGTAGPLA  465
            PMILHQIEAL+AVGV EVVLAINYQPEVM+NFLK+FE KLEIKI CSQETEP+GTAGPLA
Sbjct  72   PMILHQIEALKAVGVDEVVLAINYQPEVMLNFLKDFEAKLEIKITCSQETEPMGTAGPLA  131

Query  466  LARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVME  645
            LARDKL+D SGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVM+
Sbjct  132  LARDKLVDGSGEPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMD  191

Query  646  ESTG  657
            E+TG
Sbjct  192  ETTG  195



>ref|XP_010691388.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Beta vulgaris 
subsp. vulgaris]
Length=361

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKDFEAKLGITITCSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVV EESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVTEESTG  155



>ref|XP_010262630.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nelumbo 
nucifera]
Length=361

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FLK+FE+KL IKI CS+ETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP KE
Sbjct  61   LSFLKDFESKLGIKITCSRETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIDFHKAHGGEASIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_002308180.1| hypothetical protein POPTR_0006s09130g [Populus trichocarpa]
 gb|EEE91703.1| hypothetical protein POPTR_0006s09130g [Populus trichocarpa]
Length=361

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKE+E +LEIKI CSQETEPLGTAGPLALARDKLIDDSG PFFVLNSDVISEYP K+
Sbjct  61   LNFLKEYEKRLEIKITCSQETEPLGTAGPLALARDKLIDDSGAPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK HGGEASIMVTKVDEPSKYGVV+MEE++G
Sbjct  121  MIEFHKGHGGEASIMVTKVDEPSKYGVVLMEETSG  155



>ref|XP_010067451.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067452.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067453.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067454.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW65590.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65591.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65592.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65593.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
Length=361

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV+EVVLAINYQPE+M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVSEVVLAINYQPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK FE KL IKI CSQETEPLGTAGPLALARDKL+DDSGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKGFEAKLGIKITCSQETEPLGTAGPLALARDKLLDDSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK+HGGEASIMVTKVDEPSKYGVV+MEESTG
Sbjct  121  MIQFHKAHGGEASIMVTKVDEPSKYGVVIMEESTG  155



>ref|XP_006411211.1| hypothetical protein EUTSA_v10016850mg [Eutrema salsugineum]
 dbj|BAJ34137.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52664.1| hypothetical protein EUTSA_v10016850mg [Eutrema salsugineum]
Length=361

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KLEIKI CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_003600761.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
 gb|AES71012.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=361

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ +GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL+IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEEKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIKFHKSHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>gb|KJB76777.1| hypothetical protein B456_012G106900 [Gossypium raimondii]
Length=361

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI CSQETEPLGTAGP+ALARDKLID SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEKKLGIKITCSQETEPLGTAGPIALARDKLIDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+ FHK HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MVNFHKGHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>gb|KHG16049.1| Mannose-1-phosphate guanyltransferase [Gossypium arboreum]
Length=361

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI CSQETEPLGTAGP+ALARDKLID SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKEFEKKLGIKITCSQETEPLGTAGPIALARDKLIDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+ FHK HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MVNFHKGHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_009141836.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Brassica 
rapa]
Length=361

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KLEIKI CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP +E
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLRE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>emb|CDP16056.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEAKLGIKITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASI+VTKVDEPSKYGVVV+EESTG
Sbjct  121  MIEFHKSHGGEASIVVTKVDEPSKYGVVVLEESTG  155



>emb|CDY07033.1| BnaA04g22820D [Brassica napus]
Length=361

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KLEIKI CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP +E
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLRE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_010529799.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010529800.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010529801.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
Length=361

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+A GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSMPKPLVDFANKPMILHQIEALKAAGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KLEIKI CSQETEPLGTAGPLALARDKL D+SGEPFFVLNSDVI EYP +E
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLFDESGEPFFVLNSDVICEYPLQE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_011016812.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
Length=349

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKE+E KLEIKI CSQETEPLGTAGPLALARDKLIDD+G PFFVLNSDVISEYP K+
Sbjct  61   LNFLKEYEKKLEIKITCSQETEPLGTAGPLALARDKLIDDTGAPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK HGGEASIMVTKVDEPSKYGVV++EE++G
Sbjct  121  MIEFHKGHGGEASIMVTKVDEPSKYGVVLLEETSG  155



>emb|CDP00140.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I+I CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEAKLGIRITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVV+EE+TG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVLEEATG  155



>ref|XP_007009213.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
 gb|EOY18023.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
Length=362

 Score =   288 bits (738),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEV-  369
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGV EVVLAINYQPEV 
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVIEVVLAINYQPEVV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NFLKEFE K+ IKI CSQETEPLGTAGPLALARDKLID SG+PFFVLNSDVISEYPFK
Sbjct  61   MLNFLKEFEAKVGIKISCSQETEPLGTAGPLALARDKLIDGSGKPFFVLNSDVISEYPFK  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  156



>emb|CDX93234.1| BnaC04g46620D [Brassica napus]
Length=361

 Score =   288 bits (738),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KLEIKI CSQETEP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYP +E
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLRE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_009133383.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Brassica 
rapa]
 emb|CDY61780.1| BnaC03g72590D [Brassica napus]
Length=361

 Score =   288 bits (738),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KLEIKI CSQETEP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYP KE
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVM+E+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMDETTG  155



>ref|XP_007009215.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
5 [Theobroma cacao]
 gb|EOY18025.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
5 [Theobroma cacao]
Length=362

 Score =   288 bits (738),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQ-IEALRAVGVTEVVLAINYQPEV  369
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQ IEAL+AVGV EVVLAINYQPEV
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQQIEALKAVGVIEVVLAINYQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NFLKEFE K+ IKI CSQETEPLGTAGPLALARDKLID SG+PFFVLNSDVISEYPFK
Sbjct  61   MLNFLKEFEAKVGIKISCSQETEPLGTAGPLALARDKLIDGSGKPFFVLNSDVISEYPFK  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  EMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  156



>gb|KDO69185.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=358

 Score =   288 bits (737),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 3/155 (2%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI+CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIM   VDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIM---VDEPSKYGVVVMEESTG  152



>ref|XP_004138454.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004154737.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cucumis 
sativus]
 gb|KGN45744.1| hypothetical protein Csa_6G008750 [Cucumis sativus]
Length=361

 Score =   288 bits (737),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVEEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI CSQETEPLGTAGPLALAR KLID SGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFEKKLGIKITCSQETEPLGTAGPLALARGKLIDASGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVM+ESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMDESTG  155



>ref|XP_007026924.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
 gb|EOY07426.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
Length=362

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQ-IEALRAVGVTEVVLAINYQPEV  369
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQ IEAL+A+GVTEVVLAINYQPE+
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQQIEALKAIGVTEVVLAINYQPEI  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NFLKEFE KL+IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP K
Sbjct  61   MLNFLKEFEKKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLK  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            EMI+FHK HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  EMIDFHKGHGGEASIMVTKVDEPSKYGVVVMEETTG  156



>ref|XP_008785513.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785514.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785515.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785516.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785518.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785519.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785520.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785521.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL+IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIKFHKAHGGEATIMVTKVDEPSKYGVVVMEEETG  155



>ref|XP_010923222.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010923223.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010923224.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKP+V+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPIVDFANKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL+IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIKFHKAHGGEATIMVTKVDEPSKYGVVVMEEETG  155



>gb|KDO48143.1| hypothetical protein CISIN_1g0201131mg, partial [Citrus sinensis]
Length=269

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 3/155 (2%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KLEIKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFH+  GGEASIM   VDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHRGRGGEASIM---VDEPSKYGVVVMEETTG  152



>ref|XP_002310933.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEE88300.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=375

 Score =   286 bits (733),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL  PKPLVEFANKPMILHQIEAL+A+GVTEVVLAINY+PE M
Sbjct  1    MKALILVGGFGTRLRPLTLKHPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYKPEEM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            MNFLK+F+TKL+IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVI EYP K 
Sbjct  61   MNFLKDFDTKLDIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVICEYPLKL  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|ACK87007.1| GDP-mannose pyrophosphorylase [Carica papaya]
Length=361

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+A GV+EV+LAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSMPKPLVDFANKPMILHQIEALKAAGVSEVILAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KLEIKI CSQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVISEYP  E
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVISEYPLTE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FH SHGGEASIMVTKVDEPSKYGVVV+EE+TG
Sbjct  121  MIKFHNSHGGEASIMVTKVDEPSKYGVVVIEEATG  155



>ref|XP_010931208.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEV+LAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKEVGVTEVILAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL+IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKVDEPSKYGV+VMEE TG
Sbjct  121  LIQFHKAHGGEATIMVTKVDEPSKYGVLVMEEETG  155



>ref|XP_006340997.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Solanum 
tuberosum]
Length=361

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQP++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPKIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             NFLKEFE KL+IKI CSQETEPLGTAGPLALARD L DDSGEPFFVLNSDVI +YP KE
Sbjct  61   QNFLKEFEKKLDIKITCSQETEPLGTAGPLALARDILRDDSGEPFFVLNSDVICDYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_008777609.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   285 bits (730),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEV+LAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKEVGVTEVILAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL+IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVI+EYPF E
Sbjct  61   LNFLKDFESKLDIKITCSQETEPLGTAGPLALARDKLIDSSGEPFFVLNSDVINEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGG+A+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIQFHKAHGGDATIMVTKVDEPSKYGVVVMEEETG  155



>gb|EPS66224.1| hypothetical protein M569_08552 [Genlisea aurea]
Length=361

 Score =   285 bits (730),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+  GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDAGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQETEPLGTAGPLALARDKL+D S EPFFVLNSDVISEYP K 
Sbjct  61   LNFLKDFEAKLGIKITCSQETEPLGTAGPLALARDKLLDSSNEPFFVLNSDVISEYPLKA  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  155



>gb|ACN66754.1| GMP [Carica papaya]
Length=361

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+A GV+EV+LAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSMPKPLVDFANKPMILHQIEALKAAGVSEVILAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KLEIKI CSQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVISEYP  E
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVISEYPLTE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            MI+FH SHGGEASIMVTKVDEPSKYGVVV+EE+T
Sbjct  121  MIKFHNSHGGEASIMVTKVDEPSKYGVVVIEEAT  154



>ref|XP_008803133.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008803134.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008803135.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE++L IKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESRLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIKFHKAHGGEATIMVTKVDEPSKYGVVVMEEETG  155



>ref|XP_011033044.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
Length=375

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+A+GVTEVVLAINY+ E M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYKHEEM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            MNFLK+F+TKL+IKI CSQETEPLGTAGPLALARDKL DDSGEPFFVLNSDVI EYP K 
Sbjct  61   MNFLKDFDTKLDIKITCSQETEPLGTAGPLALARDKLTDDSGEPFFVLNSDVICEYPLKL  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFH++HGGEASIMVTKVDEPSKYGVV+MEESTG
Sbjct  121  MIEFHRAHGGEASIMVTKVDEPSKYGVVIMEESTG  155



>ref|XP_009601713.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009601714.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   283 bits (725),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQP++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPKIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             NFLKEFE KL+I+I CSQETEPLGTAGPLALARD L DDSGEPFFVLNSDVI +YP K+
Sbjct  61   QNFLKEFEKKLDIRITCSQETEPLGTAGPLALARDILRDDSGEPFFVLNSDVICDYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE TG
Sbjct  121  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEGTG  155



>ref|XP_009143286.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Brassica 
rapa]
Length=361

 Score =   283 bits (724),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+AVGV EVVL +NYQ EVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAVGVDEVVLTVNYQAEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+ E KLEIKI CS+ETEP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKDVEAKLEIKITCSRETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_010937548.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010937549.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010937550.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE +L IKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFENRLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKVDEPSKYGVVVME+ TG
Sbjct  121  LIKFHKAHGGEATIMVTKVDEPSKYGVVVMEDETG  155



>ref|NP_001142215.1| hypothetical protein [Zea mays]
 ref|XP_008668541.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668543.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668544.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87905.1| unknown [Zea mays]
 gb|ACR38500.1| unknown [Zea mays]
 tpg|DAA44594.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44595.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44596.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44597.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44598.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
Length=361

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+F NKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALARDKL D SG+PFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLADGSGDPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +IEFH++HGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIEFHRAHGGEATIMVTKVDEPSKYGVVVMEEGTG  155



>emb|CDX74832.1| BnaA05g05780D [Brassica napus]
Length=361

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+AVGV EVVL +NYQ EVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAVGVDEVVLTVNYQAEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+ E KLEIKI CS+ETEP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYPFKE
Sbjct  61   LNFLKDVEEKLEIKITCSRETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>ref|XP_004246437.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Solanum 
lycopersicum]
Length=361

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQP++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPKIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             NFLKEFE KL+IKI CSQETEPLGTAGPLALARD L DDSGEPFFVLNSDVI +YP KE
Sbjct  61   QNFLKEFEKKLDIKITCSQETEPLGTAGPLALARDILRDDSGEPFFVLNSDVICDYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I FHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LILFHKSHGGEASIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_009387284.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009387293.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKEFENKLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FH +HGGEA+I+VT+V+EPSKYGVVVM+E TG
Sbjct  121  LIQFHNAHGGEATILVTQVNEPSKYGVVVMDEETG  155



>ref|XP_004984923.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
isoform X1 [Setaria italica]
 ref|XP_004984924.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
isoform X2 [Setaria italica]
Length=361

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+F NKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALARDKL+D SG+PFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLVDGSGDPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+ HK+HGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIQLHKAHGGEATIMVTKVDEPSKYGVVVMEEGTG  155



>ref|XP_006649823.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
[Oryza brachyantha]
Length=361

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+F NKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALAR+KL D SG+PFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALAREKLADGSGDPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVMEEETG  155



>gb|AHX59161.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=198

 Score =   275 bits (702),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FLKEFE KL IKI CSQETEP+GTAGPLALARDKL D S EPFFVLNSDVI EYP K+
Sbjct  61   LSFLKEFEAKLGIKITCSQETEPMGTAGPLALARDKLDDGSAEPFFVLNSDVICEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+EFHK HGGEASIMVTKVDEPSKYGVV+++E TG
Sbjct  121  MLEFHKKHGGEASIMVTKVDEPSKYGVVILDEETG  155



>gb|EAY89395.1| hypothetical protein OsI_10901 [Oryza sativa Indica Group]
Length=361

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+F NKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALARDKL D SG+PFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLADGSGDPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE T
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVMEEET  154



>ref|XP_004970565.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Setaria italica]
Length=361

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +IEFHKSHGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LIEFHKSHGGEATIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_003558261.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228817.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228818.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228819.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
Length=361

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL I I CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVV E+ TG
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVTEKETG  155



>ref|XP_006846372.1| hypothetical protein AMTR_s00012p00262630 [Amborella trichopoda]
 gb|ERN08047.1| hypothetical protein AMTR_s00012p00262630 [Amborella trichopoda]
Length=361

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPE+M
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQE EPLGTAGPLALARDKLIDDSGEPFFVLNSDVISE+P KE
Sbjct  61   LNFLKDFEEKLCIKITCSQEMEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEFPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HG EASIMVTKVDEPSKYGVV+++E TG
Sbjct  121  MIEFHKAHGKEASIMVTKVDEPSKYGVVLLDEETG  155



>ref|XP_009407514.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEV+LAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVILAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVM+E TG
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVMDEETG  155



>ref|NP_001049673.1| Os03g0268400 [Oryza sativa Japonica Group]
 sp|Q84JH5.1|GMPP1_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
1 [Oryza sativa Japonica Group]
 gb|AAP06900.1| COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase 
involved in lipopolysaccharide biosynthesis/translation initiation 
factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) 
[Cell envelope biogenesis, outer membrane / Translation, 
ribosomal structure and biogenesis] [Oryza sativa Japonica 
Group]
 gb|AAP06910.1| putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica 
Group]
 gb|ABF95179.1| mannose-1-phosphate guanyltransferase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11587.1| Os03g0268400 [Oryza sativa Japonica Group]
 gb|EAZ26390.1| hypothetical protein OsJ_10274 [Oryza sativa Japonica Group]
 dbj|BAH00737.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+F NKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALARDKL D SG+PFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLADGSGDPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVME+ T
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDET  154



>ref|NP_001044795.1| Os01g0847200 [Oryza sativa Japonica Group]
 sp|Q941T9.1|GMPP2_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
2 [Oryza sativa Japonica Group]
 dbj|BAB64272.1| putative GMPase [Oryza sativa Japonica Group]
 dbj|BAB89577.1| putative GMPase [Oryza sativa Japonica Group]
 dbj|BAF06709.1| Os01g0847200 [Oryza sativa Japonica Group]
 gb|EAZ41985.1| hypothetical protein OsJ_26535 [Oryza sativa Japonica Group]
 dbj|BAG88187.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTG  155



>ref|XP_008801635.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X1 [Phoenix dactylifera]
 ref|XP_008801636.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X1 [Phoenix dactylifera]
Length=361

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQETEPLGTAGPLALARD L+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFEDKLGIKITCSQETEPLGTAGPLALARDNLVDGSGEPFFVLNSDVISEYPFSE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKV+EPSKYGVVVM+E TG
Sbjct  121  LIKFHKAHGGEATIMVTKVNEPSKYGVVVMKEETG  155



>ref|XP_009388596.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009388598.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I FHKS G EA+IMVTKV+EPSKYGVVVMEE TG
Sbjct  121  LIRFHKSRGSEATIMVTKVEEPSKYGVVVMEEETG  155



>gb|EMT31032.1| Mannose-1-phosphate guanyltransferase beta [Aegilops tauschii]
Length=361

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEV+LAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVILAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVME++TG
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDTTG  155



>emb|CDM85018.1| unnamed protein product [Triticum aestivum]
Length=361

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEV+LAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVILAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVME++TG
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDTTG  155



>gb|ABR15468.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=361

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FLK FETKL IKI CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP K+
Sbjct  61   LSFLKAFETKLGIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M++FH  HGGEASIMVTKVDEPSKYGVV+++E TG
Sbjct  121  MVDFHTKHGGEASIMVTKVDEPSKYGVVILDEETG  155



>sp|Q6Z9A3.1|GMPP3_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
3 [Oryza sativa Japonica Group]
 dbj|BAD05471.1| putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica 
Group]
 gb|EAZ06115.1| hypothetical protein OsI_28352 [Oryza sativa Indica Group]
 gb|EAZ14142.1| hypothetical protein OsJ_04069 [Oryza sativa Japonica Group]
 dbj|BAH01407.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_004977599.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Setaria italica]
Length=361

 Score =   278 bits (712),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQ+EAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQMEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +IEFHKSHGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LIEFHKSHGGEATIMVTKVDEPSKYGVVVMEEATG  155



>ref|NP_001142302.1| uncharacterized protein LOC100274471 [Zea mays]
 ref|XP_008654645.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 ref|XP_008654646.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 ref|XP_008654647.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 gb|ACF80591.1| unknown [Zea mays]
 gb|ACF88136.1| unknown [Zea mays]
 gb|AFW84601.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84602.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84603.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84604.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84605.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
Length=361

 Score =   278 bits (712),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_003564604.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brachypodium distachyon]
Length=361

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SG+PFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGKPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVME++TG
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDTTG  155



>gb|ABR17757.1| unknown [Picea sitchensis]
Length=361

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FLK FETK+ IKI CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP K+
Sbjct  61   LSFLKAFETKIGIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M++FH  HGGEASIMVTKVDEPSKYGVV+++E TG
Sbjct  121  MVDFHAKHGGEASIMVTKVDEPSKYGVVILDEETG  155



>gb|AFL69832.1| mannose-1-phosphate guanyltransferase 3 [Oryza sativa Indica 
Group]
Length=361

 Score =   278 bits (710),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL  VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALEEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTG  155



>ref|XP_006645004.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Oryza brachyantha]
Length=361

 Score =   278 bits (710),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEVTG  155



>gb|AFL69830.1| mannose-1-phosphate guanyltransferase 1 [Oryza sativa Indica 
Group]
Length=361

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL  VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALEEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE TG
Sbjct  121  LIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTG  155



>gb|AFL69833.1| mannose-1-phosphate guanyltransferase 4 [Oryza sativa Indica 
Group]
Length=361

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSD ISEYPF E
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDAISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_010554624.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010554625.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
Length=361

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE  L IKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP +E
Sbjct  61   LNFLKDFEKNLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLEE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHK+HGGEASIMVTKVDEPSKYGVVV +E+TG
Sbjct  121  MIAFHKAHGGEASIMVTKVDEPSKYGVVVTDENTG  155



>ref|XP_002456631.1| hypothetical protein SORBIDRAFT_03g039740 [Sorghum bicolor]
 gb|EES01751.1| hypothetical protein SORBIDRAFT_03g039740 [Sorghum bicolor]
Length=361

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LIKFHKCHGGEATIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_009412560.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQETEPLGTAGPLALARD+L+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFEDKLGIKITCSQETEPLGTAGPLALARDRLMDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEES  651
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVVM+ES
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVMDES  153



>gb|AHB17740.1| GDP-mannose pyrophosphorylase [Pogonatherum paniceum]
Length=361

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LIKFHKCHGGEATIMVTKVDEPSKYGVVVMEEATG  155



>ref|XP_006846369.1| hypothetical protein AMTR_s00012p00262290 [Amborella trichopoda]
 gb|ERN08044.1| hypothetical protein AMTR_s00012p00262290 [Amborella trichopoda]
Length=361

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+A+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQE EPLGTAGPLALARD+LID+SGEPFFVLNSDVISE+P K+
Sbjct  61   LNFLKDFEAKLGIKITCSQEKEPLGTAGPLALARDELIDESGEPFFVLNSDVISEFPLKK  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M++FHK+HG EASIMVTKVDEPSKYGVVVM E TG
Sbjct  121  MLDFHKAHGKEASIMVTKVDEPSKYGVVVMNEKTG  155



>dbj|BAJ95730.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91553.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=361

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEV+LAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVILAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHKSHGGEA+IMVTKVDEPSKYGVVV E++TG
Sbjct  121  LIQFHKSHGGEATIMVTKVDEPSKYGVVVTEDTTG  155



>ref|XP_010534527.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Tarenaya 
hassleriana]
 ref|XP_010534528.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Tarenaya 
hassleriana]
Length=361

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FLK+FET+L IKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP +E
Sbjct  61   LSFLKDFETELGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLEE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHK+HGGEASI+VTKVDEPSKYGVVVM+E+ G
Sbjct  121  MIAFHKAHGGEASIVVTKVDEPSKYGVVVMDETDG  155



>ref|XP_008674826.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 ref|XP_008674827.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 ref|XP_008674828.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 gb|ACR38121.1| unknown [Zea mays]
 tpg|DAA56851.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
 tpg|DAA56852.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
Length=361

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL I I CSQETEPLGTAGPLALARDKL D SG+PFFVLNSDVISEYPF E
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGQPFFVLNSDVISEYPFAE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK HGGEA+IMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LIKFHKCHGGEATIMVTKVDEPSKYGVVVMEEATG  155



>gb|ABK24420.1| unknown [Picea sitchensis]
 gb|ACN39840.1| unknown [Picea sitchensis]
Length=361

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FLKEFE KL IKI CSQETEP+GTAGPLALARDKL D SGEPFFVLNSDVI EYP ++
Sbjct  61   LSFLKEFEAKLGIKITCSQETEPMGTAGPLALARDKLDDGSGEPFFVLNSDVICEYPLEQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+EFHK HGGEASIMVTKVDEPSKYGVV+++E TG
Sbjct  121  MLEFHKKHGGEASIMVTKVDEPSKYGVVILDEETG  155



>ref|XP_001782193.1| predicted protein [Physcomitrella patens]
 gb|EDQ53016.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            MNFL++FE  L IKI CSQETEP+GTAGPLALARDKL D SGE FFVLNSDVISEYP ++
Sbjct  61   MNFLRDFEKSLGIKITCSQETEPMGTAGPLALARDKLDDGSGESFFVLNSDVISEYPLRQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI+FHK HGGEA+IMVTKVDEPSKYGVVVM+ES G
Sbjct  121  MIDFHKKHGGEATIMVTKVDEPSKYGVVVMDESNG  155



>gb|AHX74219.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=362

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 1/156 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQ-IEALRAVGVTEVVLAINYQPEV  369
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQ IEAL+A+GV EVVLAINYQPEV
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQQIEALKAIGVDEVVLAINYQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M++FLK FETKL IKI CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP K
Sbjct  61   MLSFLKAFETKLGIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLK  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +M++FH  HGGEASIMVTKVDEPSKYGVV+++E TG
Sbjct  121  QMVDFHTKHGGEASIMVTKVDEPSKYGVVILDEETG  156



>ref|XP_001769404.1| predicted protein [Physcomitrella patens]
 gb|EDQ65773.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            MNFL++FE  L IKI CSQETEP+GTAGPLALAR+KL D SGE FFVLNSDVISEYP ++
Sbjct  61   MNFLRDFEKSLGIKITCSQETEPMGTAGPLALARNKLDDGSGEAFFVLNSDVISEYPLRQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+EFHK HGGEA+IMVTKVDEPSKYGVVVM+ES G
Sbjct  121  MVEFHKKHGGEATIMVTKVDEPSKYGVVVMDESNG  155



>gb|ABR15469.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=361

 Score =   273 bits (697),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FLKEFE K+ IKI CSQETEP+GTAGPLALARDKL D S EPFFVLNSDVI EYP K+
Sbjct  61   LSFLKEFEAKVGIKITCSQETEPMGTAGPLALARDKLDDGSAEPFFVLNSDVICEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+EFHK HGGEASIMVTKVDEPSKYGVV+++E TG
Sbjct  121  MLEFHKKHGGEASIMVTKVDEPSKYGVVILDEETG  155



>gb|ABK24789.1| unknown [Picea sitchensis]
Length=361

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+AL+LVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+AVGV EVVLAINYQPE+M
Sbjct  1    MKALVLVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPELM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            M+FLKEFETKL IKI CSQETEP+GTAGPLALAR KLID SG PFFVLNSDVISEYP  +
Sbjct  61   MSFLKEFETKLGIKITCSQETEPMGTAGPLALARSKLIDGSGRPFFVLNSDVISEYPLNQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFH  HGGEASIMVTKV++PSKYGVVV+++ TG
Sbjct  121  MIEFHAKHGGEASIMVTKVEDPSKYGVVVLDDDTG  155



>ref|XP_009791580.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009791581.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
Length=360

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL+VPKPLV+FANKPMILHQIEAL+A+GVTEVVLAI+YQP++M
Sbjct  1    MKALILVGGFGTRLRPLTLNVPKPLVDFANKPMILHQIEALKAIGVTEVVLAISYQPKIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             NFLKEFE K +IKI CS+ETEPLGTAGPLALARD L DDS EPFFVLNSDVI +YP KE
Sbjct  61   QNFLKEFEKK-DIKITCSEETEPLGTAGPLALARDILRDDSDEPFFVLNSDVICDYPLKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE TG
Sbjct  120  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEGTG  154



>ref|XP_002974469.1| hypothetical protein SELMODRAFT_267755 [Selaginella moellendorffii]
 gb|EFJ24691.1| hypothetical protein SELMODRAFT_267755 [Selaginella moellendorffii]
Length=361

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+  GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKEAGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            M FLK+FE KL IKI CSQE EP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYP K+
Sbjct  61   MRFLKDFEAKLGIKITCSQEREPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHKSHG EA+IMVTKV+EPSKYGVVVM+++TG
Sbjct  121  MIAFHKSHGKEATIMVTKVEEPSKYGVVVMDDATG  155



>ref|XP_002990832.1| hypothetical protein SELMODRAFT_185648 [Selaginella moellendorffii]
 gb|EFJ08105.1| hypothetical protein SELMODRAFT_185648 [Selaginella moellendorffii]
Length=361

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+  GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKEAGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            M FLK+FE KL IKI CSQE EP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYP K+
Sbjct  61   MRFLKDFEAKLGIKITCSQEREPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHKSHG EA+IMVTKV+EPSKYGVVVM+++TG
Sbjct  121  MIAFHKSHGKEATIMVTKVEEPSKYGVVVMDDATG  155



>ref|XP_008801637.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X2 [Phoenix dactylifera]
Length=358

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 3/155 (2%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQETEPLGTAGPLALARD L+D SGEPFFVLNSDVISEYPF E
Sbjct  61   LNFLKDFEDKLGIKITCSQETEPLGTAGPLALARDNLVDGSGEPFFVLNSDVISEYPFSE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +I+FHK+HGGEA+IM   V+EPSKYGVVVM+E TG
Sbjct  121  LIKFHKAHGGEATIM---VNEPSKYGVVVMKEETG  152



>gb|AFK47417.1| unknown [Lotus japonicus]
Length=353

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 140/155 (90%), Gaps = 8/155 (5%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKP        MILHQIEAL+A GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKP--------MILHQIEALKAAGVTEVVLAINYQPEVM  52

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE KL IKI CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP +E
Sbjct  53   LNFLKDFEAKLGIKISCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPLEE  112

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  113  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  147



>ref|XP_007163469.1| hypothetical protein PHAVU_001G236800g, partial [Phaseolus vulgaris]
 gb|ESW35463.1| hypothetical protein PHAVU_001G236800g, partial [Phaseolus vulgaris]
Length=146

 Score =   259 bits (661),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+A+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL IKI CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP K+
Sbjct  61   LNFLKEFEAKLGIKITCSQETEPLGTAGPLALARDKLVDASGEPFFVLNSDVISEYPLKQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKY  627
            MI FHKSHGGEASIMVTKV +  ++
Sbjct  121  MIAFHKSHGGEASIMVTKVTKLRQF  145



>ref|XP_002966693.1| hypothetical protein SELMODRAFT_168373 [Selaginella moellendorffii]
 ref|XP_002978048.1| hypothetical protein SELMODRAFT_271290 [Selaginella moellendorffii]
 gb|EFJ20705.1| hypothetical protein SELMODRAFT_271290 [Selaginella moellendorffii]
 gb|EFJ32720.1| hypothetical protein SELMODRAFT_168373 [Selaginella moellendorffii]
Length=361

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMI HQIEAL+AVGVTEVVLAI+YQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMIFHQIEALKAVGVTEVVLAISYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FLK+FE KL +KI CSQE EP+GTAGPLALARDKL+D SGEPFFVLNSDVI EYP ++
Sbjct  61   LSFLKDFEAKLGVKITCSQEREPMGTAGPLALARDKLLDGSGEPFFVLNSDVICEYPLEQ  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MI FHK H GEASIMVT+VDEPSKYGVVV++E TG
Sbjct  121  MIAFHKQHKGEASIMVTQVDEPSKYGVVVLDEDTG  155



>emb|CDY20480.1| BnaC04g05640D [Brassica napus]
Length=360

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+A ILVGGFGTRLRPLTLS+PKPLV+FANKP+I+HQIEAL+AVGV EVVL +NYQ EVM
Sbjct  1    MKAFILVGGFGTRLRPLTLSLPKPLVDFANKPIIIHQIEALKAVGVDEVVLTVNYQAEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK  E  L+IKI C +ETE +G AGPLALARDKL+D SGEPFFVL+SDVISEYPFKE
Sbjct  61   LNFLKGVEANLKIKITCLRETESIGMAGPLALARDKLVDGSGEPFFVLSSDVISEYPFKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTG  155



>gb|KFK29636.1| hypothetical protein AALP_AA7G159400 [Arabis alpina]
Length=434

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = +1

Query  190  RMRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PE  366
            +M+ALILVGGFGTRLRPLT ++PKPLV+FANKPMILHQIEAL+A GVT+VVLAIN+Q P+
Sbjct  75   KMKALILVGGFGTRLRPLTFTMPKPLVDFANKPMILHQIEALKAAGVTQVVLAINHQQPQ  134

Query  367  VMMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  546
            VM+NF+KE+E KLEIKI  SQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVI EYP 
Sbjct  135  VMLNFVKEYEKKLEIKITFSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVICEYPL  194

Query  547  KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
             EMIEFHK+ G EASIMVTKVD+PSKYGVVVMEE T
Sbjct  195  LEMIEFHKASGAEASIMVTKVDDPSKYGVVVMEEDT  230



>emb|CDX90770.1| BnaA03g24500D [Brassica napus]
Length=374

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KLE+KI  SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            EMIEFHK+H  EASIMVTKVD+PSKYGVVVMEE
Sbjct  121  EMIEFHKNHAAEASIMVTKVDDPSKYGVVVMEE  153



>ref|NP_191118.1| probable mannose-1-phosphate guanylyltransferase 2 [Arabidopsis 
thaliana]
 sp|Q9M2S0.1|GMPP2_ARATH RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
2 [Arabidopsis thaliana]
 emb|CAB75917.1| mannose-1-phosphate guanylyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AAY78774.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE79405.1| probable mannose-1-phosphate guanylyltransferase 2 [Arabidopsis 
thaliana]
Length=364

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 141/158 (89%), Gaps = 3/158 (2%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPE--  366
            M+ALILVGGFGTRLRPLTLS+PKPLV+FANKPMILHQIEAL+A+GV EVVLAINY+PE  
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYEPEQL  60

Query  367  -VMMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP  543
             VM  F  + E  L IKI CSQETEPLGTAGPLALARDKL+D SG+PFFVLNSDVIS+YP
Sbjct  61   LVMSKFSNDVEATLGIKITCSQETEPLGTAGPLALARDKLVDGSGQPFFVLNSDVISDYP  120

Query  544  FKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
             +EMI FH +HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LEEMIAFHNAHGGEASIMVTKVDEPSKYGVVVMEEATG  158



>emb|CDX72252.1| BnaC07g42740D [Brassica napus]
Length=357

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF++E+E KLE+KI  SQETEPLGTAGPLALARDKLI +SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVEEYEKKLEMKITFSQETEPLGTAGPLALARDKLIHESGKPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            EMIEFHK+HG EASIMVTKVD+PSKYGVVVMEE++
Sbjct  121  EMIEFHKNHGAEASIMVTKVDDPSKYGVVVMEEAS  155



>ref|XP_010432971.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
isoform X1 [Camelina sativa]
Length=358

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q P+V
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPDV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KLEIKI  SQETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLEIKITFSQETEPLGTAGPLALARDKLVDESGQPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            EMIEFHK++  EASIMVTKVD+PSKYGVVVME +T 
Sbjct  121  EMIEFHKTNNAEASIMVTKVDDPSKYGVVVMEAATA  156



>ref|XP_009134205.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
 ref|XP_009134206.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
Length=356

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KLE+KI  SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            EMIEFHK+H  EASIMVTKVD+ SKYGVVVMEE
Sbjct  121  EMIEFHKNHAAEASIMVTKVDDSSKYGVVVMEE  153



>ref|XP_010412788.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
Length=358

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 3/158 (2%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPE--  366
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GV EV+L INY+PE  
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVDEVILTINYEPEQL  60

Query  367  -VMMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP  543
             VM NF +E ET L IKI CSQETEPLGTAGPLALAR+KL+D S +PFFVLNSDVISEYP
Sbjct  61   LVMSNFSREVETNLGIKITCSQETEPLGTAGPLALAREKLVDGSDQPFFVLNSDVISEYP  120

Query  544  FKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
             +E I FH +HGGEASIMVTKVDEPSKYGVVVMEE+TG
Sbjct  121  LEEFIAFHNAHGGEASIMVTKVDEPSKYGVVVMEEATG  158



>emb|CDY39219.1| BnaA03g50310D [Brassica napus]
Length=354

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPM+LHQIEAL+A GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMLLHQIEALKAAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KL++KI  SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLDMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            EMIEFH +HG EASIMVTKVD+PSKYGVVVMEE
Sbjct  121  EMIEFHTNHGAEASIMVTKVDDPSKYGVVVMEE  153



>ref|XP_009137936.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
 ref|XP_009137937.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
Length=354

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 1/153 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KL++KI  SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLDMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            EMI+FHK+HG EASIMVTKV++PSKYGVVVME+
Sbjct  121  EMIQFHKNHGAEASIMVTKVEDPSKYGVVVMEK  153



>gb|EMT15706.1| Mannose-1-phosphate guanyltransferase beta [Aegilops tauschii]
Length=297

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 137/155 (88%), Gaps = 10/155 (6%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLV+FANKPMILHQIEAL+ VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLK+FE+KL IKI CSQETEP+GTAGPLALARDKL D           DVISEYPF E
Sbjct  61   LNFLKDFESKLGIKITCSQETEPMGTAGPLALARDKLDD----------GDVISEYPFAE  110

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +IEFHKSHGGEA+IMVTKVDEPSKYGVVV EE TG
Sbjct  111  LIEFHKSHGGEATIMVTKVDEPSKYGVVVTEEETG  145



>ref|XP_010438164.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Camelina sativa]
Length=346

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT ++PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFTMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINQQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KLEIKI  SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLEIKITFSQETEPLGTAGPLALARDKLIDESGQPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            EMI+FHK++  E SIMVTKVD+PSKYGVVV EE+T 
Sbjct  121  EMIKFHKTNNAEVSIMVTKVDDPSKYGVVVTEEATA  156



>ref|XP_010941227.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941228.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941229.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941231.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
Length=361

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGT+LRPLTLS+PKPLV+FANKPMILHQIEAL+A+GVTEV+LAINYQP+VM
Sbjct  1    MKALILVGGFGTQLRPLTLSMPKPLVDFANKPMILHQIEALKAIGVTEVILAINYQPQVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            + FL+EFE++L IKI CSQE EPLGTAGPLALA++KL+ ++ +PFFVLNSD+  EYP KE
Sbjct  61   LRFLEEFESRLGIKITCSQENEPLGTAGPLALAKEKLLQEAEKPFFVLNSDITCEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M++FH +HGGEASIMVTKV EPSKYGVVV+++++G
Sbjct  121  MLDFHNAHGGEASIMVTKVAEPSKYGVVVLDDNSG  155



>emb|CDY39215.1| BnaA03g50270D [Brassica napus]
Length=321

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ LILVGGFGTRLR LT S+PKPLV+F NKPMILHQIEA++A GVTEVVLAIN+Q PEV
Sbjct  1    MKDLILVGGFGTRLRQLTFSMPKPLVDFGNKPMILHQIEAVKAAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KL++KI  SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLDMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            EMI+FHK+HG EASIMVTKVD+PSKYGVVVMEE++
Sbjct  121  EMIQFHKNHGAEASIMVTKVDDPSKYGVVVMEEAS  155



>emb|CAB79775.1| GDP-mannose pyrophosphorylase like protein [Arabidopsis thaliana]
Length=351

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            ++ALILVGGFGTRLRPLTLS+PKPLV+F NKPMILHQIEAL+  GVTEVVLAIN+Q PEV
Sbjct  1    LKALILVGGFGTRLRPLTLSMPKPLVDFGNKPMILHQIEALKGAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KLEIKI  SQETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLEIKITFSQETEPLGTAGPLALARDKLVDESGQPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            EMIEFHK++  EASIMVT+VD+PSKYGVVV EE T 
Sbjct  121  EMIEFHKTNRAEASIMVTEVDDPSKYGVVVTEEGTA  156



>ref|XP_008799379.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Phoenix 
dactylifera]
Length=361

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGT+LRPLT+S+PKPLV+FANKPMILHQIEAL+A GVTEV+LAINYQP+VM
Sbjct  1    MKALILVGGFGTQLRPLTISMPKPLVDFANKPMILHQIEALKATGVTEVILAINYQPQVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++FL+EFE++L I+I CSQE EP+GTAGPLALA++KL+ ++ +PFFVLNSD+  EYP KE
Sbjct  61   LSFLEEFESRLGIEITCSQENEPMGTAGPLALAKEKLLQEADKPFFVLNSDITCEYPLKE  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            M+EFH +HGGEASIMVTKV EPSKYGVVV++E++G
Sbjct  121  MLEFHNAHGGEASIMVTKVAEPSKYGVVVLDENSG  155



>dbj|BAP75927.1| GDP-mannose pyrophosphorylase, partial [Moringa oleifera]
Length=342

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +1

Query  250  SVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVMMNFLKEFETKLEIKIMCSQ  429
            S PKPLVEFANKPMILHQIEAL+A+GVTEVVLAINYQPEVM+NFLKEFE KL I I CSQ
Sbjct  1    SFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVMLNFLKEFEAKLGIMITCSQ  60

Query  430  ETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKV  609
            ETEPLGTAGPLALARDKL+D SG PFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKV
Sbjct  61   ETEPLGTAGPLALARDKLVDGSGAPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKV  120

Query  610  DEPSKYGVVVMEESTG  657
            DEPSKYGVVVMEESTG
Sbjct  121  DEPSKYGVVVMEESTG  136



>ref|XP_010438160.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Camelina sativa]
Length=358

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q P+V
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPDV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+K++E KLEIKI  SQETEPLGTAGPLALARDKL+D++G+PFFVLNSDVI EY   
Sbjct  61   MLNFVKDYEKKLEIKITFSQETEPLGTAGPLALARDKLVDETGQPFFVLNSDVICEYLLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            EMIEFHK++  EASIMVTKVD+PSKYGVVV EE+T 
Sbjct  121  EMIEFHKTNNAEASIMVTKVDDPSKYGVVVTEEATA  156



>gb|EMS68890.1| Mannose-1-phosphate guanyltransferase beta [Triticum urartu]
Length=412

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 146/206 (71%), Gaps = 51/206 (25%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQ-----------------------  303
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQ                       
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQVDKRLRLRLIEIVYYGAVSQISP  60

Query  304  ----------------------------IEALRAVGVTEVVLAINYQPEVMMNFLKEFET  399
                                        IEAL+ VGVTEV+LAINY+PEVM+NFLK+FE 
Sbjct  61   SFVVTNAEQVVQIRGKKNLLIKTYQFVQIEALKDVGVTEVILAINYRPEVMINFLKDFED  120

Query  400  KLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHG  579
            KL I I CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF E+I+FHKSHG
Sbjct  121  KLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAELIQFHKSHG  180

Query  580  GEASIMVTKVDEPSKYGVVVMEESTG  657
            GEA+IMVTKVDEPSKYGVVV E++TG
Sbjct  181  GEATIMVTKVDEPSKYGVVVTEDTTG  206



>ref|XP_010427339.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
 ref|XP_010427340.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
Length=356

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 137/155 (88%), Gaps = 5/155 (3%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+A+GV EV+LAINY+PE +
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVDEVILAINYEPEQL  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +       T L IKI CSQETEPLGTAGPLALARDKL+D SG+PFFVLNSDVISEYP +E
Sbjct  61   LVM-----TNLGIKITCSQETEPLGTAGPLALARDKLVDGSGQPFFVLNSDVISEYPLEE  115

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
             I FH +HGGEASIMVTKVDEPSKYGV+VMEE+TG
Sbjct  116  FIAFHNAHGGEASIMVTKVDEPSKYGVLVMEEATG  150



>ref|XP_010275250.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nelumbo 
nucifera]
Length=360

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLV+FANKP+ILHQIEAL+AVGV+EV+LAI+YQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSKPKPLVDFANKPIILHQIEALKAVGVSEVILAISYQPQVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             + L+EFE K+ IK+ CSQE EPLGTAGPLALAR+KLI + GEPFFVLNSD+I EYP KE
Sbjct  61   RSALEEFEVKVGIKVTCSQEMEPLGTAGPLALAREKLI-EFGEPFFVLNSDIICEYPLKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+H GEASI+VTKVDEPSKYGVVV++E  G
Sbjct  120  MIEFHKAHRGEASILVTKVDEPSKYGVVVLDEENG  154



>ref|XP_006412681.1| hypothetical protein EUTSA_v10025578mg [Eutrema salsugineum]
 gb|ESQ54134.1| hypothetical protein EUTSA_v10025578mg [Eutrema salsugineum]
Length=353

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINY-QPEV  369
            M+ALILVGG GTRLRPLTLS PKPLVEFANKPMILHQIEAL+A GVTE+VLAIN+ QPEV
Sbjct  1    MKALILVGGLGTRLRPLTLSTPKPLVEFANKPMILHQIEALKAAGVTEIVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLID-DSGEPFFVLNSDVISEYPF  546
            M+NF+KE+E KLE+KI  SQETEPLGTAGPLALARDKL+D +S EPFFVLNSD+I EYP 
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLVDEESSEPFFVLNSDIICEYPL  120

Query  547  KEMIEFHKSHGGEASIMVTKVDEPSKYG  630
             EMIEFHK+HG EASIMVTKVD+PSKYG
Sbjct  121  LEMIEFHKTHGAEASIMVTKVDDPSKYG  148



>ref|XP_002952855.1| hypothetical protein VOLCADRAFT_81984 [Volvox carteri f. nagariensis]
 gb|EFJ46105.1| hypothetical protein VOLCADRAFT_81984 [Volvox carteri f. nagariensis]
Length=360

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            MRALILVGG+GTRLRPLTLS PKPLVEFANKPMI+HQIEAL++ G TEVVLAINYQPEVM
Sbjct  1    MRALILVGGYGTRLRPLTLSCPKPLVEFANKPMIIHQIEALKSAGCTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            M F++E++ KL +KI+CSQE EP+GTAGPLALAR+ L D  G PFFVLNSDVI +YP K+
Sbjct  61   MGFIEEWQEKLGVKIVCSQEKEPMGTAGPLALARETLDDGKGTPFFVLNSDVICDYPLKD  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            M++FHK+ G EA+I+VTKVD+P+KYGVVVM+E
Sbjct  121  MLDFHKARGAEATILVTKVDDPTKYGVVVMDE  152



>gb|ACN88684.2| GDP-D-mannose pyrophosphorylase [Malus domestica]
Length=333

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +1

Query  277  ANKPMILHQIEALRAVGVTEVVLAINYQPEVMMNFLKEFETKLEIKIMCSQETEPLGTAG  456
            ANKPMILHQIEAL+A+GVTEVVLAINYQPEVMM FLKEFE K+ IKI CSQETEPLGTAG
Sbjct  1    ANKPMILHQIEALKAIGVTEVVLAINYQPEVMMTFLKEFEEKVGIKITCSQETEPLGTAG  60

Query  457  PLALARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVV  636
            PLALARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVV
Sbjct  61   PLALARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVV  120

Query  637  VMEESTG  657
            VMEESTG
Sbjct  121  VMEESTG  127



>ref|XP_001695916.1| GDP-D-mannose pyrophosphorylase [Chlamydomonas reinhardtii]
 gb|EDP01253.1| GDP-D-mannose pyrophosphorylase [Chlamydomonas reinhardtii]
Length=360

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            MRALILVGG+GTRLRPLTLS PKPLVEFANKPMI+HQIEAL+  G TEVVLAINYQPEVM
Sbjct  1    MRALILVGGYGTRLRPLTLSCPKPLVEFANKPMIIHQIEALKVAGCTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            + F++E++ KL ++I+CSQE EP+GTAGPLALAR+ L D  G PFFVLNSDVI +YP K+
Sbjct  61   LGFIQEWQEKLGVRIVCSQEKEPMGTAGPLALARETLDDGKGTPFFVLNSDVICDYPLKD  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            M++FHK+ G EA+I+VTKVD+P+KYGVVVM+E
Sbjct  121  MLDFHKARGAEATILVTKVDDPTKYGVVVMDE  152



>gb|KDP38962.1| hypothetical protein JCGZ_00719 [Jatropha curcas]
Length=355

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALIL GGFGT L PLT++VP+ LVEFANKP+IL+QIEAL+ VGV+EVVLAINY+ EV+
Sbjct  1    MKALILAGGFGTHLMPLTVTVPRALVEFANKPIILYQIEALKGVGVSEVVLAINYKQEVI  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            + FLKE E KL IKI CSQET+PLGTAG LALA+DKLID +GEPFFVLNSDVISEYP  E
Sbjct  61   LEFLKEHEKKLGIKITCSQETKPLGTAGSLALAKDKLIDGTGEPFFVLNSDVISEYPLME  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK HGG+ASIMVT+V +PSKYGVVV+ E+TG
Sbjct  121  MIEFHKGHGGQASIMVTEVIDPSKYGVVVIREATG  155



>emb|CDY05114.1| BnaC03g29120D [Brassica napus]
Length=263

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 132/153 (86%), Gaps = 10/153 (7%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KLE+KI  SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            EMIEFHK+H  EASIM         YGVVVMEE
Sbjct  121  EMIEFHKNHAAEASIM---------YGVVVMEE  144



>ref|XP_003610574.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
Length=350

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 129/156 (83%), Gaps = 19/156 (12%)
 Frame = +1

Query  211  VGGFGTRLRPLTLSVPKPLVEFANKPMILHQ-------IEALRAVGVTEVVLAINYQPEV  369
            +GGFGTRLRPLTL+ PKPLV+FANKPMILHQ       IEAL+A GVTEVVLAINYQPE 
Sbjct  18   LGGFGTRLRPLTLNFPKPLVDFANKPMILHQLKIYQGYIEALKATGVTEVVLAINYQPE-  76

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
                       L IKI CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVI EYP K
Sbjct  77   -----------LGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVICEYPLK  125

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            +MIEFHKSHGGEASIMVTKVDEPSKYGV V+EE+ G
Sbjct  126  QMIEFHKSHGGEASIMVTKVDEPSKYGVAVLEETAG  161



>emb|CDX90771.1| BnaA03g24510D [Brassica napus]
Length=347

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 132/153 (86%), Gaps = 10/153 (7%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            M+NF+KE+E KLE+KI  SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP  
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL  120

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            EMIEFHK+H  EASIM         YGVVVMEE
Sbjct  121  EMIEFHKNHAAEASIM---------YGVVVMEE  144



>gb|AGO64472.1| GDP-D-mannose pyrophosphorylase, partial [Rosa roxburghii]
Length=186

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  298  HQIEALRAVGVTEVVLAINYQPEVMMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARD  477
            HQIEAL+A+GVTEVVLAINYQPEVM+NFLKEFETK+ IKI CSQETEPLGTAGPLALARD
Sbjct  1    HQIEALKAIGVTEVVLAINYQPEVMLNFLKEFETKVGIKITCSQETEPLGTAGPLALARD  60

Query  478  KLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            KLID+SGEPFFVLNSDVIS+YP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG
Sbjct  61   KLIDESGEPFFVLNSDVISDYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  120



>ref|XP_005652260.1| GDP-D-mannose pyrophosphorylase [Coccomyxa subellipsoidea C-169]
 gb|EIE27716.1| GDP-D-mannose pyrophosphorylase [Coccomyxa subellipsoidea C-169]
Length=361

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGG+GTRLRPLTL+VPKP+V+FANKPMI+HQIEAL+  G  EVVLAINYQP+VM
Sbjct  1    MKALILVGGYGTRLRPLTLTVPKPIVDFANKPMIIHQIEALKNAGCNEVVLAINYQPKVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            M+FLKE+E KL IKI CSQE EP+GTAGPLALA + L D SG+PFFVLNSDVI E+P ++
Sbjct  61   MDFLKEWEEKLAIKITCSQEKEPMGTAGPLALASEILNDGSGDPFFVLNSDVICEFPLRD  120

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEES  651
            M+ FH+  G E +I+VT+V+EPSKYGVVV ++S
Sbjct  121  MLAFHRKTGAEGTILVTQVEEPSKYGVVVTDDS  153



>ref|XP_004368238.1| GDPmannose pyrophosphorylase [Acanthamoeba castellanii str. Neff]
 gb|ELR25483.1| GDPmannose pyrophosphorylase [Acanthamoeba castellanii str. Neff]
Length=359

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKPLVEFANK MILHQIEAL  VGV EVVLAINY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKAMILHQIEALVKVGVKEVVLAINYKPELM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             N+LK++E++L IKI  SQET+PLGTAGPLALAR+ ++++ GEPFFVLNSD+  EYP  +
Sbjct  61   ANYLKKYESELGIKISYSQETQPLGTAGPLALARE-ILEEDGEPFFVLNSDITCEYPLAD  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEES  651
            ++ FHK+HG E +IMVTKV+EPSKYGVVV++E 
Sbjct  120  LLAFHKNHGKEGTIMVTKVEEPSKYGVVVLKEG  152



>gb|AET14212.1| GDP-D-mannose pyrophosphorylase [Brassica rapa subsp. chinensis]
Length=329

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  289  MILHQIEALRAVGVTEVVLAINYQPEVMMNFLKEFETKLEIKIMCSQETEPLGTAGPLAL  468
            MILHQIEAL+AVGV EVVLAINYQPEVM+NFLK+FE KLEIKI CSQETEP+GTAGPLAL
Sbjct  1    MILHQIEALKAVGVDEVVLAINYQPEVMLNFLKDFEAKLEIKITCSQETEPMGTAGPLAL  60

Query  469  ARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            ARDKL+D SGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVM+E
Sbjct  61   ARDKLVDGSGEPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMDE  120

Query  649  STG  657
            +TG
Sbjct  121  TTG  123



>ref|XP_005851739.1| hypothetical protein CHLNCDRAFT_133102 [Chlorella variabilis]
 gb|EFN59637.1| hypothetical protein CHLNCDRAFT_133102 [Chlorella variabilis]
Length=368

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +1

Query  190  RMRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEV  369
            R +AL+LVGG+GTRLRPLTL+VPKP+++FAN+PMI+HQIEAL+  G  EVVLAINY+P+V
Sbjct  7    RPKALVLVGGYGTRLRPLTLTVPKPIIDFANRPMIVHQIEALKEAGCDEVVLAINYRPQV  66

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
            MM+FLKE+E KL IKI CSQE EP+GTAGPLALARD L +D G PFFVLNSDV+  YP K
Sbjct  67   MMDFLKEWEEKLGIKITCSQEPEPMGTAGPLALARDILHNDEGVPFFVLNSDVVCGYPMK  126

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            +M+E H   G EA+I+VTKV +PSKYGVVVM++  
Sbjct  127  QMMEAHLRTGAEATILVTKVSDPSKYGVVVMDDQN  161



>ref|XP_011399603.1| Mannose-1-phosphate guanyltransferase [Auxenochlorella protothecoides]
 gb|KFM26665.1| Mannose-1-phosphate guanyltransferase [Auxenochlorella protothecoides]
Length=372

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +1

Query  196  RALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVMM  375
            +AL+LVGG+GTRLRPLTL+VPKP+++F NKPMI HQIEAL+  G  EVVLAINY+P+VMM
Sbjct  13   KALVLVGGYGTRLRPLTLTVPKPIIDFGNKPMICHQIEALKEAGCDEVVLAINYRPQVMM  72

Query  376  NFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKEM  555
            +FLKE+E KL IKI CSQE EP+GTAGPLALAR  L D  G PFFVLNSDVI EYP KEM
Sbjct  73   DFLKEWEEKLGIKITCSQEPEPMGTAGPLALARHILEDGHGTPFFVLNSDVICEYPLKEM  132

Query  556  IEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            +E H++ G EA+I+VTKV++PSKYGVVV
Sbjct  133  LEVHRASGAEATILVTKVEDPSKYGVVV  160



>gb|AGC69739.1| mannose-1-phosphate guanylyltransferase [Dictyostelium lacteum]
Length=359

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSRPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             ++LK +E KL IKI  SQET PLGTAGPLALARD L D  GEPFFVLNSD+I ++PF +
Sbjct  61   SSYLKPYEEKLGIKISYSQETVPLGTAGPLALARDLLND--GEPFFVLNSDIICDFPFAD  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            ++ +HK+HGGE +IMVTKV+EPSKYGVVV +E  G
Sbjct  119  LLAYHKNHGGEGTIMVTKVEEPSKYGVVVYKEENG  153



>ref|XP_003287195.1| mannose-1-phosphate guanylyltransferase [Dictyostelium purpureum]
 gb|EGC36249.1| mannose-1-phosphate guanylyltransferase [Dictyostelium purpureum]
Length=359

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSKPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L+ +E KL IKI  S ET PLGTAGPLALARD L D  GEPFFVLNSD+I ++PF +
Sbjct  61   SAYLQPYEEKLGIKISYSHETVPLGTAGPLALARDLLND--GEPFFVLNSDIICDFPFAD  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            ++ FHK+HGGE +IMVTKV+EPSKYGVVV +E TG
Sbjct  119  LLAFHKNHGGEGTIMVTKVEEPSKYGVVVYKEETG  153



>ref|XP_637125.1| mannose-1-phosphate guanylyltransferase [Dictyostelium discoideum 
AX4]
 sp|Q54K39.1|GMPPB_DICDI RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: 
Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta [Dictyostelium 
discoideum]
 gb|EAL63618.1| mannose-1-phosphate guanylyltransferase [Dictyostelium discoideum 
AX4]
Length=359

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSKPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L+ +E KL IKI  S ET PLGTAGPLALARD L D  GEPFFVLNSD+I ++PF +
Sbjct  61   SQYLEPYEKKLGIKISYSHETVPLGTAGPLALARDLLND--GEPFFVLNSDIICDFPFAD  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            ++ FHKSHGGE +IMVTKV+EPSKYGVVV +E  G
Sbjct  119  LLAFHKSHGGEGTIMVTKVEEPSKYGVVVYKEENG  153



>ref|XP_009537794.1| hypothetical protein PHYSODRAFT_319613 [Phytophthora sojae]
 gb|EGZ07030.1| hypothetical protein PHYSODRAFT_319613 [Phytophthora sojae]
Length=359

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLVEF NK ++LHQIEAL AVGVTEV+LA+NYQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSIVLHQIEALVAVGVTEVILAVNYQPQVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L+  E K +IKI CS ETEPLGTAGPLALAR+ L  D G+PFFV NSDVI EY  ++
Sbjct  61   LAALESMEKKYQIKISCSHETEPLGTAGPLALARELL--DDGDPFFVFNSDVICEYRLQD  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
             ++FHK+HGGE ++MVT+VDEPSKYGVV+
Sbjct  119  FLDFHKAHGGEGTLMVTRVDEPSKYGVVI  147



>ref|XP_010432972.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
isoform X2 [Camelina sativa]
Length=353

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 127/156 (81%), Gaps = 6/156 (4%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEV  369
            M+ALILVGGFGTRLRPLT S+PKPLV+F NKPMILHQIEAL+A GVTEVVLAIN+Q P+V
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPDV  60

Query  370  MMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFK  549
                 +     +        ETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP  
Sbjct  61   TYTIFRNHNLTIH-----YSETEPLGTAGPLALARDKLVDESGQPFFVLNSDVICEYPLL  115

Query  550  EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            EMIEFHK++  EASIMVTKVD+PSKYGVVVME +T 
Sbjct  116  EMIEFHKTNNAEASIMVTKVDDPSKYGVVVMEAATA  151



>ref|XP_006408596.1| hypothetical protein EUTSA_v10002042mg [Eutrema salsugineum]
 gb|ESQ50049.1| hypothetical protein EUTSA_v10002042mg [Eutrema salsugineum]
Length=326

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 1/135 (1%)
 Frame = +1

Query  253  VPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEVMMNFLKEFETKLEIKIMCSQ  429
            +PKPLV+F NKPMILHQIEAL+  GVTEVVLAIN+Q PEVM+NF+KE+E KL+IKI  SQ
Sbjct  1    MPKPLVDFGNKPMILHQIEALKDAGVTEVVLAINHQQPEVMLNFVKEYEKKLDIKITFSQ  60

Query  430  ETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKV  609
            ETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP  EMIEFHK HG EASIMVTKV
Sbjct  61   ETEPLGTAGPLALARDKLVDESGKPFFVLNSDVICEYPLLEMIEFHKIHGAEASIMVTKV  120

Query  610  DEPSKYGVVVMEEST  654
            D+PS+YGVVVMEE+T
Sbjct  121  DDPSEYGVVVMEETT  135



>dbj|BAN16547.1| ADB2008858, partial [Acytostelium subglobosum]
 dbj|GAM21573.1| hypothetical protein SAMD00019534_047480, partial [Acytostelium 
subglobosum LB1]
Length=366

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = +1

Query  184  DLRMRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQP  363
            +++M+ALILVGGFGTRLRPLTLSVPKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P
Sbjct  5    NIKMKALILVGGFGTRLRPLTLSVPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRP  64

Query  364  EVMMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP  543
            ++M  +L+ +  KL IKI  S ET PLGTAGPLALARD L D  G+PFFVLNSD+I ++P
Sbjct  65   QLMSAYLEPYAEKLGIKISYSHETTPLGTAGPLALARDLLND--GQPFFVLNSDIICDFP  122

Query  544  FKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            F +++ +HK+HG E +IMVTKV+EPSKYGVVV +E +G
Sbjct  123  FADLLAYHKAHGKEGTIMVTKVEEPSKYGVVVYKEDSG  160



>ref|XP_008903956.1| hypothetical protein PPTG_09918 [Phytophthora parasitica INRA-310]
 gb|ETI48632.1| hypothetical protein F443_07367 [Phytophthora parasitica P1569]
 gb|ETI48660.1| hypothetical protein F443_07363 [Phytophthora parasitica P1569]
 gb|ETK88560.1| hypothetical protein L915_07220 [Phytophthora parasitica]
 gb|ETL41954.1| hypothetical protein L916_07172 [Phytophthora parasitica]
 gb|ETL95106.1| hypothetical protein L917_07061 [Phytophthora parasitica]
 gb|ETM48339.1| hypothetical protein L914_07131 [Phytophthora parasitica]
 gb|ETN10852.1| hypothetical protein PPTG_09918 [Phytophthora parasitica INRA-310]
 gb|ETO77385.1| hypothetical protein F444_07427 [Phytophthora parasitica P1976]
 gb|ETP18433.1| hypothetical protein F441_07370 [Phytophthora parasitica CJ01A1]
 gb|ETP46326.1| hypothetical protein F442_07420 [Phytophthora parasitica P10297]
Length=359

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLVEF NK +++HQIEAL AVGVTEV+LA+NYQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSIVMHQIEALVAVGVTEVILAVNYQPQVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L+  E K  IKI CS ETEPLGTAGPLALAR+ L  D G+PFFV NSDVI EY  ++
Sbjct  61   LAALESMEKKYNIKISCSHETEPLGTAGPLALARELL--DDGDPFFVFNSDVICEYRLQD  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
             ++FHK+HG E +IMVT+VDEPSKYGVV+
Sbjct  119  FLDFHKAHGAEGTIMVTRVDEPSKYGVVI  147



>ref|XP_002899327.1| mannose-1-phosphate guanyltransferase beta, putative [Phytophthora 
infestans T30-4]
 gb|EEY62296.1| mannose-1-phosphate guanyltransferase beta, putative [Phytophthora 
infestans T30-4]
Length=359

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLVEF NK +++HQIEAL AVGVTEV+LA+NYQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSIVMHQIEALVAVGVTEVILAVNYQPQVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L+  E K  IKI CS ETEPLGTAGPLALAR+ L  D G+PFFV NSDVI EY  ++
Sbjct  61   LAALESMEKKYHIKISCSHETEPLGTAGPLALARELL--DDGDPFFVFNSDVICEYRLED  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
             ++FHK+HG E +IMVT+VDEPSKYGVV+
Sbjct  119  FLDFHKAHGAEGTIMVTRVDEPSKYGVVI  147



>emb|CCA19060.1| mannose1phosphate guanyltransferase beta putative [Albugo laibachii 
Nc14]
Length=359

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS PKPLVEF NK +++HQIEAL AVGVTEVVLA+NYQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSVVVHQIEALVAVGVTEVVLAVNYQPQVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L   E K  IKI CS E+EPLGTAGPLALA+D L  D G+PFFVLNSDVI EYP + 
Sbjct  61   LQALSSMEEKYHIKISCSHESEPLGTAGPLALAKDLL--DDGDPFFVLNSDVICEYPLEA  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
             + FH+SH GE +IMVT+V+EPSKYGV++ ++
Sbjct  119  FLRFHQSHSGEGTIMVTRVEEPSKYGVILSDQ  150



>ref|XP_011019240.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
 ref|XP_011006397.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
Length=329

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +1

Query  301  QIEALRAVGVTEVVLAINYQPEVMMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDK  480
            QIEAL+A+GVTEVVLAINYQPEVM+NFLKE+E KLEIKI CSQETEPLGTAGPLALARDK
Sbjct  5    QIEALKAIGVTEVVLAINYQPEVMLNFLKEYEKKLEIKITCSQETEPLGTAGPLALARDK  64

Query  481  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            LIDD+G PFFVLNSDVISEYP K+MIEFHK HGGEASIMVTKVDEPSKYGVV++EE++G
Sbjct  65   LIDDTGAPFFVLNSDVISEYPLKQMIEFHKGHGGEASIMVTKVDEPSKYGVVLLEETSG  123



>emb|CEJ05128.1| Putative Mannose-1-phosphate guanyltransferase [Rhizopus microsporus]
Length=273

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLSKAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L+E+E +  +KI  S ETEPLGTAGPLALARD L  D   PFFVLNSDVI +YPF++
Sbjct  61   VAALQEYEKEYNVKITFSVETEPLGTAGPLALARDILGKDDS-PFFVLNSDVICDYPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FHKSHG E +I+VTKVD+PSKYGVVV
Sbjct  120  IRDFHKSHGNEGTIIVTKVDDPSKYGVVV  148



>ref|XP_007790760.1| putative mannose-1-phosphate guanyltransferase protein [Eutypa 
lata UCREL1]
 gb|EMR70143.1| putative mannose-1-phosphate guanyltransferase protein [Eutypa 
lata UCREL1]
Length=170

 Score =   213 bits (543),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMI+HQIEAL AVGVT+VVLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTMPKPLVEFANKPMIMHQIEALAAVGVTDVVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
               L E+  KL +KI  S E EPLGTAGPL LA ++++  + EPFFVLNSDV  EYPFKE
Sbjct  61   ERVLGEYGDKLGVKIHFSLEPEPLGTAGPLKLA-EEILSKNDEPFFVLNSDVTCEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + EFHK+HG E +I+VTKV+EPSKYGV+V
Sbjct  120  IAEFHKAHGEEGTIVVTKVEEPSKYGVIV  148



>ref|XP_002174350.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB08057.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
japonicus yFS275]
Length=363

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF NKPMILHQ+EAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMILHQVEALAAAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  +KI  S E EPLGTAGPLALARD L  D   PFFVLNSDVI +YPF +
Sbjct  61   VQALKKYEAEYNVKITFSVENEPLGTAGPLALARDVLGKDD-SPFFVLNSDVICDYPFAD  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FHKSHG E +I+VTKVDEPSKYGVVV
Sbjct  120  LAKFHKSHGREGTIVVTKVDEPSKYGVVV  148



>ref|XP_004353971.1| mannose-1-phosphate guanylyltransferase [Dictyostelium fasciculatum]
 gb|EGG14534.1| mannose-1-phosphate guanylyltransferase [Dictyostelium fasciculatum]
Length=359

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L+ +  KL IKI  S ET PLGTAGPLALARD L D  G+PFFVLNSD+I ++PF +
Sbjct  61   SAYLEPYAEKLGIKISYSHETTPLGTAGPLALARDLLND--GQPFFVLNSDIICDFPFGD  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            ++++HK+HG E +IMVTKV+EPSKYGVVV +E  G
Sbjct  119  LLQYHKAHGKEGTIMVTKVEEPSKYGVVVYKEENG  153



>ref|XP_004347896.1| mannose-1-phosphate guanyltransferase beta [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE93259.1| mannose-1-phosphate guanyltransferase beta [Capsaspora owczarzaki 
ATCC 30864]
Length=359

 Score =   219 bits (557),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL +PKPLVEFANKPM+LHQ+EAL   GVT V+LA+NY+ EVM
Sbjct  1    MKALILVGGFGTRLRPLTLGLPKPLVEFANKPMLLHQVEALVKAGVTHVILAVNYRAEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
               L+ FE    IKI  SQETEPLGTAGPLALARD ++++   PFFVLNSDVI ++PF+E
Sbjct  61   EKELRSFEQTYNIKISISQETEPLGTAGPLALARD-ILNEGDSPFFVLNSDVICDFPFEE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            M+ FHK+HG E +I+VTKVDEPSKYGVVV
Sbjct  120  MVAFHKAHGKEGTILVTKVDEPSKYGVVV  148



>gb|EPY51214.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
cryophilus OY26]
Length=363

 Score =   219 bits (557),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E + ++KI  S E EPLGTAGPLALARD L  DS  PFFVLNSDVI EYPF +
Sbjct  61   VQALKKYEEEYKVKITFSVENEPLGTAGPLALARDILGKDS-SPFFVLNSDVICEYPFAD  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FHK+HG E +I+VTKV++PSKYGVVV
Sbjct  120  LAKFHKAHGAEGTIVVTKVEDPSKYGVVV  148



>gb|EFA80657.1| mannose-1-phosphate guanylyltransferase [Polysphondylium pallidum 
PN500]
Length=359

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L+ +  KL IKI  S ET PLGTAGPLALARD L D  G+PFFVLNSD+I ++PF +
Sbjct  61   SAYLEPYAEKLGIKISYSHETTPLGTAGPLALARDLLND--GQPFFVLNSDIICDFPFGD  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            ++ FHK+HG E +IMVTKV+EPSKYGVVV +E  G
Sbjct  119  LLAFHKAHGKEGTIMVTKVEEPSKYGVVVYKEDDG  153



>ref|XP_006284084.1| hypothetical protein CARUB_v10005214mg [Capsella rubella]
 gb|EOA16982.1| hypothetical protein CARUB_v10005214mg [Capsella rubella]
Length=332

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = +1

Query  253  VPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEVMMNFLKEFETKLEIKIMCSQ  429
            +PKPLV+F NKPMILHQIEAL+A GV+EVVLAIN Q PE+M+NF+KE+E KLEIKI  SQ
Sbjct  1    MPKPLVDFGNKPMILHQIEALKAAGVSEVVLAINQQQPELMLNFVKEYEKKLEIKITFSQ  60

Query  430  ETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKV  609
            ETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP  EMIEFHK++  EASIMVTKV
Sbjct  61   ETEPLGTAGPLALARDKLLDESGQPFFVLNSDVICEYPLLEMIEFHKTNCAEASIMVTKV  120

Query  610  DEPSKYGVVVMEEST  654
            D+PSKYGVVV EE+T
Sbjct  121  DDPSKYGVVVTEEAT  135



>ref|NP_194786.1| Glucose-1-phosphate adenylyltransferase family protein [Arabidopsis 
thaliana]
 sp|Q8H1Q7.1|GMPP3_ARATH RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
3 [Arabidopsis thaliana]
 gb|AAN13073.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE85782.1| Glucose-1-phosphate adenylyltransferase family protein [Arabidopsis 
thaliana]
Length=331

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = +1

Query  253  VPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQ-PEVMMNFLKEFETKLEIKIMCSQ  429
            +PKPLV+F NKPMILHQIEAL+  GVTEVVLAIN+Q PEVM+NF+KE+E KLEIKI  SQ
Sbjct  1    MPKPLVDFGNKPMILHQIEALKGAGVTEVVLAINHQQPEVMLNFVKEYEKKLEIKITFSQ  60

Query  430  ETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKV  609
            ETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP  EMIEFHK++  EASIMVT+V
Sbjct  61   ETEPLGTAGPLALARDKLVDESGQPFFVLNSDVICEYPLLEMIEFHKTNRAEASIMVTEV  120

Query  610  DEPSKYGVVVMEESTG  657
            D+PSKYGVVV EE T 
Sbjct  121  DDPSKYGVVVTEEGTA  136



>emb|CEG73578.1| Putative Mannose-1-phosphate guanyltransferase [Rhizopus microsporus]
Length=363

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLSKAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L+E+E +  +KI  S ETEPLGTAGPLALARD L  D   PFFVLNSDVI +YPF++
Sbjct  61   VAALQEYEKEYNVKITFSVETEPLGTAGPLALARDILGKDD-SPFFVLNSDVICDYPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FHKSHG E +I+VTKVD+PSKYGVVV
Sbjct  120  IRDFHKSHGNEGTIIVTKVDDPSKYGVVV  148



>gb|EGA87676.1| Psa1p [Saccharomyces cerevisiae VL3]
Length=253

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPFKE
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNS-PFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>gb|EGA75738.1| Psa1p [Saccharomyces cerevisiae AWRI796]
Length=253

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPFKE
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNS-PFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>gb|EGA59462.1| Psa1p [Saccharomyces cerevisiae FostersB]
 gb|EGA83697.1| Psa1p [Saccharomyces cerevisiae Lalvin QA23]
Length=253

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPFKE
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNS-PFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>ref|XP_005706305.1| mannose-1-phosphate guanylyltransferase [Galdieria sulphuraria]
 gb|EME29785.1| mannose-1-phosphate guanylyltransferase [Galdieria sulphuraria]
Length=358

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGG+GTRLRPLTLS PKPLVEF NKPM+ HQIEAL AVGV EVVLA++YQP+ M
Sbjct  1    MKALILVGGYGTRLRPLTLSYPKPLVEFCNKPMVFHQIEALAAVGVNEVVLAVSYQPQAM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             +FL+  + KL IKI CS+ETEPLGTAGP+ LA   L D  GEPFFVLNSD+I +YPF++
Sbjct  61   QDFLESEQQKLGIKITCSRETEPLGTAGPIKLAESLLND--GEPFFVLNSDIICDYPFQK  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
            M++FH+ HGG  +I+VT+V+EPSKYGVV+ ++
Sbjct  119  MLDFHRKHGGIGTILVTQVEEPSKYGVVLFDK  150



>emb|CEI86119.1| Putative Mannose-1-phosphate guanyltransferase [Rhizopus microsporus]
Length=389

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLAKAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LKE+E +  +KI  S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF++
Sbjct  61   VAALKEYEKQYNVKITFSVETEPLGTAGPLALAREILAKDDS-PFFVLNSDVICDYPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FH +HGGE +I VTKVD+PSKYGVVV   S+
Sbjct  120  LRDFHLAHGGEGTIAVTKVDDPSKYGVVVNRPSS  153



>ref|XP_447012.1| hypothetical protein [Candida glabrata CBS 138]
 sp|Q6FRY2.1|MPG12_CANGA RecName: Full=Mannose-1-phosphate guanyltransferase 2; AltName: 
Full=ATP-mannose-1-phosphate guanylyltransferase 2; AltName: 
Full=GDP-mannose pyrophosphorylase 2 [Candida glabrata CBS 
138]
 emb|CAG59945.1| unnamed protein product [Candida glabrata]
Length=361

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTLSVPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLSVPKPLVEFCNRPMILHQIEALAEAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++ LK++E +  + I  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPFKE
Sbjct  61   VDTLKKYEKEYGVNITFSVETEPLGTAGPLKLA-EKILKKDNSPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + EFHKSHGG+ +I+ TKVDEPSKYGV+V +  T
Sbjct  120  LAEFHKSHGGKGTIVATKVDEPSKYGVIVHDLGT  153



>dbj|GAM18590.1| hypothetical protein SAMD00019534_017650 [Acytostelium subglobosum 
LB1]
Length=359

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLSVPKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L+ +  KL IKI  S ET PLGTAGPLALAR+ L D  G+PFFVLNSD+I ++PF +
Sbjct  61   SAYLEPYAQKLGIKISYSHETTPLGTAGPLALARELLND--GQPFFVLNSDIICDFPFAD  118

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            ++ +HK+HG E +IMVTKV+EPSKYGVVV +E  G
Sbjct  119  LLAYHKAHGKEGTIMVTKVEEPSKYGVVVYKEEDG  153



>dbj|BAO41930.1| mannose-1-phosphate guanyltransferase [Kluyveromyces marxianus 
DMKU3-1042]
 dbj|BAP73354.1| mannose-1-phosphate guanyltransferase [Kluyveromyces marxianus]
Length=361

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI +YPFKE
Sbjct  61   VETLKKYEEEYGVSITFSVETEPLGTAGPLKLAEDVLKKDN-SPFFVLNSDVICDYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>gb|EJU01665.1| mannose-1-phosphate guanylyltransferase [Dacryopinax sp. DJM-731 
SS1]
Length=364

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIEALVEAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L++ E +  IKI  S E+EPLGTAGPLALARD L  D   PFFVLN+DV   YPFK+
Sbjct  61   VKVLEKVEEQYNIKITFSVESEPLGTAGPLALARDILAKDD-SPFFVLNADVTCAYPFKQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVME  645
            + EFHKSHG E +I+VTKV EPSKYGV+V +
Sbjct  120  LAEFHKSHGNEGTILVTKVAEPSKYGVIVSQ  150



>gb|EIE84524.1| mannose-1-phosphate guanyltransferase [Rhizopus delemar RA 99-880]
Length=355

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLSKAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LKE+E +  + I  S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF++
Sbjct  61   VAALKEYEKEYNVNITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDVICDYPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVME  645
            + +FHKSHG E +I+VTKVD+PSKYGVVV +
Sbjct  120  IRDFHKSHGNEGTIIVTKVDDPSKYGVVVNQ  150



>dbj|BAA13790.1| unnamed protein product [Schizosaccharomyces pombe]
Length=363

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF NKPMILHQ+EAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMILHQVEALAAAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S E EPLGTAGPLALARD L  D   PFFVLNSDVI EYPF +
Sbjct  61   VEALKKYEKEYNVNITFSVENEPLGTAGPLALARDILAKDH-SPFFVLNSDVICEYPFAD  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            +  FHK+HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAAFHKAHGAEGTIVVTKVEEPSKYGVVV  148



>gb|EIE79690.1| mannose-1-phosphate guanyltransferase [Rhizopus delemar RA 99-880]
Length=363

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLSKAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LKE+E +  + I  S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF++
Sbjct  61   VAALKEYEKEYNVNITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDVICDYPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FHKSHG E +I+VTKVD+PSKYGVVV
Sbjct  120  IRDFHKSHGNEGTIIVTKVDDPSKYGVVV  148



>ref|NP_588405.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
pombe 972h-]
 sp|O74484.1|MPG1_SCHPO RecName: Full=Mannose-1-phosphate guanyltransferase; AltName: 
Full=GDP-mannose pyrophosphorylase; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase [Schizosaccharomyces pombe 
972h-]
 emb|CAA20770.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
pombe]
Length=363

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF NKPMILHQ+EAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMILHQVEALAAAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S E EPLGTAGPLALARD L  D   PFFVLNSDVI EYPF +
Sbjct  61   VEALKKYEKEYNVNITFSVENEPLGTAGPLALARDILAKDH-SPFFVLNSDVICEYPFAD  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            +  FHK+HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAAFHKAHGAEGTIVVTKVEEPSKYGVVV  148



>emb|CDR44464.1| CYFA0S14e02960g1_1 [Cyberlindnera fabianii]
Length=362

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEFAN+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFANRPMILHQIEALAKAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +N LK++E +  + I  S ETEPLGTAGPL LA + L  D   PFFVLNSDVI EYPF+E
Sbjct  61   VNTLKKYEEEYGVSITFSVETEPLGTAGPLKLAEEVLKKDD-SPFFVLNSDVICEYPFEE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            ++ FHK+HGG  +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LVAFHKAHGGRGTIVATKVDEPSKYGVIVHDIAT  153



>emb|CCX14363.1| Similar to Mannose-1-phosphate guanyltransferase; acc. no. Q5B1J4 
[Pyronema omphalodes CBS 100304]
Length=364

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF N+PMILHQ+EAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQVEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +N L+++E +  +KI  S ETEPLGTAGPL LA + L  D   PFFVLNSDVI EYPF+ 
Sbjct  61   INVLQKYEEEYNVKITFSVETEPLGTAGPLKLAGEILGKDD-SPFFVLNSDVICEYPFQA  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVME  645
            +  FHKSHG E +I+VTKVDEPSKYGVVV E
Sbjct  120  LAAFHKSHGQEGTIVVTKVDEPSKYGVVVHE  150



>ref|XP_001642832.1| hypothetical protein Kpol_414p7 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO14974.1| hypothetical protein Kpol_414p7 [Vanderwaltozyma polyspora DSM 
70294]
Length=361

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEFAN+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFANRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA + L  D+  PFFVLNSDVI EYPFKE
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEEVLKKDN-SPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + ST
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIST  153



>gb|KIV83904.1| mannose-1-phosphate guanyltransferase [Exophiala sideris]
Length=364

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFAN+PMILHQ+EAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQVEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
               LK++E K  +KI  S E+EPLGTAGPL LA +K++     PFFVLNSDVI EYPFKE
Sbjct  61   TAALKKYEEKYNVKITFSVESEPLGTAGPLKLA-EKILGKDDNPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + EFH SHG E +I+VTKV+EPSKYGV+V
Sbjct  120  LAEFHNSHGEEGTIVVTKVEEPSKYGVIV  148



>ref|NP_010228.1| mannose-1-phosphate guanylyltransferase [Saccharomyces cerevisiae 
S288c]
 sp|P41940.2|MPG1_YEAST RecName: Full=Mannose-1-phosphate guanyltransferase; AltName: 
Full=ATP-mannose-1-phosphate guanylyltransferase; AltName: 
Full=GDP-mannose pyrophosphorylase; AltName: Full=NDP-hexose 
pyrophosphorylase [Saccharomyces cerevisiae S288c]
 gb|AAC49289.1| Psa1p [Saccharomyces cerevisiae]
 emb|CAA98617.1| PSA1 [Saccharomyces cerevisiae]
 gb|EDN60300.1| GDP-mannose pyrophosphorylase [Saccharomyces cerevisiae YJM789]
 gb|EDV08332.1| GDP-mannose pyrophosphorylase [Saccharomyces cerevisiae RM11-1a]
 gb|EDZ73286.1| YDL055Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU05989.1| Psa1p [Saccharomyces cerevisiae JAY291]
 emb|CAY78453.1| Psa1p [Saccharomyces cerevisiae EC1118]
 tpg|DAA11801.1| TPA: mannose-1-phosphate guanylyltransferase [Saccharomyces cerevisiae 
S288c]
 gb|EGA79694.1| Psa1p [Saccharomyces cerevisiae Vin13]
 dbj|GAA22191.1| K7_Psa1p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EHN07969.1| Psa1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW11154.1| Psa1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG87021.1| Psa1p [Saccharomyces cerevisiae R008]
 gb|EWG91731.1| Psa1p [Saccharomyces cerevisiae P301]
 gb|EWG96943.1| Psa1p [Saccharomyces cerevisiae R103]
 gb|AHY74952.1| Psa1p [Saccharomyces cerevisiae YJM993]
 gb|AJP37691.1| Psa1p [Saccharomyces cerevisiae YJM1078]
Length=361

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPFKE
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDN-SPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>ref|XP_006682149.1| hypothetical protein BATDEDRAFT_20856 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77188.1| hypothetical protein BATDEDRAFT_20856 [Batrachochytrium dendrobatidis 
JAM81]
Length=360

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFAN+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQIEALVKAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
             NF+  +E +L + I  S ETEPLGTAGPLALA D ++  + +PFFVLNSDVI ++PF+E
Sbjct  61   ANFIATYEAQLGVHITFSVETEPLGTAGPLALASD-VLGKNDDPFFVLNSDVICDFPFEE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            M  FHKSHG E +++VT+V+EPSKYGVV+
Sbjct  120  MAAFHKSHGNEGTLLVTRVEEPSKYGVVI  148



>gb|EPX73569.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
octosporus yFS286]
Length=363

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF N+PMILHQ+EAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQVEALAAAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E + +++I  S E EPLGTAGPLALARD L  D+  PFFVLNSDVI EYPF +
Sbjct  61   VQALKKYEEEYKVRITFSVENEPLGTAGPLALARDILGKDN-SPFFVLNSDVICEYPFGD  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FHK+HG E +I+VTKV++PSKYGVVV
Sbjct  120  LAKFHKAHGAEGTIVVTKVEDPSKYGVVV  148



>ref|XP_011102864.1| psa1p [Saccharomyces arboricola H-6]
 gb|EJS44385.1| psa1p [Saccharomyces arboricola H-6]
Length=361

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E++  + I  S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPF+E
Sbjct  61   VETLKKYESEYGVNITFSVETEPLGTAGPLKLAEDVLKKDN-SPFFVLNSDVICEYPFQE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>ref|XP_011273620.1| Mannose-1-phosphate guanyltransferase [Wickerhamomyces ciferrii]
 emb|CCH44528.1| Mannose-1-phosphate guanyltransferase [Wickerhamomyces ciferrii]
Length=362

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEFAN+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFANRPMILHQIEALAKAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L+++E +  + I  S ETEPLGTAGPL LA D L  D   PFFVLNSDVI EYPF+E
Sbjct  61   VETLQKYEKEYGVSITFSVETEPLGTAGPLKLAEDVLKKDK-SPFFVLNSDVICEYPFEE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + ST
Sbjct  120  LAKFHKAHGGQGTIVATKVDEPSKYGVIVHDIST  153



>ref|XP_009650791.1| mannose-1-phosphate guanyltransferase [Verticillium dahliae VdLs.17]
 gb|EGY14437.1| mannose-1-phosphate guanyltransferase [Verticillium dahliae VdLs.17]
Length=364

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+A+ILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIEAL A GVT+VVLA+NY+PE+M
Sbjct  1    MKAIILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIEALAAAGVTDVVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
               L E+E +  IKI  S ETEPLGTAGPL LA D L  D   PFFVLNSDVI +YPF++
Sbjct  61   EKHLAEYEERFGIKITFSIETEPLGTAGPLKLAEDVLAKDDA-PFFVLNSDVICDYPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FHK+HG E +I+VTKV+EPSKYGV+V
Sbjct  120  LAQFHKNHGEEGTIVVTKVEEPSKYGVIV  148



>gb|KIW41620.1| mannose-1-phosphate guanyltransferase, variant [Exophiala oligosperma]
Length=364

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFAN+PMILHQ+EAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQVEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
               LK++E +  +KI  S ETEPLGTAGPL LA +K++    +PFFVLNSDVI EYPF++
Sbjct  61   TGALKQYEERYNVKITFSVETEPLGTAGPLKLA-EKILGRDDKPFFVLNSDVICEYPFRQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEES  651
            + +FH SHG E +I+VTKV+EPSKYGV+V + S
Sbjct  120  LADFHASHGDEGTIVVTKVEEPSKYGVIVHKPS  152



>emb|CEP07577.1| hypothetical protein [Parasitella parasitica]
Length=363

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLAKAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  L+E+E    +KI  S ETEPLGTAGPLALARD L  D   PFFVLNSD+I ++PF++
Sbjct  61   VAALQEYEAIYNVKITFSVETEPLGTAGPLALARDILAKDD-SPFFVLNSDIICDFPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FH SHGG+ +I VTKVD+PSKYGVVV
Sbjct  120  LRDFHLSHGGQGTIAVTKVDDPSKYGVVV  148



>emb|CDH17206.1| Mannose-1-phosphate guanyltransferase [Zygosaccharomyces bailii 
ISA1307]
 emb|CDH10960.1| Mannose-1-phosphate guanyltransferase [Zygosaccharomyces bailii 
ISA1307]
Length=361

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF+E
Sbjct  61   VETLKKYEKEYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPFQE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>gb|EIE85443.1| mannose-1-phosphate guanyltransferase [Rhizopus delemar RA 99-880]
Length=361

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLAKAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LKE+E +  ++I  S ETEPLGTAGPLALARD L  D   PFFVLNSDVI +YPF++
Sbjct  61   VAALKEYEEEYNVRITFSVETEPLGTAGPLALARDILAKDD-SPFFVLNSDVICDYPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FH +HG E +I VTKVD+PSKYGVVV + ++
Sbjct  120  LRDFHLAHGAEGTIAVTKVDDPSKYGVVVNKSNS  153



>gb|KIW14322.1| mannose-1-phosphate guanyltransferase [Exophiala spinifera]
Length=364

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFAN+PMILHQ+EAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQVEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
               LK++E    +KI  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPFK+
Sbjct  61   TGALKKYEELYNVKITFSVETEPLGTAGPLKLA-EKILGKDDTPFFVLNSDVICEYPFKQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + EFH SHG E +I+VTKV+EPSKYGV+V
Sbjct  120  LAEFHNSHGDEGTIVVTKVEEPSKYGVIV  148



>ref|XP_002151296.1| mannose-1-phosphate guanylyltransferase [Talaromyces marneffei 
ATCC 18224]
 gb|EEA20296.1| mannose-1-phosphate guanylyltransferase [Talaromyces marneffei 
ATCC 18224]
 gb|KFX48572.1| Mannose-1-phosphate guanyltransferase [Talaromyces marneffei 
PM1]
Length=364

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF N+PMILHQ+E+L A GVT++VLA+NY+P+VM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQVESLAAAGVTDIVLAVNYRPDVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++ LK++E +  I I  S E+EPLGTAGPL LA +K++     PFFVLNSDVI EYPFK+
Sbjct  61   VSALKKYEEQYNINIEFSVESEPLGTAGPLKLA-EKILGKDDSPFFVLNSDVICEYPFKQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + EFHKSHG E +I+VTKVDEPSKYGVVV
Sbjct  120  LAEFHKSHGDEGTIVVTKVDEPSKYGVVV  148



>emb|CDF91365.1| ZYBA0S11-01222g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=361

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF+E
Sbjct  61   VETLKKYEKEYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPFQE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>ref|XP_002670915.1| predicted protein [Naegleria gruberi]
 gb|EFC38171.1| predicted protein [Naegleria gruberi]
Length=374

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  187  LRMRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPE  366
            ++++ALILVGG+GTRLRPLT S  KPL+ FANKP+++HQIEAL+  G TE+VLA+NY+P+
Sbjct  1    MKVKALILVGGYGTRLRPLTFSTAKPLIHFANKPIVVHQIEALKKAGCTEIVLAVNYKPQ  60

Query  367  VMMNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  546
             M++ +K++E K ++KI  S E EPLGTAGPLALARD L+ D  E FFVLNSDVI EY F
Sbjct  61   EMIDAMKKYEEKYQVKITYSVENEPLGTAGPLALARDILVADENEYFFVLNSDVICEYSF  120

Query  547  KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE  648
             E++++HK HG E +IMVTKVD+PSKYGVVV ++
Sbjct  121  DELLDYHKYHGKEGTIMVTKVDDPSKYGVVVTQD  154



>gb|KFY75477.1| hypothetical protein V499_04519 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFZ06137.1| hypothetical protein V501_07694 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=364

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF NK MILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L E+E +  +KI  S ETEPLGTAGPL LA +K +  + EPFFVLNSDVI EYPF E
Sbjct  61   EKYLAEYEEQYNVKITFSIETEPLGTAGPLKLA-EKTLGKNNEPFFVLNSDVICEYPFAE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            +  FHK+HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAAFHKAHGDEGTIIVTKVEEPSKYGVVV  148



>gb|KFY61094.1| hypothetical protein V496_05148 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=364

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF NK MILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L E+E +  +KI  S ETEPLGTAGPL LA +K +  + EPFFVLNSDVI EYPF E
Sbjct  61   EKYLAEYEEQYNVKITFSIETEPLGTAGPLKLA-EKTLGKNNEPFFVLNSDVICEYPFAE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            +  FHK+HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAAFHKAHGDEGTIIVTKVEEPSKYGVVV  148



>gb|ELR08715.1| mannose-1-phosphate guanyltransferase [Pseudogymnoascus destructans 
20631-21]
Length=364

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF NK MILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L E+E +  +KI  S ETEPLGTAGPL LA +K +  + EPFFVLNSDVI EYPF E
Sbjct  61   EKYLAEYEEQYNVKITFSIETEPLGTAGPLKLA-EKTLAKNNEPFFVLNSDVICEYPFAE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            +  FHK+HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAAFHKAHGDEGTIIVTKVEEPSKYGVVV  148



>emb|CEI86118.1| Putative Mannose-1-phosphate guanyltransferase [Rhizopus microsporus]
Length=443

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLAKAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LKE+E +  +KI  S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF++
Sbjct  61   VAALKEYEKQYNVKITFSVETEPLGTAGPLALAREILAKDD-SPFFVLNSDVICDYPFEQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FH +HGGE +I VTKVD+PSKYGVVV
Sbjct  120  LRDFHLAHGGEGTIAVTKVDDPSKYGVVV  148



>gb|AAA69677.1| mannose-1-phosphate guanyltransferase [Saccharomyces cerevisiae]
Length=361

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++ LA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIALAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPFKE
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDN-SPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + +FHK+HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LADFHKAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>gb|KFY85514.1| hypothetical protein V500_08352 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFY86261.1| hypothetical protein V498_07559 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
 gb|KFZ16574.1| hypothetical protein V502_05027 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=364

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF NK MILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L E+E +  +KI  S ETEPLGTAGPL LA +K +  + EPFFVLNSDVI EYPF E
Sbjct  61   EKYLAEYEEQYNVKITFSIETEPLGTAGPLKLA-EKTLGKNNEPFFVLNSDVICEYPFAE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            +  FHK+HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAAFHKAHGDEGTIIVTKVEEPSKYGVVV  148



>gb|KFX86865.1| hypothetical protein V490_08766 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFX95242.1| hypothetical protein O988_05892 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY38163.1| hypothetical protein V495_06723 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY55162.1| hypothetical protein V497_07165 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=364

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF NK MILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              +L E+E +  +KI  S ETEPLGTAGPL LA +K +  + EPFFVLNSDVI EYPF E
Sbjct  61   EKYLAEYEEQYNVKITFSIETEPLGTAGPLKLA-EKTLGKNNEPFFVLNSDVICEYPFAE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            +  FHK+HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAAFHKAHGDEGTIIVTKVEEPSKYGVVV  148



>ref|NP_986146.1| AFR599Wp [Ashbya gossypii ATCC 10895]
 sp|Q752H4.1|MPG1_ASHGO RecName: Full=Mannose-1-phosphate guanyltransferase; AltName: 
Full=GDP-mannose pyrophosphorylase; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase [Ashbya gossypii ATCC 10895]
 gb|AAS53970.1| AFR599Wp [Ashbya gossypii ATCC 10895]
 gb|AEY98284.1| FAFR599Wp [Ashbya gossypii FDAG1]
Length=361

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFCNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPFKE
Sbjct  61   VETLKKYEKQYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            +  FH++HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LAAFHRAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>ref|XP_001247805.1| hypothetical protein CIMG_01576 [Coccidioides immitis RS]
 gb|EAS36222.1| mannose-1-phosphate guanyltransferase [Coccidioides immitis RS]
Length=364

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFAN+PMILHQ+E+L A GVT++VLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQVESLAAAGVTDIVLAVNYRPDIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++ LK++E +  +KI  S E+EPLGTAGPL LA +K++     PFFVLNSDVI EYPFKE
Sbjct  61   VSTLKKYEEEYNVKIEFSVESEPLGTAGPLKLA-EKILGKDDSPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + EFHK HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAEFHKKHGDEGTIVVTKVEEPSKYGVVV  148



>gb|KJB76118.1| hypothetical protein B456_012G072800 [Gossypium raimondii]
Length=333

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 119/155 (77%), Gaps = 28/155 (18%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTLS+PKPLVEFANKPMILHQIEAL+AVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSIPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +NFLKEFE KL I I CSQETE LG                              YPFKE
Sbjct  61   LNFLKEFEAKLGITISCSQETELLGQL----------------------------YPFKE  92

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG  657
            MIEFHK+HGGEASI+VTKVDEPSK GVVVMEE+TG
Sbjct  93   MIEFHKAHGGEASIVVTKVDEPSKCGVVVMEETTG  127



>ref|XP_003714211.1| mannose-1-phosphate guanyltransferase [Magnaporthe oryzae 70-15]
 gb|EHA54404.1| mannose-1-phosphate guanyltransferase [Magnaporthe oryzae 70-15]
 gb|ELQ40528.1| mannose-1-phosphate guanyltransferase [Magnaporthe oryzae Y34]
 gb|ELQ62214.1| mannose-1-phosphate guanyltransferase [Magnaporthe oryzae P131]
Length=364

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+A+ILVGGFGTRLRPLTL++PKPLVEFANKPMILHQIEAL A GVT+VVLA+NY+PE+M
Sbjct  1    MKAIILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIEALSAAGVTDVVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
               L E+  K  I I  S ETEPLGTAGPL LA   L+ D   PFFVLN+DV  EYPFK+
Sbjct  61   EKALAEYSKKFNINITFSVETEPLGTAGPLKLAEKTLLKDD-TPFFVLNADVTCEYPFKQ  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + +FHK+HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LADFHKAHGDEGTIVVTKVEEPSKYGVVV  148



>ref|XP_002374260.1| mannose-1-phosphate guanylyltransferase [Aspergillus flavus NRRL3357]
 sp|Q2UJU5.1|MPG1_ASPOR RecName: Full=Mannose-1-phosphate guanyltransferase; AltName: 
Full=GDP-mannose pyrophosphorylase; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase [Aspergillus oryzae RIB40]
 dbj|BAE58170.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED55478.1| mannose-1-phosphate guanylyltransferase [Aspergillus flavus NRRL3357]
 gb|EIT80854.1| GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase 
[Aspergillus oryzae 3.042]
 gb|KDE79279.1| GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase 
[Aspergillus oryzae 100-8]
Length=364

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEF N+PMILHQ+E+L A GVT++VLA+NY+P+VM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQVESLAAAGVTDIVLAVNYRPDVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++ LK++E +  +KI  S E+EPLGTAGPL LA +K++     PFFVLNSDVI +YPFKE
Sbjct  61   VSALKKYEEQYNVKIEFSVESEPLGTAGPLKLA-EKILGKDDSPFFVLNSDVICDYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + EFHK HG E +I+VTKVDEPSKYGVVV
Sbjct  120  LAEFHKKHGDEGTIVVTKVDEPSKYGVVV  148



>emb|CCK70177.1| hypothetical protein KNAG_0D04310 [Kazachstania naganishii CBS 
8797]
Length=361

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA + L  D+  PFFVLNSDVI EYPFKE
Sbjct  61   VKTLKKYEEEYGVNITFSVETEPLGTAGPLKLAENVLKKDN-SPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            + EFH +HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LAEFHAAHGGKGTIVATKVDEPSKYGVIVHDLAT  153



>gb|AGO10911.1| AaceriAFR599Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=361

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGG+GTRLRPLTL+VPKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFCNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            +  LK++E +  + I  S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPFKE
Sbjct  61   VETLKKYEKEYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST  654
            +  FH++HGG+ +I+ TKVDEPSKYGV+V + +T
Sbjct  120  LAAFHRAHGGKGTIVATKVDEPSKYGVIVHDIAT  153



>ref|XP_003065665.1| mannose-1-phosphate guanyltransferase, putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER23520.1| mannose-1-phosphate guanyltransferase, putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EFW21436.1| mannose-1-phosphate guanyltransferase [Coccidioides posadasii 
str. Silveira]
Length=364

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ALILVGGFGTRLRPLTL++PKPLVEFAN+PMILHQ+E+L A GVT++VLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQVESLAAAGVTDIVLAVNYRPDIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
            ++ LK++E +  +KI  S E+EPLGTAGPL LA +K++     PFFVLNSDVI EYPFKE
Sbjct  61   VSTLKKYEEEYNVKIEFSVESEPLGTAGPLKLA-EKILGKDDSPFFVLNSDVICEYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            + EFHK HG E +I+VTKV+EPSKYGVVV
Sbjct  120  LAEFHKRHGDEGTIVVTKVEEPSKYGVVV  148



>gb|KFA61058.1| hypothetical protein S40285_06340 [Stachybotrys chlorohalonata 
IBT 40285]
Length=364

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = +1

Query  193  MRALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALRAVGVTEVVLAINYQPEVM  372
            M+ LILVGGFGTRLRPLTL++PKPLVEF NKPMI+HQIEAL A GVT++VLA+NY+PE+M
Sbjct  1    MKGLILVGGFGTRLRPLTLTLPKPLVEFGNKPMIVHQIEALVAAGVTDIVLAVNYRPEIM  60

Query  373  MNFLKEFETKLEIKIMCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE  552
              FL E+E K  IKI  S E+EPL TAGPL LA +K++     PFFVLNSDVI +YPFKE
Sbjct  61   EKFLAEYEEKYNIKIEFSVESEPLDTAGPLKLA-EKILAKDDSPFFVLNSDVICDYPFKE  119

Query  553  MIEFHKSHGGEASIMVTKVDEPSKYGVVV  639
            ++EFH+SHG E +I+VTKV+EPSKYGVVV
Sbjct  120  LLEFHRSHGDEGTIVVTKVEEPSKYGVVV  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500