BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039E11

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769985.1|  PREDICTED: uncharacterized protein LOC104220752    174   8e-49   Nicotiana sylvestris
ref|XP_009594216.1|  PREDICTED: uncharacterized protein LOC104090749    171   9e-48   Nicotiana tomentosiformis
ref|XP_006360143.1|  PREDICTED: uncharacterized protein LOC102590255    167   5e-46   Solanum tuberosum [potatoes]
emb|CDP05871.1|  unnamed protein product                                152   3e-40   Coffea canephora [robusta coffee]
ref|XP_010268765.1|  PREDICTED: uncharacterized protein LOC104605628    149   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010545803.1|  PREDICTED: uncharacterized protein LOC104818056    149   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_004244201.1|  PREDICTED: uncharacterized protein LOC101247444    148   6e-39   Solanum lycopersicum
ref|XP_010644223.1|  PREDICTED: uncharacterized protein LOC100253...    144   2e-37   Vitis vinifera
ref|XP_002284644.1|  PREDICTED: mpv17-like protein isoform X1           144   2e-37   Vitis vinifera
ref|XP_010092169.1|  Peroxisomal membrane protein 2                     144   2e-37   
ref|XP_011098348.1|  PREDICTED: mpv17-like protein isoform X2           139   3e-35   Sesamum indicum [beniseed]
ref|XP_011098346.1|  PREDICTED: mpv17-like protein isoform X1           138   3e-35   Sesamum indicum [beniseed]
ref|XP_011029433.1|  PREDICTED: mpv17-like protein                      137   8e-35   Populus euphratica
ref|XP_002317517.2|  hypothetical protein POPTR_0011s12440g             136   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010278296.1|  PREDICTED: uncharacterized protein LOC104612557    135   3e-34   Nelumbo nucifera [Indian lotus]
gb|KDP38924.1|  hypothetical protein JCGZ_00681                         135   4e-34   Jatropha curcas
gb|EYU26408.1|  hypothetical protein MIMGU_mgv1a007901mg                135   4e-34   Erythranthe guttata [common monkey flower]
ref|XP_006841712.1|  hypothetical protein AMTR_s00003p00254020          135   5e-34   
ref|XP_007211442.1|  hypothetical protein PRUPE_ppa007209mg             135   6e-34   Prunus persica
ref|XP_011042502.1|  PREDICTED: uncharacterized protein LOC105138177    135   6e-34   Populus euphratica
ref|XP_008226678.1|  PREDICTED: uncharacterized protein LOC103326248    135   7e-34   Prunus mume [ume]
ref|XP_009147654.1|  PREDICTED: uncharacterized protein LOC103871177    134   8e-34   Brassica rapa
gb|KDO74166.1|  hypothetical protein CISIN_1g017634mg                   130   3e-33   Citrus sinensis [apfelsine]
emb|CDY53804.1|  BnaA06g01790D                                          133   3e-33   Brassica napus [oilseed rape]
ref|XP_007021317.1|  Peroxisomal membrane 22 kDa family protein i...    133   4e-33   
ref|XP_007021315.1|  Peroxisomal membrane 22 kDa family protein i...    132   4e-33   Theobroma cacao [chocolate]
ref|XP_006392859.1|  hypothetical protein EUTSA_v10011607mg             130   2e-32   Eutrema salsugineum [saltwater cress]
ref|XP_006370309.1|  hypothetical protein POPTR_0001s41510g             130   3e-32   Populus trichocarpa [western balsam poplar]
ref|NP_564616.1|  peroxisomal membrane Mpv17/PMP22 family protein       129   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KDO74165.1|  hypothetical protein CISIN_1g017634mg                   129   4e-32   Citrus sinensis [apfelsine]
gb|KDO74164.1|  hypothetical protein CISIN_1g017634mg                   129   4e-32   Citrus sinensis [apfelsine]
ref|XP_004291669.1|  PREDICTED: uncharacterized protein LOC101306984    129   5e-32   Fragaria vesca subsp. vesca
gb|KDO74155.1|  hypothetical protein CISIN_1g017634mg                   128   8e-32   Citrus sinensis [apfelsine]
ref|NP_564615.3|  peroxisomal membrane Mpv17/PMP22 family protein       129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008366686.1|  PREDICTED: uncharacterized protein LOC103430324    129   1e-31   Malus domestica [apple tree]
ref|XP_006464706.1|  PREDICTED: uncharacterized protein LOC102611604    128   2e-31   Citrus sinensis [apfelsine]
gb|KDO74161.1|  hypothetical protein CISIN_1g017634mg                   128   2e-31   Citrus sinensis [apfelsine]
gb|KDO74162.1|  hypothetical protein CISIN_1g017634mg                   128   2e-31   Citrus sinensis [apfelsine]
ref|XP_010462139.1|  PREDICTED: uncharacterized protein LOC104742787    127   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006451945.1|  hypothetical protein CICLE_v10008646mg             127   2e-31   
ref|XP_003539587.1|  PREDICTED: uncharacterized protein LOC100805057    127   3e-31   Glycine max [soybeans]
gb|KJB62723.1|  hypothetical protein B456_009G432500                    126   3e-31   Gossypium raimondii
gb|KJB62720.1|  hypothetical protein B456_009G432500                    126   3e-31   Gossypium raimondii
gb|KJB62724.1|  hypothetical protein B456_009G432500                    127   4e-31   Gossypium raimondii
ref|XP_010924061.1|  PREDICTED: uncharacterized protein LOC105046...    126   6e-31   
ref|XP_006451942.1|  hypothetical protein CICLE_v10008646mg             126   6e-31   
ref|XP_004487676.1|  PREDICTED: uncharacterized protein LOC101505712    126   6e-31   Cicer arietinum [garbanzo]
gb|KJB62721.1|  hypothetical protein B456_009G432500                    126   7e-31   Gossypium raimondii
ref|XP_006451944.1|  hypothetical protein CICLE_v10008646mg             126   8e-31   
ref|XP_010500911.1|  PREDICTED: mpv17-like protein                      126   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010479814.1|  PREDICTED: uncharacterized protein LOC104758621    126   1e-30   Camelina sativa [gold-of-pleasure]
gb|KJB62718.1|  hypothetical protein B456_009G432500                    126   1e-30   Gossypium raimondii
gb|KJB62719.1|  hypothetical protein B456_009G432500                    125   1e-30   Gossypium raimondii
gb|KJB62726.1|  hypothetical protein B456_009G432500                    125   1e-30   Gossypium raimondii
gb|KJB62715.1|  hypothetical protein B456_009G432500                    125   1e-30   Gossypium raimondii
gb|KJB62714.1|  hypothetical protein B456_009G432500                    126   1e-30   Gossypium raimondii
ref|XP_010060525.1|  PREDICTED: uncharacterized protein LOC104448413    125   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010924060.1|  PREDICTED: uncharacterized protein LOC105046...    125   2e-30   Elaeis guineensis
ref|XP_009334618.1|  PREDICTED: uncharacterized protein LOC103927419    125   2e-30   Pyrus x bretschneideri [bai li]
gb|KCW67302.1|  hypothetical protein EUGRSUZ_F01090                     125   2e-30   Eucalyptus grandis [rose gum]
emb|CDY26037.1|  BnaC06g05870D                                          124   5e-30   Brassica napus [oilseed rape]
ref|XP_003543260.1|  PREDICTED: uncharacterized protein LOC100786706    124   7e-30   Glycine max [soybeans]
ref|XP_006305136.1|  hypothetical protein CARUB_v10009510mg             123   9e-30   Capsella rubella
ref|XP_009378495.1|  PREDICTED: uncharacterized protein LOC103966...    123   9e-30   
ref|XP_009378494.1|  PREDICTED: uncharacterized protein LOC103966...    123   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_009397791.1|  PREDICTED: uncharacterized protein LOC103982557    123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHF98025.1|  Peroxisomal membrane 2                                  122   2e-29   Gossypium arboreum [tree cotton]
gb|KHN36788.1|  Peroxisomal membrane protein 2                          122   2e-29   Glycine soja [wild soybean]
ref|XP_002891718.1|  hypothetical protein ARALYDRAFT_474411             120   8e-29   
ref|XP_010921049.1|  PREDICTED: uncharacterized protein LOC105044749    119   5e-28   Elaeis guineensis
ref|XP_007149619.1|  hypothetical protein PHAVU_005G085000g             118   1e-27   Phaseolus vulgaris [French bean]
ref|XP_008452277.1|  PREDICTED: uncharacterized protein LOC103493...    117   1e-27   Cucumis melo [Oriental melon]
ref|XP_008452276.1|  PREDICTED: uncharacterized protein LOC103493...    117   1e-27   Cucumis melo [Oriental melon]
ref|XP_010687649.1|  PREDICTED: uncharacterized protein LOC104901742    116   4e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN56219.1|  hypothetical protein Csa_3G100790                       114   3e-26   Cucumis sativus [cucumbers]
ref|XP_004149288.1|  PREDICTED: uncharacterized protein LOC101205134    114   3e-26   Cucumis sativus [cucumbers]
ref|XP_008800139.1|  PREDICTED: uncharacterized protein LOC103714610    112   1e-25   
ref|XP_010675607.1|  PREDICTED: protein SYM1-like                       111   2e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH38794.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    110   4e-25   Medicago truncatula
gb|KFK35762.1|  hypothetical protein AALP_AA4G033000                    107   3e-24   Arabis alpina [alpine rockcress]
emb|CBI20352.3|  unnamed protein product                                103   3e-23   Vitis vinifera
gb|KDO74163.1|  hypothetical protein CISIN_1g017634mg                   102   2e-22   Citrus sinensis [apfelsine]
gb|EPS62403.1|  hypothetical protein M569_12387                         101   2e-22   Genlisea aurea
ref|XP_006447326.1|  hypothetical protein CICLE_v10015813mg             100   1e-21   
gb|KDO40773.1|  hypothetical protein CISIN_1g019056mg                   100   1e-21   Citrus sinensis [apfelsine]
gb|KDO40772.1|  hypothetical protein CISIN_1g019056mg                   100   1e-21   Citrus sinensis [apfelsine]
ref|XP_006447327.1|  hypothetical protein CICLE_v10015813mg             100   2e-21   Citrus clementina [clementine]
gb|KDO40771.1|  hypothetical protein CISIN_1g019056mg                   100   2e-21   Citrus sinensis [apfelsine]
ref|XP_008386298.1|  PREDICTED: uncharacterized protein LOC103448811  97.8    4e-21   
ref|NP_001062843.2|  Os09g0315000                                     93.2    1e-20   
gb|ABR17136.1|  unknown                                               95.9    3e-20   Picea sitchensis
gb|ADM21186.1|  peroxisomal membrane-like protein                     94.7    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230251.1|  PREDICTED: uncharacterized protein LOC103329...  95.1    7e-20   Prunus mume [ume]
ref|XP_008230249.1|  PREDICTED: uncharacterized protein LOC103329...  95.1    7e-20   
ref|XP_008230250.1|  PREDICTED: uncharacterized protein LOC103329...  95.1    7e-20   Prunus mume [ume]
ref|XP_008230252.1|  PREDICTED: uncharacterized protein LOC103329...  95.1    7e-20   
ref|XP_009357078.1|  PREDICTED: uncharacterized protein LOC103947838  95.1    9e-20   Pyrus x bretschneideri [bai li]
ref|XP_009134349.1|  PREDICTED: protein SYM1                          94.7    1e-19   Brassica rapa
emb|CDY48204.1|  BnaCnng15950D                                        94.7    1e-19   Brassica napus [oilseed rape]
ref|XP_008379554.1|  PREDICTED: uncharacterized protein LOC103442533  94.7    1e-19   
ref|XP_006396570.1|  hypothetical protein EUTSA_v10028802mg           94.7    1e-19   Eutrema salsugineum [saltwater cress]
gb|AAD11583.1|  hypothetical protein                                  93.6    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217251.1|  hypothetical protein PRUPE_ppa007825mg           94.7    1e-19   Prunus persica
emb|CDX90887.1|  BnaA03g25670D                                        94.7    1e-19   
ref|NP_974505.1|  peroxisomal membrane (Mpv17/PMP22) family protein   94.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009766316.1|  PREDICTED: protein SYM1                          94.7    1e-19   Nicotiana sylvestris
ref|XP_010095804.1|  Protein SYM1                                     94.7    1e-19   Morus notabilis
gb|KJB79963.1|  hypothetical protein B456_013G074900                  94.0    1e-19   Gossypium raimondii
gb|KJB79962.1|  hypothetical protein B456_013G074900                  94.0    2e-19   Gossypium raimondii
ref|XP_008230248.1|  PREDICTED: mpv17-like protein isoform X2         94.4    2e-19   
ref|XP_009623041.1|  PREDICTED: protein SYM1                          94.4    2e-19   Nicotiana tomentosiformis
ref|XP_008230247.1|  PREDICTED: mpv17-like protein isoform X1         94.4    2e-19   
gb|ABF97329.1|  peroxisomal membrane protein, putative, expressed     94.0    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97328.1|  peroxisomal membrane protein, putative, expressed     94.0    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010422462.1|  PREDICTED: LOW QUALITY PROTEIN: mpv17-like p...  94.4    2e-19   
ref|NP_192250.2|  peroxisomal membrane (Mpv17/PMP22) family protein   94.0    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ27617.1|  hypothetical protein OsJ_11561                        94.0    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AAP40491.1|  unknown protein                                       94.0    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79961.1|  hypothetical protein B456_013G074900                  94.0    2e-19   Gossypium raimondii
gb|KJB79964.1|  hypothetical protein B456_013G074900                  94.0    2e-19   Gossypium raimondii
gb|EEC75642.1|  hypothetical protein OsI_12389                        94.0    2e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001050563.1|  Os03g0583800                                     94.0    2e-19   
gb|KDP24169.1|  hypothetical protein JCGZ_25826                       93.6    3e-19   Jatropha curcas
ref|XP_004487310.1|  PREDICTED: protein SYM1-like isoform X1          93.6    3e-19   
ref|XP_010657274.1|  PREDICTED: mpv17-like protein                    93.6    4e-19   Vitis vinifera
ref|XP_004487311.1|  PREDICTED: protein SYM1-like isoform X2          93.2    4e-19   Cicer arietinum [garbanzo]
ref|XP_002874865.1|  hypothetical protein ARALYDRAFT_490222           93.2    4e-19   
ref|XP_002517962.1|  Peroxisomal membrane protein, putative           93.2    4e-19   
ref|NP_001151402.1|  mpv17 / PMP22 family protein                     93.2    5e-19   Zea mays [maize]
dbj|BAJ94190.1|  predicted protein                                    92.8    6e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011039752.1|  PREDICTED: uncharacterized protein LOC105136...  92.0    7e-19   Populus euphratica
ref|XP_006650305.1|  PREDICTED: peroxisomal membrane protein 2-like   91.7    7e-19   Oryza brachyantha
gb|KCW89501.1|  hypothetical protein EUGRSUZ_A01792                   92.0    7e-19   Eucalyptus grandis [rose gum]
ref|XP_006366011.1|  PREDICTED: protein SYM1-like                     92.4    8e-19   Solanum tuberosum [potatoes]
ref|XP_010455892.1|  PREDICTED: protein SYM1-like                     92.0    8e-19   Camelina sativa [gold-of-pleasure]
gb|KHG05370.1|  Peroxisomal membrane 2                                92.4    8e-19   Gossypium arboreum [tree cotton]
ref|XP_008353524.1|  PREDICTED: PXMP2/4 family protein 1-like         92.4    8e-19   Malus domestica [apple tree]
ref|XP_006371588.1|  hypothetical protein POPTR_0019s13430g           92.4    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011085340.1|  PREDICTED: peroxisomal membrane protein 2        92.0    9e-19   Sesamum indicum [beniseed]
ref|XP_011039751.1|  PREDICTED: protein SYM1 isoform X1               92.0    1e-18   Populus euphratica
ref|XP_006288235.1|  hypothetical protein CARUB_v10001476mg           92.0    1e-18   Capsella rubella
ref|XP_004982515.1|  PREDICTED: uncharacterized protein LOC101756875  92.0    1e-18   
gb|EYU26133.1|  hypothetical protein MIMGU_mgv1a009627mg              91.7    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_004248154.1|  PREDICTED: protein SYM1                          91.7    2e-18   Solanum lycopersicum
ref|XP_010051684.1|  PREDICTED: uncharacterized protein LOC104440...  91.3    2e-18   Eucalyptus grandis [rose gum]
ref|XP_003562336.1|  PREDICTED: uncharacterized protein LOC100846887  91.7    2e-18   Brachypodium distachyon [annual false brome]
ref|XP_002466876.1|  hypothetical protein SORBIDRAFT_01g015680        91.7    2e-18   Sorghum bicolor [broomcorn]
gb|AFW68287.1|  hypothetical protein ZEAMMB73_230689                  90.9    2e-18   
ref|XP_008681255.1|  PREDICTED: hypothetical protein isoform X2       91.3    2e-18   
gb|EMT03498.1|  Peroxisomal membrane protein 2                        90.1    2e-18   
ref|NP_001136458.1|  hypothetical protein                             91.3    2e-18   
ref|XP_010051673.1|  PREDICTED: uncharacterized protein LOC104440...  90.9    2e-18   
gb|KFK30935.1|  hypothetical protein AALP_AA6G045100                  90.9    3e-18   Arabis alpina [alpine rockcress]
ref|XP_007043533.1|  Peroxisomal membrane 22 kDa family protein       92.0    3e-18   
ref|XP_010522636.1|  PREDICTED: protein SYM1                          90.5    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_004304121.1|  PREDICTED: protein SYM1                          90.1    5e-18   Fragaria vesca subsp. vesca
gb|KEH39092.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  90.1    5e-18   Medicago truncatula
gb|KEH39091.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  89.7    5e-18   Medicago truncatula
gb|KEH39090.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  89.7    6e-18   Medicago truncatula
gb|EMT31197.1|  Peroxisomal membrane protein 2                        89.0    6e-18   
gb|EMS63851.1|  Peroxisomal membrane protein 2                        88.6    1e-17   Triticum urartu
gb|EMS63743.1|  Protein SYM1                                          87.8    2e-17   Triticum urartu
gb|ACJ84916.1|  unknown                                               87.0    2e-17   Medicago truncatula
ref|XP_007149878.1|  hypothetical protein PHAVU_005G106400g           87.8    2e-17   Phaseolus vulgaris [French bean]
gb|ACU17682.1|  unknown                                               86.3    3e-17   Glycine max [soybeans]
ref|XP_003543349.1|  PREDICTED: peroxisomal membrane protein 2        87.4    3e-17   Glycine max [soybeans]
ref|XP_008455339.1|  PREDICTED: mpv17-like protein                    87.4    4e-17   Cucumis melo [Oriental melon]
gb|KHN36615.1|  Peroxisomal membrane protein 2                        88.2    5e-17   Glycine soja [wild soybean]
ref|XP_004137017.1|  PREDICTED: uncharacterized protein LOC101214701  87.0    7e-17   Cucumis sativus [cucumbers]
ref|XP_004155526.1|  PREDICTED: uncharacterized protein LOC101223761  87.0    7e-17   
dbj|BAD34004.1|  peroxisomal membrane protein-like                    86.7    8e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003539526.1|  PREDICTED: peroxisomal membrane protein 2-like   85.1    2e-16   
gb|KHN04274.1|  Peroxisomal membrane protein 2                        85.1    3e-16   Glycine soja [wild soybean]
ref|XP_002530181.1|  conserved hypothetical protein                   84.7    3e-16   
emb|CDP14740.1|  unnamed protein product                              84.0    7e-16   Coffea canephora [robusta coffee]
gb|EEE59409.1|  hypothetical protein OsJ_11557                        77.8    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001774069.1|  predicted protein                                74.7    7e-13   
ref|XP_001765838.1|  predicted protein                                73.9    9e-13   
ref|XP_006374188.1|  hypothetical protein POPTR_0015s04090g           66.6    2e-10   
ref|XP_002966359.1|  hypothetical protein SELMODRAFT_66864            57.0    1e-06   
ref|XP_002978201.1|  hypothetical protein SELMODRAFT_56885            56.6    1e-06   
gb|ADM25596.1|  peroxisomal membrane-like protein                     53.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008363403.1|  PREDICTED: beta-glucosidase 13-like              57.4    2e-06   
gb|ADM25574.1|  peroxisomal membrane-like protein                     53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25570.1|  peroxisomal membrane-like protein                     52.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25609.1|  peroxisomal membrane-like protein                     52.4    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25608.1|  peroxisomal membrane-like protein                     52.0    6e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25601.1|  peroxisomal membrane-like protein                     50.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25614.1|  peroxisomal membrane-like protein                     50.4    2e-05   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009769985.1| PREDICTED: uncharacterized protein LOC104220752 [Nicotiana sylvestris]
Length=375

 Score =   174 bits (441),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 132/194 (68%), Gaps = 18/194 (9%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  215
            MATINGL +PQ   SLSKP PK  S SHFKP K Q+  + + +Q           + A E
Sbjct  1    MATINGLTSPQPFLSLSKPKPKP-SYSHFKPLKPQILSKGLKQQNQQLRDWAVVGSVANE  59

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  395
             D+IPVQS+D+TDQQ GVV   ERE EGG D+D +   V   G  G   RLSFE     G
Sbjct  60   TDLIPVQSNDTTDQQSGVVIGLEREPEGG-DMDLVNQVVGGFGNEG---RLSFE-----G  110

Query  396  sssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFE  575
            ++   SS++S S G  E+  M +V+DRAINATIVLAAG+FAITKLLTIDH+YWHGWT++E
Sbjct  111  AAGGFSSSSSGSNGKLEQEDMNRVIDRAINATIVLAAGSFAITKLLTIDHDYWHGWTVYE  170

Query  576  ILRYAPQHNWSAYE  617
            ILRYAPQHNW AYE
Sbjct  171  ILRYAPQHNWIAYE  184



>ref|XP_009594216.1| PREDICTED: uncharacterized protein LOC104090749 [Nicotiana tomentosiformis]
Length=375

 Score =   171 bits (434),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 131/194 (68%), Gaps = 18/194 (9%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  215
            M+TINGL +PQ   SL KP P   S SHFKP K ++  + + +Q          ++ A E
Sbjct  1    MSTINGLTSPQPFLSLPKPKPNP-SYSHFKPLKPRILSKGLKQQNQQLRDWAVVSSVANE  59

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  395
             D+IPVQS+D+TDQQ GVV   ERE EGG D+D +   V   G  G   RLSFEG     
Sbjct  60   TDLIPVQSNDTTDQQSGVVIGLEREPEGG-DMDLVNQVVGGFGNEG---RLSFEG-----  110

Query  396  sssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFE  575
            ++    S++S S G  E+  M++V+DRAINATIVLAAG+FAITKLLTIDH+YWHGWT++E
Sbjct  111  AAGGFRSSSSGSNGKSEQEDMDRVIDRAINATIVLAAGSFAITKLLTIDHDYWHGWTIYE  170

Query  576  ILRYAPQHNWSAYE  617
            ILRYAPQHNW AYE
Sbjct  171  ILRYAPQHNWIAYE  184



>ref|XP_006360143.1| PREDICTED: uncharacterized protein LOC102590255 [Solanum tuberosum]
Length=371

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 121/195 (62%), Gaps = 24/195 (12%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  215
            MATINGL +PQ   SL K N K    S  KP K Q   + + +Q           +   E
Sbjct  1    MATINGLTSPQPFLSLQKSNSKP-FLSLSKPMKSQFLFKGLKQQNQQLRDWVVVGSVTNE  59

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAE-GGGDIDSIvnqvvvvggfgnegRLSFEGPTGF  392
             DVIPVQS+D TDQQ GVV   ERE E GGG++D +   V   G  G   RLSFEG  GF
Sbjct  60   ADVIPVQSTDVTDQQNGVVIGLEREPELGGGEMDIVNQVVGGFGNEG---RLSFEGAGGF  116

Query  393  gsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLF  572
             S+S    +            +EK++DRAINATIVLAAG+FAITKLLTIDH+YWHGWTLF
Sbjct  117  SSASGVGGSD-----------VEKLIDRAINATIVLAAGSFAITKLLTIDHDYWHGWTLF  165

Query  573  EILRYAPQHNWSAYE  617
            EILRYAPQHNW AYE
Sbjct  166  EILRYAPQHNWVAYE  180



>emb|CDP05871.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 120/200 (60%), Gaps = 21/200 (11%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT-KLQLFPRPV----------SKQFAAAA  206
            MA+IN L TPQT  SL  P PK+      KPT K+Q FP P           S     + 
Sbjct  1    MASINSLTTPQTFLSL--PKPKSSLCFQPKPTSKIQSFPHPFNLLLSKHHKDSSFIVGSV  58

Query  207  AKELDVIPVQSSDSTDQQGGVVDA-TEREAEG--GGDIDSIvnqvvvvggfgnegRLSFE  377
            + E D+IPVQSSD TDQQ GV+    E E EG  G DI        VV GF N+GRLSFE
Sbjct  59   SNEPDIIPVQSSDYTDQQDGVLGGIVEIETEGLSGEDI-----LNQVVNGFSNKGRLSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
              T            SS  G   E  ME+++D AINA+IVLAAGTFA+TKLLTID +YWH
Sbjct  114  AATSSSGYCGGGGTGSSVEGEKGEQEMERLMDSAINASIVLAAGTFAVTKLLTIDSDYWH  173

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWTL+EILRY PQHNWSAYE
Sbjct  174  GWTLYEILRYVPQHNWSAYE  193



>ref|XP_010268765.1| PREDICTED: uncharacterized protein LOC104605628 [Nelumbo nucifera]
Length=386

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 120/176 (68%), Gaps = 10/176 (6%)
 Frame = +3

Query  93   TLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVV  272
            T++ LS  + +    +H K        R  +     + A+ELDVIPV+SSDSTDQQ GVV
Sbjct  29   TVKGLSGSSLQNSCKAH-KSGNSGFLRRKRTDWVVLSVAEELDVIPVRSSDSTDQQDGVV  87

Query  273  DATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaass-sggagEE  449
               ERE EG          +  VGGF NEGRLSFEG   F   SSSSS++S  S   GEE
Sbjct  88   ARIEREREG--------ESLNQVGGFANEGRLSFEGAGDFQGFSSSSSSSSVPSDRKGEE  139

Query  450  LGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
              ++K++DRAINATIVLAAGTFAITKLLTIDH+YWHGWTL+EILRYAPQHNWSAYE
Sbjct  140  EDIDKLIDRAINATIVLAAGTFAITKLLTIDHDYWHGWTLYEILRYAPQHNWSAYE  195



>ref|XP_010545803.1| PREDICTED: uncharacterized protein LOC104818056 [Tarenaya hassleriana]
Length=377

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 116/194 (60%), Gaps = 16/194 (8%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKP------NPKTGSPSHFKPTKLQLFPR--PVSKQFAAAAAKE  215
            MA+++   +P++L SLSKP      +P   SP+  KP + Q+FPR   +S+   A    E
Sbjct  1    MASLHTSISPRSLLSLSKPRKPTSISPPVFSPAAQKPPRTQVFPRNKQISRVPYAVVRDE  60

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  395
            LDVIPVQS D TDQQ GVV         G D                EGRLSFEG +   
Sbjct  61   LDVIPVQSGDRTDQQEGVVVVGGEAEREGSDAQ---VAGFGGAAAAGEGRLSFEGFSS--  115

Query  396  sssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFE  575
               S+           E   MEK++DR INATIVLAAG++AITKLLTIDH+YWHGWTLFE
Sbjct  116  ---SAVVTDDGEERRRENEEMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFE  172

Query  576  ILRYAPQHNWSAYE  617
            ILRYAPQHNW+AYE
Sbjct  173  ILRYAPQHNWTAYE  186



>ref|XP_004244201.1| PREDICTED: uncharacterized protein LOC101247444 [Solanum lycopersicum]
Length=376

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 112/195 (57%), Gaps = 19/195 (10%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  215
            MATINGL +P    SL K N K    S  KP K Q   + + +Q           + + E
Sbjct  1    MATINGLTSPHPFLSLQKSNSKP-FLSLSKPMKSQFLFKGLKQQNQQLRDWAVVGSVSNE  59

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAE-GGGDIDSIvnqvvvvggfgnegRLSFEGPTGF  392
             D I VQSSD  DQQ GVV   ERE + GGGD+  +   V              EG   F
Sbjct  60   ADEIRVQSSDVMDQQNGVVIGLEREPKLGGGDMGIVNQVVGG---------FGNEGRLSF  110

Query  393  gsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLF  572
                  SSA+   G   +E  +EK++DR INATIVLAAG+FAITKLLTIDH+YWHGWTLF
Sbjct  111  EGGGGFSSASGVGGSESKEEDVEKLIDRTINATIVLAAGSFAITKLLTIDHDYWHGWTLF  170

Query  573  EILRYAPQHNWSAYE  617
            EILRYAPQHNW AYE
Sbjct  171  EILRYAPQHNWVAYE  185



>ref|XP_010644223.1| PREDICTED: uncharacterized protein LOC100253839 isoform X2 [Vitis 
vinifera]
Length=370

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 116/170 (68%), Gaps = 9/170 (5%)
 Frame = +3

Query  108  SKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVVDATER  287
            SKP P    P    P    +F     K++  A A+ELDVIPVQSSDSTDQQ GV+   E 
Sbjct  20   SKPRPTIFLPKGL-PQTSGIFSGTNRKRWVVAVAEELDVIPVQSSDSTDQQDGVLARIEV  78

Query  288  EAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssggagEELGMEKV  467
            E EG          V  VGGF  EGR SFEG   F   SSSSS+++SS G GE   +E++
Sbjct  79   EEEG--------ELVNQVGGFSGEGRFSFEGAGEFQGFSSSSSSSTSSEGQGEAEDVERL  130

Query  468  VDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +DR+INATIVLAAG+FA+TKLLTID +YWHGWT+FEILRYAPQHNWSAYE
Sbjct  131  IDRSINATIVLAAGSFAVTKLLTIDADYWHGWTIFEILRYAPQHNWSAYE  180



>ref|XP_002284644.1| PREDICTED: mpv17-like protein isoform X1 [Vitis vinifera]
Length=371

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 116/170 (68%), Gaps = 9/170 (5%)
 Frame = +3

Query  108  SKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVVDATER  287
            SKP P    P    P    +F     K++  A A+ELDVIPVQSSDSTDQQ GV+   E 
Sbjct  20   SKPRPTIFLPKGL-PQTSGIFSGTNRKRWVVAVAEELDVIPVQSSDSTDQQDGVLARIEV  78

Query  288  EAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssggagEELGMEKV  467
            E EG          V  VGGF  EGR SFEG   F   SSSSS+++SS G GE   +E++
Sbjct  79   EEEG--------ELVNQVGGFSGEGRFSFEGAGEFQGFSSSSSSSTSSEGQGEAEDVERL  130

Query  468  VDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +DR+INATIVLAAG+FA+TKLLTID +YWHGWT+FEILRYAPQHNWSAYE
Sbjct  131  IDRSINATIVLAAGSFAVTKLLTIDADYWHGWTIFEILRYAPQHNWSAYE  180



>ref|XP_010092169.1| Peroxisomal membrane protein 2 [Morus notabilis]
 gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis]
Length=393

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 118/200 (59%), Gaps = 31/200 (16%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKL--------QLFPRPVSK----QFAAA  203
            MA++N +  PQ+  S+SKP PK   P++  P  +         +F R   K       + 
Sbjct  1    MASVNTI-APQSFLSISKPKPK---PTNAYPKSIPCSNFPNHSIFSRNKQKVKGWALNSV  56

Query  204  AAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-  380
              +ELDVIPVQSSD TDQQ GVV +     EGGG    + +QV      G   R SFEG 
Sbjct  57   VNEELDVIPVQSSDGTDQQEGVVVS---RVEGGGLESELASQVGGFVSEG---RFSFEGG  110

Query  381  -PTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
               GFGS S             E   MEK+VDR INATIVLAAGT+AIT+LLTID +YWH
Sbjct  111  AELGFGSGSGVGDVR-------ESESMEKMVDRTINATIVLAAGTYAITRLLTIDQDYWH  163

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWTLFEILRYAPQHNWSAYE
Sbjct  164  GWTLFEILRYAPQHNWSAYE  183



>ref|XP_011098348.1| PREDICTED: mpv17-like protein isoform X2 [Sesamum indicum]
Length=376

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 119/194 (61%), Gaps = 18/194 (9%)
 Frame = +3

Query  60   MATINGLPTPQTL-RSLSKPNPKTGSPSHFKP-------TKLQLFPRPVSKQFAAAAAKE  215
            MA      TP ++ +S +KPN     PS  +P         L+   R  S Q   + A E
Sbjct  1    MAAAAASITPLSISKSKTKPN---NVPSFKQPPLPAAGKISLKSSLRRQSLQLVGSVANE  57

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  395
             DVIPVQS D  DQQ GVV   +RE E   ++D +V             RLSFEG  GF 
Sbjct  58   FDVIPVQSDDIVDQQDGVV-CIQREGEAT-EVDQMVGGFGSEASG----RLSFEGAAGFS  111

Query  396  sssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFE  575
            S++SS+    S  G  +E  ME++VDRAINATIVLAAG+FAITKLLTIDH+YWHGWTL+E
Sbjct  112  SAASSAGGPGSGDGKSQE-DMERLVDRAINATIVLAAGSFAITKLLTIDHDYWHGWTLYE  170

Query  576  ILRYAPQHNWSAYE  617
            ILRYAPQHNWSAYE
Sbjct  171  ILRYAPQHNWSAYE  184



>ref|XP_011098346.1| PREDICTED: mpv17-like protein isoform X1 [Sesamum indicum]
Length=379

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 119/194 (61%), Gaps = 18/194 (9%)
 Frame = +3

Query  60   MATINGLPTPQTL-RSLSKPNPKTGSPSHFKP-------TKLQLFPRPVSKQFAAAAAKE  215
            MA      TP ++ +S +KPN     PS  +P         L+   R  S Q   + A E
Sbjct  1    MAAAAASITPLSISKSKTKPN---NVPSFKQPPLPAAGKISLKSSLRRQSLQLVGSVANE  57

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  395
             DVIPVQS D  DQQ GVV   +RE E   ++D +V             RLSFEG  GF 
Sbjct  58   FDVIPVQSDDIVDQQDGVV-CIQREGEAT-EVDQMVGGFGSEASG----RLSFEGAAGFS  111

Query  396  sssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFE  575
            S++SS+    S  G  +E  ME++VDRAINATIVLAAG+FAITKLLTIDH+YWHGWTL+E
Sbjct  112  SAASSAGGPGSGDGKSQE-DMERLVDRAINATIVLAAGSFAITKLLTIDHDYWHGWTLYE  170

Query  576  ILRYAPQHNWSAYE  617
            ILRYAPQHNWSAYE
Sbjct  171  ILRYAPQHNWSAYE  184



>ref|XP_011029433.1| PREDICTED: mpv17-like protein [Populus euphratica]
Length=370

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 114/195 (58%), Gaps = 28/195 (14%)
 Frame = +3

Query  69   INGLPT--PQTLRSLSKP---------NPKTGSPSHFKPTKLQLFPRPV-SKQFAAAAAK  212
            +  LPT  P +L  LSKP         NP+  SP   K  K Q F R + S    +   +
Sbjct  1    MAALPTISPHSLLPLSKPKKTISKNLQNPQFLSP---KLPKSQAFSRNIPSWHLNSVFQE  57

Query  213  ELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGF  392
            E+DVIPVQS DS DQQ G+V A + E EG      +       G      +LSFEG +  
Sbjct  58   EVDVIPVQSGDSVDQQEGMV-AIQVEREGTELAPQVSGFGGKEG------QLSFEGFSS-  109

Query  393  gsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLF  572
                 +SS+         EL  E+++DR INATIVLAAGT+AITKLLTIDH+YWHGWTLF
Sbjct  110  -----ASSSGLDGETRERELESERLIDRTINATIVLAAGTYAITKLLTIDHDYWHGWTLF  164

Query  573  EILRYAPQHNWSAYE  617
            EILRYAPQHNWSAYE
Sbjct  165  EILRYAPQHNWSAYE  179



>ref|XP_002317517.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa]
 gb|EEE98129.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa]
Length=370

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 116/196 (59%), Gaps = 27/196 (14%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKP---------NPKTGSPSHFKPTKLQLFPRPV-SKQFAAAAA  209
            MA ++ + +P++L  LSKP         NP+  SP   K  K Q F R + S    +   
Sbjct  1    MAALHTI-SPRSLLPLSKPKKTISKNLQNPQFLSP---KLPKSQAFSRNIPSWHLNSVFQ  56

Query  210  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  389
            +E DVIPVQS DS DQQ G+V A + E EG      +       G      +LSFEG + 
Sbjct  57   EEFDVIPVQSGDSVDQQEGMV-ANQVEREGTELAPQVSGFGGSEG------QLSFEGFSS  109

Query  390  FgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTL  569
                  +SS+         EL  ++++DR INATIVLAAGT+AITKLLTIDH+YWHGWTL
Sbjct  110  ------ASSSGLDGESRERELESDRLIDRTINATIVLAAGTYAITKLLTIDHDYWHGWTL  163

Query  570  FEILRYAPQHNWSAYE  617
            FEILRYAPQHNWSAYE
Sbjct  164  FEILRYAPQHNWSAYE  179



>ref|XP_010278296.1| PREDICTED: uncharacterized protein LOC104612557 [Nelumbo nucifera]
Length=379

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 99/139 (71%), Gaps = 9/139 (6%)
 Frame = +3

Query  201  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG  380
            +  +E DVIPV+SSDSTD Q GVV   E E EGG            VGGF NEGRLS EG
Sbjct  60   SVVEEFDVIPVRSSDSTDLQNGVVARIEIEQEGGSS--------NQVGGFANEGRLSLEG  111

Query  381  PTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHG  560
               F   SSSSS+  S G   EE  ++K++DRAINA IVL AGTFAITKLLTIDH+YWHG
Sbjct  112  AGEFQGFSSSSSSVLSDGKG-EEDDIDKLIDRAINAAIVLVAGTFAITKLLTIDHDYWHG  170

Query  561  WTLFEILRYAPQHNWSAYE  617
            WTL+EILRYAPQHNWSAYE
Sbjct  171  WTLYEILRYAPQHNWSAYE  189



>gb|KDP38924.1| hypothetical protein JCGZ_00681 [Jatropha curcas]
Length=375

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 119/196 (61%), Gaps = 22/196 (11%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSK---PNPKTGSPSHFKPTKLQLFP-------RPVSKQFAAAAA  209
            MA+++ + +P +L  LSK   P  K    SHF  TK+   P       +  S    +   
Sbjct  1    MASLHTI-SPHSLLPLSKSKKPTSKILPNSHFLGTKILHSPIFWTNKQKTESWLLNSVVQ  59

Query  210  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  389
            +ELDVIPVQS DSTDQQ GVV  ++ E+EG            V G   NEG+LSFEG + 
Sbjct  60   EELDVIPVQSGDSTDQQDGVV-VSQVESEGN------ELATQVSGFGSNEGQLSFEGFSS  112

Query  390  FgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTL  569
                +SS+           EL M+K +DR+INA IVLAAG++A+TKLLTIDH+YW GWT+
Sbjct  113  ----ASSAGMEGDGQRTQSELEMDKFIDRSINALIVLAAGSYAVTKLLTIDHDYWQGWTI  168

Query  570  FEILRYAPQHNWSAYE  617
            +EILRYAPQHNWSAYE
Sbjct  169  YEILRYAPQHNWSAYE  184



>gb|EYU26408.1| hypothetical protein MIMGU_mgv1a007901mg [Erythranthe guttata]
Length=392

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 114/194 (59%), Gaps = 25/194 (13%)
 Frame = +3

Query  90   QTLRSLSKPNPKTGSPSH---FKPTKLQLFPRPVSKQFA------------AAAAKELDV  224
            Q+  SL  P PK+ S +    FKP      P   S  F+             + A ELDV
Sbjct  14   QSFFSLPNPKPKSSSSNRPSSFKPQSPP--PAATSNNFSKSNRRRQSLLLICSVANELDV  71

Query  225  IPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsss  404
            IPVQS D  DQ  GVV    REAE      ++   V   G     GRLSFEG  GF S++
Sbjct  72   IPVQSEDRVDQHDGVV-CIGREAEP----TAVDQVVGGFGSDAAPGRLSFEGAAGFSSAA  126

Query  405  ssssaasssggagE---ELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFE  575
            S +   + S G G+   +  M+K++DR INATIVLAAGTFAITKLLTIDH+YWHGWTL E
Sbjct  127  SGAGGPARSSGGGDGESQEEMDKLIDRTINATIVLAAGTFAITKLLTIDHDYWHGWTLLE  186

Query  576  ILRYAPQHNWSAYE  617
            ILRYAPQHNWSAYE
Sbjct  187  ILRYAPQHNWSAYE  200



>ref|XP_006841712.1| hypothetical protein AMTR_s00003p00254020 [Amborella trichopoda]
 gb|ERN03387.1| hypothetical protein AMTR_s00003p00254020 [Amborella trichopoda]
Length=367

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 109/199 (55%), Gaps = 34/199 (17%)
 Frame = +3

Query  45   PFPPQMATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAA--------  200
            P P  + +  G   P   +S    NPK              F R  S  F A        
Sbjct  6    PKPIFLHSFKGFLDPN-FQSFRTQNPK--------------FCRAPSSNFYAGRRNWALG  50

Query  201  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG  380
            + + ELDVIPVQS++S DQQ GV+    REA+    ++ +              RLSFEG
Sbjct  51   SVSDELDVIPVQSNNSVDQQDGVMVRINREADEEQSLNRVGGFSNEG-------RLSFEG  103

Query  381  PTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHG  560
                       SA+ SS    EE G +K+VDRAINATIVLAAG+FAITKLLTIDH+YWHG
Sbjct  104  GV---MDVRGFSASFSSSLEIEEDG-DKLVDRAINATIVLAAGSFAITKLLTIDHDYWHG  159

Query  561  WTLFEILRYAPQHNWSAYE  617
            WTLFEILRYAPQHNW AYE
Sbjct  160  WTLFEILRYAPQHNWIAYE  178



>ref|XP_007211442.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica]
 gb|EMJ12641.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica]
Length=378

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 117/202 (58%), Gaps = 31/202 (15%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKP-----------TKLQLFPRPVSKQF----  194
            MA+I+ +  PQ+   L    P+  + +H KP           +K Q F R   K      
Sbjct  1    MASIHSI-APQSFLPLPNSKPRKPTNAHPKPILSSNLCNSKLSKNQTFLRNKRKDRWILK  59

Query  195  AAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEG-GGDIDSIvnqvvvvggfgnegRLS  371
            +    +E DVIPVQS+D TDQQ G+      E EG  G++ S      V G   +EGRLS
Sbjct  60   SLVDQEECDVIPVQSTDCTDQQEGMA-VCRVECEGVEGELAS-----QVGGFGASEGRLS  113

Query  372  FEGPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNY  551
            FEG  GFGSS   +          E    E++VDR INATIVLAAGTFAITKLLTID +Y
Sbjct  114  FEGAGGFGSSGVGNER--------ESEEFERLVDRTINATIVLAAGTFAITKLLTIDQDY  165

Query  552  WHGWTLFEILRYAPQHNWSAYE  617
            WHGWTL+EILRYAPQHNWSAYE
Sbjct  166  WHGWTLYEILRYAPQHNWSAYE  187



>ref|XP_011042502.1| PREDICTED: uncharacterized protein LOC105138177 [Populus euphratica]
Length=369

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 112/191 (59%), Gaps = 35/191 (18%)
 Frame = +3

Query  78   LPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSK-QFAAAAAKELDVIPVQSSDSTD  254
            LP  +T +++SK N +     + K  K+Q F R   + Q  +   +ELDV+PVQS DS D
Sbjct  13   LPLSKTKKTISK-NLQNLQLLNSKLPKIQTFSRNKQRWQLNSVVQEELDVVPVQSGDSVD  71

Query  255  QQGGVV------DATEREAE----GGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsss  404
            QQ G+V      + TE  A+    GG D                 GR SFEG   F S+S
Sbjct  72   QQEGMVAIPVEREGTELAAQVSGFGGSD-----------------GRFSFEG---FSSAS  111

Query  405  ssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILR  584
            SS   A S     E    E+++DR INA IVL AGT+AITKLLTIDHNYWHGWTLFEILR
Sbjct  112  SSGIDAESIERQSES---ERLIDRTINAMIVLGAGTYAITKLLTIDHNYWHGWTLFEILR  168

Query  585  YAPQHNWSAYE  617
            YAPQHNWSAYE
Sbjct  169  YAPQHNWSAYE  179



>ref|XP_008226678.1| PREDICTED: uncharacterized protein LOC103326248 [Prunus mume]
Length=378

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 116/202 (57%), Gaps = 31/202 (15%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKP-----------TKLQLFPRPVSKQF----  194
            MA+I+ +  PQ+   L    P+  + +H KP           +K Q F R   K      
Sbjct  1    MASIHSI-APQSFLPLPNSKPRKPTNAHPKPILSSNLCSSKLSKNQTFLRNKRKDRWILK  59

Query  195  AAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEG-GGDIDSIvnqvvvvggfgnegRLS  371
            +    +E DVIP+QS+D TDQQ G+      E EG  G++ S      V G    EGRLS
Sbjct  60   SLVDQEECDVIPLQSTDCTDQQEGMA-VCRVECEGVEGELAS-----QVGGFGATEGRLS  113

Query  372  FEGPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNY  551
            FEG  GFGSS   +          E    E++VDR INATIVLAAGTFAITKLLTID +Y
Sbjct  114  FEGAGGFGSSGVGNER--------ESEEFERLVDRTINATIVLAAGTFAITKLLTIDQDY  165

Query  552  WHGWTLFEILRYAPQHNWSAYE  617
            WHGWTLFEILRYAPQHNWSAYE
Sbjct  166  WHGWTLFEILRYAPQHNWSAYE  187



>ref|XP_009147654.1| PREDICTED: uncharacterized protein LOC103871177 [Brassica rapa]
Length=362

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 109/181 (60%), Gaps = 24/181 (13%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPVQSSDSTD  254
            +P++  SLSKP+ K        P + Q+F R   ++   + A    E DVIPVQS D TD
Sbjct  11   SPRSFLSLSKPSRK--------PHRSQVFLRINKRRSCVSCALVHDETDVIPVQSGDRTD  62

Query  255  QQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssg  434
             + G + A   E E   D++        V       +LSFEG   F SSS ++       
Sbjct  63   HEEGSLVAMSSETER--DVNE------PVVVGFGAEQLSFEG---FPSSSPTADLGDEKS  111

Query  435  gagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAY  614
               EE  MEK++DR+INATIVLAAGT+AITKLLTIDH+YWHGWTLFEILRYAPQHNW AY
Sbjct  112  RESEE--MEKMIDRSINATIVLAAGTYAITKLLTIDHDYWHGWTLFEILRYAPQHNWLAY  169

Query  615  E  617
            E
Sbjct  170  E  170



>gb|KDO74166.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=244

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 105/189 (56%), Gaps = 30/189 (16%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +               LSF+G +        
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSS-------  109

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
              A++      EE  ME+++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  110  --ASADERRGNEE--MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  166  PLHNWTAYE  174



>emb|CDY53804.1| BnaA06g01790D [Brassica napus]
Length=373

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 108/181 (60%), Gaps = 24/181 (13%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPVQSSDSTD  254
            +P++  SLSKP+ K        P + Q+F R   ++   + A    E DVIPVQS D TD
Sbjct  11   SPRSFLSLSKPSRK--------PHRSQVFLRINKRRSCVSCALVHDETDVIPVQSGDRTD  62

Query  255  QQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssg  434
             + G +     E E   D++        V       +LSFEG   F SSS ++       
Sbjct  63   HEEGSLVVMSSETER--DVNE------PVVVGFGAEQLSFEG---FPSSSPTADLGDEKS  111

Query  435  gagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAY  614
               EE  MEK++DR+INATIVLAAGT+AITKLLTIDH+YWHGWTLFEILRYAPQHNW AY
Sbjct  112  RESEE--MEKMIDRSINATIVLAAGTYAITKLLTIDHDYWHGWTLFEILRYAPQHNWLAY  169

Query  615  E  617
            E
Sbjct  170  E  170



>ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma 
cacao]
 gb|EOY12842.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma 
cacao]
Length=391

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 119/201 (59%), Gaps = 25/201 (12%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSK---PNPKTGSPSHFKPTKL------------QLFPRPVSKQF  194
            MA+++   TPQ L  LSK   P  +  S S    +KL            +   R  +   
Sbjct  1    MASLHTTITPQGLLYLSKSGNPISRQASASPLTSSKLPESLTFSRNKWRKNSNRKANSVV  60

Query  195  AAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSF  374
              + A+ELDVIPVQS D TD Q GV  +       GG++ S       VGGFGNEGRLSF
Sbjct  61   VNSLAEELDVIPVQSEDVTDMQEGVAVSQVESEPAGGELAS------QVGGFGNEGRLSF  114

Query  375  EGPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYW  554
            EG +  GS+S S       G       MEK++DR INATIVLAAGTFA+TKLLTIDHNYW
Sbjct  115  EGFSASGSASGSGFGDGEGGAE----DMEKLIDRTINATIVLAAGTFALTKLLTIDHNYW  170

Query  555  HGWTLFEILRYAPQHNWSAYE  617
             GWTL+EILRYAPQHNWSAYE
Sbjct  171  QGWTLYEILRYAPQHNWSAYE  191



>ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007021316.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12840.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12841.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
Length=386

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 119/201 (59%), Gaps = 25/201 (12%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSK---PNPKTGSPSHFKPTKL------------QLFPRPVSKQF  194
            MA+++   TPQ L  LSK   P  +  S S    +KL            +   R  +   
Sbjct  1    MASLHTTITPQGLLYLSKSGNPISRQASASPLTSSKLPESLTFSRNKWRKNSNRKANSVV  60

Query  195  AAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSF  374
              + A+ELDVIPVQS D TD Q GV  +       GG++ S       VGGFGNEGRLSF
Sbjct  61   VNSLAEELDVIPVQSEDVTDMQEGVAVSQVESEPAGGELAS------QVGGFGNEGRLSF  114

Query  375  EGPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYW  554
            EG +  GS+S S       G       MEK++DR INATIVLAAGTFA+TKLLTIDHNYW
Sbjct  115  EGFSASGSASGSGFGDGEGGAE----DMEKLIDRTINATIVLAAGTFALTKLLTIDHNYW  170

Query  555  HGWTLFEILRYAPQHNWSAYE  617
             GWTL+EILRYAPQHNWSAYE
Sbjct  171  QGWTLYEILRYAPQHNWSAYE  191



>ref|XP_006392859.1| hypothetical protein EUTSA_v10011607mg [Eutrema salsugineum]
 gb|ESQ30145.1| hypothetical protein EUTSA_v10011607mg [Eutrema salsugineum]
Length=359

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 113/180 (63%), Gaps = 19/180 (11%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA--KELDVIPVQSSDSTDQ  257
            +P++  SLSKP+         KP + Q+F R   + F + A    E+DVIPVQS D TD 
Sbjct  11   SPRSFLSLSKPS--------LKPHRSQIFLRNKQRDFVSRALIHDEIDVIPVQSRDRTDH  62

Query  258  QGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssgg  437
            + G V     E E     D   + VV  GG  +EGRLS EG      SSSSS+A      
Sbjct  63   EEGSVVVMSTETEK----DVNESVVVGFGGATSEGRLSLEG-----FSSSSSAADLGDER  113

Query  438  agEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
              E   MEK++DR+INATIVLAAGT+AITKLLTIDH+YWHGWTLFEILRYAPQHNW AYE
Sbjct  114  RSESEEMEKMIDRSINATIVLAAGTYAITKLLTIDHDYWHGWTLFEILRYAPQHNWIAYE  173



>ref|XP_006370309.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa]
 gb|ABK96261.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP66878.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa]
Length=369

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 114/206 (55%), Gaps = 47/206 (23%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKP---------NPKTGSPSHFKPTKLQLFPR-PVSKQFAAAAA  209
            MA ++ + +P  L SLSK          NP+  SP   K  K Q F R   S    +   
Sbjct  1    MAALHAI-SPHGLLSLSKTKKTISKSLQNPQFLSP---KLPKSQTFCRNKQSWHLNSVVQ  56

Query  210  KELDVIPVQSSDSTDQQGGVV------DATEREAE----GGGDIDSIvnqvvvvggfgne  359
            +ELDVIPVQS DS DQQ G++      + TE  A+    GG D                 
Sbjct  57   EELDVIPVQSGDSVDQQEGMLAIPVEREGTELAAQVSGFGGSD-----------------  99

Query  360  gRLSFEGPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTI  539
            G+ SFEG   F S+SSS     S     E    E+++DR INA IVL AGT+AITKLLTI
Sbjct  100  GQFSFEG---FSSASSSGIDGESIDRQSES---ERLIDRTINAMIVLGAGTYAITKLLTI  153

Query  540  DHNYWHGWTLFEILRYAPQHNWSAYE  617
            DHNYWHGWTLFEILRYAPQHNWSAYE
Sbjct  154  DHNYWHGWTLFEILRYAPQHNWSAYE  179



>ref|NP_564616.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
 gb|AAM61632.1| unknown [Arabidopsis thaliana]
 gb|AEE32861.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
Length=306

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 113/190 (59%), Gaps = 24/190 (13%)
 Frame = +3

Query  63   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA--KELDVIPVQ  236
            A+++   +P++   LSKP+         KP + Q+  R   +   + A    E+D+IPVQ
Sbjct  4    ASLHTSISPRSFLPLSKPS--------LKPHRSQILLRNKQRNCVSCALIRDEIDLIPVQ  55

Query  237  SSDSTDQQGG--VVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgssss  407
            S D TD + G  VV +TE   +G   +      VV      +EG+LS EG P+      S
Sbjct  56   SRDRTDHEEGSVVVMSTETAVDGNESV------VVGFSAATSEGQLSLEGFPSS-----S  104

Query  408  sssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRY  587
            SS A        E   MEK++DR INATIVLAAG++AITKLLTIDH+YWHGWTLFEILRY
Sbjct  105  SSGADLGDEKRRENEEMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRY  164

Query  588  APQHNWSAYE  617
            APQHNW AYE
Sbjct  165  APQHNWIAYE  174



>gb|KDO74165.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=316

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 105/189 (56%), Gaps = 30/189 (16%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +               LSF+G +        
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSS-------  109

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
              A++      EE  ME+++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  110  --ASADERRGNEE--MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  166  PLHNWTAYE  174



>gb|KDO74164.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=314

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 105/189 (56%), Gaps = 30/189 (16%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +               LSF+G +        
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSS-------  109

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
              A++      EE  ME+++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  110  --ASADERRGNEE--MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  166  PLHNWTAYE  174



>ref|XP_004291669.1| PREDICTED: uncharacterized protein LOC101306984 [Fragaria vesca 
subsp. vesca]
Length=377

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 119/198 (60%), Gaps = 24/198 (12%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT-----------KLQLFP-RPVSKQFAAA  203
            MA+I+ +  PQ+  +L  P P+     H KPT           K Q FP R  ++   + 
Sbjct  1    MASIHAI-APQSFLNLPNPKPRKPITPHSKPTSSSNLYTLKPPKTQSFPSRKPTRVLTSV  59

Query  204  AAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGP  383
            A    DVIPVQSSD  DQQ G+V  +  E EG   ++S      V G   +EGRLSFEG 
Sbjct  60   ADHHHDVIPVQSSDCVDQQEGMV-VSRAECEG---VES-ELASQVGGFGASEGRLSFEG-  113

Query  384  TGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGW  563
                    SSS+   +    EEL   ++VDR+INATIVLAAG+FA+TKLLTID +YWHGW
Sbjct  114  ---AGGFGSSSSGVGNERGNEEL--YRLVDRSINATIVLAAGSFALTKLLTIDQDYWHGW  168

Query  564  TLFEILRYAPQHNWSAYE  617
            T++EILRYAPQHNW+AYE
Sbjct  169  TIYEILRYAPQHNWTAYE  186



>gb|KDO74155.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=327

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 105/189 (56%), Gaps = 30/189 (16%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +               LSF+G +        
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSS-------  109

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
              A++      EE  ME+++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  110  --ASADERRGNEE--MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  166  PLHNWTAYE  174



>ref|NP_564615.3| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
 gb|AAG52277.1|AC019018_14 unknown protein; 54928-56750 [Arabidopsis thaliana]
 gb|AAK60317.1|AF385726_1 At1g52870/F14G24_14 [Arabidopsis thaliana]
 gb|AAN72239.1| At1g52870/F14G24_14 [Arabidopsis thaliana]
 gb|AEE32862.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
Length=366

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 113/190 (59%), Gaps = 24/190 (13%)
 Frame = +3

Query  63   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA--KELDVIPVQ  236
            A+++   +P++   LSKP+         KP + Q+  R   +   + A    E+D+IPVQ
Sbjct  4    ASLHTSISPRSFLPLSKPS--------LKPHRSQILLRNKQRNCVSCALIRDEIDLIPVQ  55

Query  237  SSDSTDQQGG--VVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgssss  407
            S D TD + G  VV +TE   +G   +      VV      +EG+LS EG P+      S
Sbjct  56   SRDRTDHEEGSVVVMSTETAVDGNESV------VVGFSAATSEGQLSLEGFPSS-----S  104

Query  408  sssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRY  587
            SS A        E   MEK++DR INATIVLAAG++AITKLLTIDH+YWHGWTLFEILRY
Sbjct  105  SSGADLGDEKRRENEEMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRY  164

Query  588  APQHNWSAYE  617
            APQHNW AYE
Sbjct  165  APQHNWIAYE  174



>ref|XP_008366686.1| PREDICTED: uncharacterized protein LOC103430324 [Malus domestica]
Length=374

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 114/196 (58%), Gaps = 23/196 (12%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPR----PVSKQ------FAAAAA  209
            MA I+ +   Q+  SL  P P+    +H KP      P+    P +KQ       +A   
Sbjct  1    MAAIHSIAA-QSFLSLPNPKPRKPIAAHPKPILTSKLPKNPTFPRNKQKSRWVLNSAVER  59

Query  210  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  389
            +E DVIPV SSD TDQQ GVV A+  E+EGG   D       V G   +EGRLSFE    
Sbjct  60   EECDVIPVHSSDRTDQQEGVV-ASRVESEGG---DQGELVSQVGGFGASEGRLSFE----  111

Query  390  FgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTL  569
                 +    +S  G   E    E++VDR INA IVLAAGTFA+TKL+T+D +YWHGWTL
Sbjct  112  ----GAGGFGSSGVGSERESEEFERLVDRTINAAIVLAAGTFALTKLVTVDQDYWHGWTL  167

Query  570  FEILRYAPQHNWSAYE  617
            +EILRYAPQHNWSAYE
Sbjct  168  YEILRYAPQHNWSAYE  183



>ref|XP_006464706.1| PREDICTED: uncharacterized protein LOC102611604 [Citrus sinensis]
 gb|KDO74156.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74157.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74158.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74159.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74160.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=365

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 105/189 (56%), Gaps = 30/189 (16%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +               LSF+G +        
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSS-------  109

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
              A++      EE  ME+++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  110  --ASADERRGNEE--MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  166  PLHNWTAYE  174



>gb|KDO74161.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=367

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 105/189 (56%), Gaps = 30/189 (16%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +               LSF+G +        
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSS-------  109

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
              A++      EE  ME+++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  110  --ASADERRGNEE--MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  166  PLHNWTAYE  174



>gb|KDO74162.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=368

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 105/189 (56%), Gaps = 30/189 (16%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +               LSF+G +        
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSS-------  109

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
              A++      EE  ME+++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  110  --ASADERRGNEE--MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  166  PLHNWTAYE  174



>ref|XP_010462139.1| PREDICTED: uncharacterized protein LOC104742787 [Camelina sativa]
Length=370

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 111/190 (58%), Gaps = 21/190 (11%)
 Frame = +3

Query  63   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPV  233
            A+++   +P++   LSKP       S  KP + Q+  R   ++   + A    E+DVIPV
Sbjct  5    ASLHTSISPRSFLPLSKP-------SLMKPHRSQILLRKNKQRSCVSCALIRDEIDVIPV  57

Query  234  QSSDSTD-QQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgssss  407
            QS D TD ++G VV  +  E E  G+    V          ++G+LS EG P+       
Sbjct  58   QSRDHTDHEEGSVVFMSAAETERDGN--EAVVVGFGPAATTSDGQLSLEGFPSS------  109

Query  408  sssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRY  587
             S A        E   MEK++DR INATIVLAAG++AITKLLTIDH+YWHGWTLFEILRY
Sbjct  110  -SGADLGDEKRRENEEMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRY  168

Query  588  APQHNWSAYE  617
            APQHNW AYE
Sbjct  169  APQHNWIAYE  178



>ref|XP_006451945.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65185.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=317

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 107/189 (57%), Gaps = 27/189 (14%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +                  +G   F   SS+
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFS--------------DGTLSFDGFSSA  110

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
            SSA++      EE+G  +++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  111  SSASADERRGNEEMG--RLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  168

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  169  PLHNWTAYE  177



>ref|XP_003539587.1| PREDICTED: uncharacterized protein LOC100805057 [Glycine max]
Length=375

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 117/195 (60%), Gaps = 20/195 (10%)
 Frame = +3

Query  60   MATINGLPTPQT-LRSLSKPNPK-------TGSPSHFKPTKLQLFPRPVSKQFAA-AAAK  212
            MA+++    P+T L S+ KP           G   +F+     L      +  AA +AA+
Sbjct  1    MASVHSTVAPRTFLPSIPKPRAPLHAAKFVAGGAHNFRRLSRNLILSGNKRAVAANSAAE  60

Query  213  ELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGF  392
            E DVI VQS D TDQQ GVV    R    GGD +       V G   NEG LS EG    
Sbjct  61   EFDVISVQSDDITDQQEGVV--VSRVEMEGGDCE---LATQVSGFGANEGLLSLEG----  111

Query  393  gsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLF  572
               SSSSS++SS  G   E  MEK++DR INATIVLAAGTFA+TKLLTID +YWHGWTL+
Sbjct  112  --FSSSSSSSSSLVGNESEEDMEKLIDRTINATIVLAAGTFAVTKLLTIDSDYWHGWTLY  169

Query  573  EILRYAPQHNWSAYE  617
            EILRYAPQHNWSAYE
Sbjct  170  EILRYAPQHNWSAYE  184



>gb|KJB62723.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=317

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 115/200 (58%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPN---PKTGSPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>gb|KJB62720.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=316

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 115/200 (58%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNP---KTGSPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>gb|KJB62724.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=339

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 115/200 (58%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPN---PKTGSPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>ref|XP_010924061.1| PREDICTED: uncharacterized protein LOC105046999 isoform X2 [Elaeis 
guineensis]
Length=328

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 114/201 (57%), Gaps = 25/201 (12%)
 Frame = +3

Query  51   PPQMATINGLPTPQTLRSLSKPNPK------TGSPSHFKPTKLQLFPRPVSKQFAAAAAK  212
            P +   +   P P +L S SKP         T +P  ++P + +   R ++   +  AA+
Sbjct  10   PSRFLPLPSRPRPSSLPSTSKPCLSSSRFHGTLAPPPWRPDRAR---RDLAVAASGTAAE  66

Query  213  ELDVIPVQSSDSTDQQGGVVDA---TEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGP  383
            +LDVIPV+S DSTD+Q GVV      E+E E GG   S              G  +FE  
Sbjct  67   DLDVIPVKSPDSTDRQDGVVAVGAVREQEDEDGGGSSS----------HNQVGGFAFENG  116

Query  384  TGFgsssssssaasssgga---gEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYW  554
               G +     +  SS  +    E   +E++VDRAINA IVLAAGT+AITKLLTID +YW
Sbjct  117  GVGGVTGGGGGSLYSSPLSSSLEEGEDVERLVDRAINAAIVLAAGTYAITKLLTIDRDYW  176

Query  555  HGWTLFEILRYAPQHNWSAYE  617
            HGWTL+EILRYAPQHNW+AYE
Sbjct  177  HGWTLYEILRYAPQHNWTAYE  197



>ref|XP_006451942.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 ref|XP_006451943.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 ref|XP_006451946.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65182.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65183.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65186.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=368

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 107/189 (57%), Gaps = 27/189 (14%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +                  +G   F   SS+
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFS--------------DGTLSFDGFSSA  110

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
            SSA++      EE+G  +++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  111  SSASADERRGNEEMG--RLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  168

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  169  PLHNWTAYE  177



>ref|XP_004487676.1| PREDICTED: uncharacterized protein LOC101505712 [Cicer arietinum]
Length=366

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 122/197 (62%), Gaps = 28/197 (14%)
 Frame = +3

Query  60   MATINGLPTPQTLR-SLSKPNPKTGSPSHFKPTKLQLFP------RPVSKQFAAA---AA  209
            MA+++    PQ+   S+SKP  K  S S     KLQ FP       P++K+   +   +A
Sbjct  1    MASVHSTVPPQSFFPSISKPKSKPNSIS-----KLQNFPASIFSTNPINKRVMVSTKSSA  55

Query  210  KELDVIPVQSSDSTDQQGGVVDATEREAEGG-GDIDSIvnqvvvvggfgnegRLSFEGPT  386
            +E DVI VQS D TDQQ G++     E EGG G++ +      V G   NEG LS EG  
Sbjct  56   EEFDVITVQSDDVTDQQEGLM-VRRVEMEGGDGELAT-----QVNGFGANEGLLSLEG--  107

Query  387  GFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWT  566
                 SSS  ++S   G   E  +EK++DR INA+IVLAAGTFA+TKLLTID +YWHGWT
Sbjct  108  ----FSSSPPSSSGLVGNENEESVEKLLDRTINASIVLAAGTFALTKLLTIDSDYWHGWT  163

Query  567  LFEILRYAPQHNWSAYE  617
            ++EI+RYAPQHNWSAYE
Sbjct  164  IYEIVRYAPQHNWSAYE  180



>gb|KJB62721.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=351

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 115/200 (58%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPN---PKTGSPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>ref|XP_006451944.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65184.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=380

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 107/189 (57%), Gaps = 27/189 (14%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  230
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  231  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  410
            VQS D TD Q GVV   E + E    +  +                  +G   F   SS+
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFS--------------DGTLSFDGFSSA  110

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
            SSA++      EE+G  +++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYA
Sbjct  111  SSASADERRGNEEMG--RLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  168

Query  591  PQHNWSAYE  617
            P HNW+AYE
Sbjct  169  PLHNWTAYE  177



>ref|XP_010500911.1| PREDICTED: mpv17-like protein [Camelina sativa]
Length=370

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 105/189 (56%), Gaps = 17/189 (9%)
 Frame = +3

Query  63   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPV  233
            AT   L T  + RS     P+   PS  KP + Q+  R   ++   + A    E DV+PV
Sbjct  3    ATAASLHTSISPRSF----PRLSKPSLMKPHRSQILLRKNKQRSCVSCALIRDETDVLPV  58

Query  234  QSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgsssss  410
            QS D TD + G +     E E  G+    V          +EG+LS EG P+        
Sbjct  59   QSRDRTDHEEGSLVLMSVETERDGN--EAVVVGFGAAATTSEGQLSLEGFPSS-------  109

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
            S A        E   M+K++DR INATIVLAAG++AITKLLTIDH+YWHGWTLFEILRYA
Sbjct  110  SGADLGDEKRRENEEMDKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRYA  169

Query  591  PQHNWSAYE  617
            PQHNW AYE
Sbjct  170  PQHNWIAYE  178



>ref|XP_010479814.1| PREDICTED: uncharacterized protein LOC104758621 [Camelina sativa]
Length=367

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 112/189 (59%), Gaps = 22/189 (12%)
 Frame = +3

Query  63   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPV  233
            A+++   +P++   LSKP       S  KP + Q   R   ++   + A    E+DVIPV
Sbjct  5    ASLHTSISPRSFLPLSKP-------SLMKPHRSQTLLRKNKQRSCVSCALIRDEVDVIPV  57

Query  234  QSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgsssss  410
            QS D TD +  ++ A   E E  G+ +++V   V      +EG+LS EG P+        
Sbjct  58   QSRDRTDHEVVLMSA---ETERDGN-EAVVVGFVPAATTTSEGQLSLEGFPSS-------  106

Query  411  ssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYA  590
            S A        E   MEK++DR INATIVLAAG++AITKLLTIDH+YWHGWTLFEILRYA
Sbjct  107  SGADLGDEKRRENEEMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRYA  166

Query  591  PQHNWSAYE  617
            PQHNW AYE
Sbjct  167  PQHNWIAYE  175



>gb|KJB62718.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=391

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 114/200 (57%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>gb|KJB62719.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62725.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=380

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 114/200 (57%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>gb|KJB62726.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=382

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 114/200 (57%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>gb|KJB62715.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62716.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62717.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62722.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62728.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=382

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 114/200 (57%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>gb|KJB62714.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=418

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 115/200 (58%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPN---PKTGSPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSPSGNGFGDGQGSQEEL--DRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>ref|XP_010060525.1| PREDICTED: uncharacterized protein LOC104448413 [Eucalyptus grandis]
 gb|KCW67301.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis]
Length=373

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 114/194 (59%), Gaps = 21/194 (11%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFP-----RPVS---KQFAAAAAKE  215
            MA+I    +P++L  L K  P    P    P KL   P     RP     +  A +  +E
Sbjct  1    MASI----SPRSLLPLPKMGPNPLHPPSLSPAKLAKLPPFPRNRPRLGGLRLVANSVVEE  56

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  395
             DVIPVQS DSTDQQ G+  + ER  E    +  +       G   +EG+  F+   GF 
Sbjct  57   FDVIPVQSGDSTDQQEGLSVSLERAGEAAELVSQV------GGFATSEGQFPFD---GFS  107

Query  396  sssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFE  575
            S+SS +S++SS        GM +++DR+IN  IVLAAGT+AITKLLTID +YWHGWT++E
Sbjct  108  SASSGASSSSSGVEKDGSEGMARLIDRSINGMIVLAAGTYAITKLLTIDSDYWHGWTIYE  167

Query  576  ILRYAPQHNWSAYE  617
            I+RYAP HNWSAYE
Sbjct  168  IVRYAPLHNWSAYE  181



>ref|XP_010924060.1| PREDICTED: uncharacterized protein LOC105046999 isoform X1 [Elaeis 
guineensis]
Length=389

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 114/201 (57%), Gaps = 25/201 (12%)
 Frame = +3

Query  51   PPQMATINGLPTPQTLRSLSKPNPK------TGSPSHFKPTKLQLFPRPVSKQFAAAAAK  212
            P +   +   P P +L S SKP         T +P  ++P + +   R ++   +  AA+
Sbjct  10   PSRFLPLPSRPRPSSLPSTSKPCLSSSRFHGTLAPPPWRPDRAR---RDLAVAASGTAAE  66

Query  213  ELDVIPVQSSDSTDQQGGVVDA---TEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGP  383
            +LDVIPV+S DSTD+Q GVV      E+E E GG   S              G  +FE  
Sbjct  67   DLDVIPVKSPDSTDRQDGVVAVGAVREQEDEDGGGSSS----------HNQVGGFAFENG  116

Query  384  TGFgsssssssaasssggag---EELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYW  554
               G +     +  SS  +    E   +E++VDRAINA IVLAAGT+AITKLLTID +YW
Sbjct  117  GVGGVTGGGGGSLYSSPLSSSLEEGEDVERLVDRAINAAIVLAAGTYAITKLLTIDRDYW  176

Query  555  HGWTLFEILRYAPQHNWSAYE  617
            HGWTL+EILRYAPQHNW+AYE
Sbjct  177  HGWTLYEILRYAPQHNWTAYE  197



>ref|XP_009334618.1| PREDICTED: uncharacterized protein LOC103927419 [Pyrus x bretschneideri]
Length=379

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 110/201 (55%), Gaps = 28/201 (14%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPR---PVSKQFAAAAAK------  212
            MA I+ +   Q+  SL  P P+    +H KP     FP    P +  F     K      
Sbjct  1    MAAIHSIAA-QSFPSLPNPKPRKPIAAHVKPILTCAFPTSKLPKNPTFTRNKQKSRWVLN  59

Query  213  ------ELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSF  374
                  E DVIPVQSS+ TDQQ GVV A+  E+EGG   D       V G   +EGR SF
Sbjct  60   SVVEREECDVIPVQSSNRTDQQEGVV-ASRVESEGG---DQGELVSQVGGFGASEGRFSF  115

Query  375  EGPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYW  554
            E              +S  G   E    E++VDR INA IVLAAGTFA+TKL+T+D +YW
Sbjct  116  E--------GPGGFGSSGVGSERESEEFERLVDRTINAAIVLAAGTFALTKLITVDQDYW  167

Query  555  HGWTLFEILRYAPQHNWSAYE  617
            HGWTL+EILRYAPQHNWSAYE
Sbjct  168  HGWTLYEILRYAPQHNWSAYE  188



>gb|KCW67302.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis]
Length=381

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 114/194 (59%), Gaps = 21/194 (11%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFP-----RPVS---KQFAAAAAKE  215
            MA+I    +P++L  L K  P    P    P KL   P     RP     +  A +  +E
Sbjct  1    MASI----SPRSLLPLPKMGPNPLHPPSLSPAKLAKLPPFPRNRPRLGGLRLVANSVVEE  56

Query  216  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  395
             DVIPVQS DSTDQQ G+  + ER  E    +  +       G   +EG+  F+   GF 
Sbjct  57   FDVIPVQSGDSTDQQEGLSVSLERAGEAAELVSQV------GGFATSEGQFPFD---GFS  107

Query  396  sssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFE  575
            S+SS +S++SS        GM +++DR+IN  IVLAAGT+AITKLLTID +YWHGWT++E
Sbjct  108  SASSGASSSSSGVEKDGSEGMARLIDRSINGMIVLAAGTYAITKLLTIDSDYWHGWTIYE  167

Query  576  ILRYAPQHNWSAYE  617
            I+RYAP HNWSAYE
Sbjct  168  IVRYAPLHNWSAYE  181



>emb|CDY26037.1| BnaC06g05870D [Brassica napus]
Length=352

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 105/183 (57%), Gaps = 38/183 (21%)
 Frame = +3

Query  84   TPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA--KELDVIPVQSSDSTDQ  257
            +P++   LSKP+PK        P + Q+F R   +   + A    E DVIPV+S D    
Sbjct  11   SPRSFLPLSKPSPK--------PQRSQVFLRNKQRSCVSCALINDETDVIPVKSHD----  58

Query  258  QGGVV---DATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaass  428
             G VV   + TER+                       G+LSFEG   F SSS ++     
Sbjct  59   DGSVVVMSNETERDVN----------------EPVVVGQLSFEG---FPSSSPAADMGDD  99

Query  429  sggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWS  608
                 EE  M+K++DR+INATIVLAAGT+AITKLLTIDH+YWHGWTLFEILRYAPQHNW 
Sbjct  100  KSRESEE--MDKMIDRSINATIVLAAGTYAITKLLTIDHDYWHGWTLFEILRYAPQHNWL  157

Query  609  AYE  617
            AYE
Sbjct  158  AYE  160



>ref|XP_003543260.1| PREDICTED: uncharacterized protein LOC100786706 [Glycine max]
Length=376

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 99/140 (71%), Gaps = 13/140 (9%)
 Frame = +3

Query  201  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGG-GDIDSIvnqvvvvggfgnegRLSFE  377
            +A++E DVI VQS D TDQQ GVV  +  E EGG G++ +      V     NEG LS E
Sbjct  57   SASEEFDVISVQSEDITDQQEGVV-VSRVEMEGGDGELAT-----QVSRFGANEGLLSLE  110

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G       SSSSS +SSS    E + MEK++DR INATIVLAAGTFA+TKLLTID +YWH
Sbjct  111  G------FSSSSSPSSSSLIGSESVDMEKLIDRTINATIVLAAGTFAVTKLLTIDSDYWH  164

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWTL+EILRYAPQHNWSAYE
Sbjct  165  GWTLYEILRYAPQHNWSAYE  184



>ref|XP_006305136.1| hypothetical protein CARUB_v10009510mg [Capsella rubella]
 gb|EOA38034.1| hypothetical protein CARUB_v10009510mg [Capsella rubella]
Length=366

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 111/192 (58%), Gaps = 30/192 (16%)
 Frame = +3

Query  63   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKL-QLFPRPVSKQFAAAAA---KELDVIP  230
            A+++   +P++   LSK        S  KP +  Q+  R + ++   + A    E+DVIP
Sbjct  6    ASLHTSISPRSFLPLSKH-------SLLKPHRSSQILLRKIKQRNCVSCALIGDEIDVIP  58

Query  231  VQSSDSTDQQGG--VVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgss  401
            VQS D TD + G  V+ +TE E +G   +      V       +EG+LS EG P+     
Sbjct  59   VQSRDRTDHEDGSVVLMSTETERDGNETV-----VVGFGAAATSEGQLSLEGFPSS----  109

Query  402  sssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEIL  581
                   S      E   MEK++DR INATIVLAAG++AI+KLLTIDH+YWHGWTLFEIL
Sbjct  110  -------SGDEKRRENEEMEKMIDRTINATIVLAAGSYAISKLLTIDHDYWHGWTLFEIL  162

Query  582  RYAPQHNWSAYE  617
            RYAPQHNW AYE
Sbjct  163  RYAPQHNWVAYE  174



>ref|XP_009378495.1| PREDICTED: uncharacterized protein LOC103966976 isoform X2 [Pyrus 
x bretschneideri]
Length=379

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 116/203 (57%), Gaps = 31/203 (15%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSP--SHFKPTKLQLFPR---------PVSKQ-----  191
            MATI+ + + Q+   LS PN K   P  +H KP     FP          P +KQ     
Sbjct  1    MATIHCIAS-QSF--LSHPNHKPRKPITAHPKPISTSNFPTSKLPKNPSFPRNKQKSRWL  57

Query  192  -FAAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRL  368
              +    +E DVIPVQS+D TDQ+ G V A   +++GG   D       V G   +EGRL
Sbjct  58   LNSVVEREECDVIPVQSTDCTDQKEGAVAARRADSDGG---DQGELVSQVGGFGESEGRL  114

Query  369  SFEGPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHN  548
            SFE         +    +S  G   E    E++VDR INAT+VLAAGTFA+TKL+T+D +
Sbjct  115  SFE--------GAGGFGSSGVGSERESEEFERLVDRTINATVVLAAGTFALTKLITVDQD  166

Query  549  YWHGWTLFEILRYAPQHNWSAYE  617
            YWHGWTL+EILRYAPQHNWSAYE
Sbjct  167  YWHGWTLYEILRYAPQHNWSAYE  189



>ref|XP_009378494.1| PREDICTED: uncharacterized protein LOC103966976 isoform X1 [Pyrus 
x bretschneideri]
Length=380

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 116/203 (57%), Gaps = 31/203 (15%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSP--SHFKPTKLQLFPR---------PVSKQ-----  191
            MATI+ + + Q+   LS PN K   P  +H KP     FP          P +KQ     
Sbjct  1    MATIHCIAS-QSF--LSHPNHKPRKPITAHPKPISTSNFPTSKLPKNPSFPRNKQKSRWL  57

Query  192  -FAAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRL  368
              +    +E DVIPVQS+D TDQ+ G V A   +++GG   D       V G   +EGRL
Sbjct  58   LNSVVEREECDVIPVQSTDCTDQKEGAVAARRADSDGG---DQGELVSQVGGFGESEGRL  114

Query  369  SFEGPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHN  548
            SFE         +    +S  G   E    E++VDR INAT+VLAAGTFA+TKL+T+D +
Sbjct  115  SFE--------GAGGFGSSGVGSERESEEFERLVDRTINATVVLAAGTFALTKLITVDQD  166

Query  549  YWHGWTLFEILRYAPQHNWSAYE  617
            YWHGWTL+EILRYAPQHNWSAYE
Sbjct  167  YWHGWTLYEILRYAPQHNWSAYE  189



>ref|XP_009397791.1| PREDICTED: uncharacterized protein LOC103982557 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 88/159 (55%), Gaps = 34/159 (21%)
 Frame = +3

Query  183  SKQFAAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgneg  362
            S    + A ++LDVIPVQSSDSTDQQ G++    RE +   +                  
Sbjct  56   SSVIVSVATEDLDVIPVQSSDSTDQQDGLIPMVGREQQEEEN------------------  97

Query  363  RLSFEGPT----GFgsssssssaasssggagE----------ELGMEKVVDRAINATIVL  500
              S +GP+    GF   S        S G             E  M K+VDRAINA IVL
Sbjct  98   --SLQGPSSPVGGFALESGGGVMGGGSSGGVGFSSSSATVIGEEDMNKLVDRAINAAIVL  155

Query  501  AAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            AAGTFAITKLLTID  YWHGWTL+EILRYAPQHNW+AYE
Sbjct  156  AAGTFAITKLLTIDSEYWHGWTLYEILRYAPQHNWTAYE  194



>gb|KHF98025.1| Peroxisomal membrane 2 [Gossypium arboreum]
Length=381

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 114/200 (57%), Gaps = 25/200 (13%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  200
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRENSVVVVK  60

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  377
            + A+ELDVIPVQS D  D Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVIDIQEGVAVSQAPRESSGGELVTQVGGFSNEGM-------LSFE  113

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G +   S S+S +      G+ EEL  ++++DR INATIVLAAGT+AITKLLTID NYW 
Sbjct  114  GVS--SSGSTSGNGFGDGQGSQEEL--DRLMDRIINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAPQHNWSAYE
Sbjct  170  GWTIYEIVRYAPQHNWSAYE  189



>gb|KHN36788.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=372

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 93/140 (66%), Gaps = 17/140 (12%)
 Frame = +3

Query  201  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGG-GDIDSIvnqvvvvggfgnegRLSFE  377
            +A++E DVI VQS D TDQQ GVV  +  E EGG G++ +               ++S  
Sbjct  57   SASEEFDVISVQSEDITDQQEGVV-VSRVEMEGGDGELAT---------------QVSGF  100

Query  378  GPTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            G      S    S++SSS    E + MEK++DR INATIVLAAGTFA+TKLLTID +YWH
Sbjct  101  GANEGLLSLEGFSSSSSSLIGSESVDMEKLIDRTINATIVLAAGTFAVTKLLTIDSDYWH  160

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWTL+EILRYAPQHNWSAYE
Sbjct  161  GWTLYEILRYAPQHNWSAYE  180



>ref|XP_002891718.1| hypothetical protein ARALYDRAFT_474411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67977.1| hypothetical protein ARALYDRAFT_474411 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 107/187 (57%), Gaps = 24/187 (13%)
 Frame = +3

Query  63   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAK-ELDVIPVQS  239
            A+++   +P++   LSKP+         KP + Q+F R  +KQ   A  + E+DVIPVQS
Sbjct  4    ASLHTSISPRSFLPLSKPS--------LKPHRSQIFLR--NKQRTCALIRDEIDVIPVQS  53

Query  240  SDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgsssssss  416
             D TD + G V     E E     D   + VV      +EG+LS EG P+          
Sbjct  54   RDRTDHEEGSVVVMSTETER----DVNESVVVGFSAATSEGQLSLEGFPSS--------G  101

Query  417  aasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQ  596
                    GE    EK++DR INATIVLAAG++AITKLLTIDH+YWH WTL EILRYAPQ
Sbjct  102  GDLGDEKRGENEEREKMIDRTINATIVLAAGSYAITKLLTIDHDYWHVWTLLEILRYAPQ  161

Query  597  HNWSAYE  617
            HNW AYE
Sbjct  162  HNWIAYE  168



>ref|XP_010921049.1| PREDICTED: uncharacterized protein LOC105044749 [Elaeis guineensis]
Length=391

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 87/148 (59%), Gaps = 17/148 (11%)
 Frame = +3

Query  195  AAAAAKELDVIPVQSSDSTDQQGGVVDAT---EREAEGGGDIDSIvnqvvvvggfgnegR  365
            +  AA++LDVIPVQS DSTDQQ GVV      E+E E GG   S              G 
Sbjct  67   SVTAAEDLDVIPVQSPDSTDQQDGVVAVAAGREQEEEDGGGSSS----------HSQVGG  116

Query  366  LSFEGPTGFgsssssssaasssggagEEL----GMEKVVDRAINATIVLAAGTFAITKLL  533
             +F+       +        SS  +   L     + + VDRAINA IVLA GTFAITKLL
Sbjct  117  FAFQSGGVGSVTGGGGGGDFSSSPSSSSLEEGEDVHRFVDRAINAAIVLAVGTFAITKLL  176

Query  534  TIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            TID +YWHGWTL+EILRYAPQHNW+AYE
Sbjct  177  TIDRDYWHGWTLYEILRYAPQHNWTAYE  204



>ref|XP_007149619.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 ref|XP_007149620.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 gb|ESW21613.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 gb|ESW21614.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
Length=378

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 118/196 (60%), Gaps = 20/196 (10%)
 Frame = +3

Query  60   MATINGLPTPQT-LRSLSKPNPKTGSPSHFKPTKLQLFPR---------PVSKQFAAAAA  209
            M +++    P+  L S+SKP P+      F    +  FPR               A AA 
Sbjct  1    MTSVHSTVAPRAFLPSISKPKPRAPHTKSFAGGVVHDFPRFSRSCIFSGNNRAVAANAAG  60

Query  210  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  389
            ++L+VI V+S D TDQQ GV+  +  E +G   +DS      + G    EG LS EG   
Sbjct  61   EDLNVISVKSDDITDQQEGVL-VSRVEIDG---VDS-ELATRINGFGAKEGLLSLEG---  112

Query  390  FgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTL  569
            F SSSS+SS+A     + E++  EK++DR INATIVLAAG FAITKLLTID +YWHGWTL
Sbjct  113  FSSSSSTSSSALVGSESEEDV--EKLIDRTINATIVLAAGAFAITKLLTIDSDYWHGWTL  170

Query  570  FEILRYAPQHNWSAYE  617
            +EILRYAPQHNWSAYE
Sbjct  171  YEILRYAPQHNWSAYE  186



>ref|XP_008452277.1| PREDICTED: uncharacterized protein LOC103493348 isoform X2 [Cucumis 
melo]
Length=376

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 113/202 (56%), Gaps = 33/202 (16%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT---------KLQLFPRPVSKQFAA--AA  206
            MA+++    PQT  S +    +  +PSH +P          +  +F R   K   A  +A
Sbjct  1    MASVHA-TAPQTFTSFTTAK-RAPAPSHPRPAINFHVPKLPQRSIFSRNGRKSNWALNSA  58

Query  207  AKELDVIPVQSSDSTDQQGGV-VDATER---EAEGGGDIDSIvnqvvvvggfgnegRLSF  374
             +E DVIP++SSDSTDQQ G+ V   ER   E E G  +                G LS 
Sbjct  59   VEEFDVIPLRSSDSTDQQEGLAVGRAERDGAEGELGSAVGGF-------------GELSL  105

Query  375  EGPTGFgsssssssaasssggagEELGMEKV-VDRAINATIVLAAGTFAITKLLTIDHNY  551
             G       SSS+S     G    E  ME+V +DR INATIVLAAG++A+TKLLTID +Y
Sbjct  106  GGAGEIQGFSSSASVGDGGGTESGE--MERVMIDRIINATIVLAAGSYALTKLLTIDQDY  163

Query  552  WHGWTLFEILRYAPQHNWSAYE  617
            WHGWTL+EILRYAPQHNWSAYE
Sbjct  164  WHGWTLYEILRYAPQHNWSAYE  185



>ref|XP_008452276.1| PREDICTED: uncharacterized protein LOC103493348 isoform X1 [Cucumis 
melo]
Length=382

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 113/202 (56%), Gaps = 33/202 (16%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT---------KLQLFPRPVSKQFAA--AA  206
            MA+++    PQT  S +    +  +PSH +P          +  +F R   K   A  +A
Sbjct  1    MASVHA-TAPQTFTSFTTAK-RAPAPSHPRPAINFHVPKLPQRSIFSRNGRKSNWALNSA  58

Query  207  AKELDVIPVQSSDSTDQQGGV-VDATER---EAEGGGDIDSIvnqvvvvggfgnegRLSF  374
             +E DVIP++SSDSTDQQ G+ V   ER   E E G  +                G LS 
Sbjct  59   VEEFDVIPLRSSDSTDQQEGLAVGRAERDGAEGELGSAVGGF-------------GELSL  105

Query  375  EGPTGFgsssssssaasssggagEELGMEKV-VDRAINATIVLAAGTFAITKLLTIDHNY  551
             G       SSS+S     G    E  ME+V +DR INATIVLAAG++A+TKLLTID +Y
Sbjct  106  GGAGEIQGFSSSASVGDGGGTESGE--MERVMIDRIINATIVLAAGSYALTKLLTIDQDY  163

Query  552  WHGWTLFEILRYAPQHNWSAYE  617
            WHGWTL+EILRYAPQHNWSAYE
Sbjct  164  WHGWTLYEILRYAPQHNWSAYE  185



>ref|XP_010687649.1| PREDICTED: uncharacterized protein LOC104901742 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 104/185 (56%), Gaps = 7/185 (4%)
 Frame = +3

Query  63   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSS  242
            ++I+ +P PQTL  L+KP            T            FA +A ++ DV+PV+S+
Sbjct  4    SSIHPIP-PQTLSPLTKPLKVKPPTHLTFTTTTL-----RRHSFAISAVRDPDVLPVKST  57

Query  243  DSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaa  422
            D TDQ GG +     + E  G I+        + G  +  +LS EG  G  S     +  
Sbjct  58   DITDQPGGSMMIMTIQNETDGSING-GVGGGALVGGFDGQQLSLEGIGGGTSGGGGGNDG  116

Query  423  sssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHN  602
               G  G    +EK++DR IN + VLAAGTFAITKLLT+DH+YWHGWT++EILRYAP HN
Sbjct  117  GGRGNDGGGNDLEKLIDRGINVSFVLAAGTFAITKLLTVDHDYWHGWTVYEILRYAPLHN  176

Query  603  WSAYE  617
            W+AYE
Sbjct  177  WNAYE  181



>gb|KGN56219.1| hypothetical protein Csa_3G100790 [Cucumis sativus]
Length=412

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 89/144 (62%), Gaps = 20/144 (14%)
 Frame = +3

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATER---EAEGGGDIDSIvnqvvvvggfgnegRL  368
            +A +E DVIPVQSSD TDQQ GV +   ER   E E G  +                  L
Sbjct  93   SAVEEFDVIPVQSSDFTDQQEGVALGRAERDGAEGEMGTAVGGFG-------------EL  139

Query  369  SFEGPTGFgsssssssaasssggagEELGMEKV-VDRAINATIVLAAGTFAITKLLTIDH  545
            S  G       SSS+S A   G    E  ME+V +DR INATIVLAAG++A+TKLLTID 
Sbjct  140  SLGGAGEIQGFSSSASVADGGGTETGE--MERVMIDRIINATIVLAAGSYALTKLLTIDQ  197

Query  546  NYWHGWTLFEILRYAPQHNWSAYE  617
            +YWHGWTL+EILRYAPQHNWSAYE
Sbjct  198  DYWHGWTLYEILRYAPQHNWSAYE  221



>ref|XP_004149288.1| PREDICTED: uncharacterized protein LOC101205134 [Cucumis sativus]
 ref|XP_004171301.1| PREDICTED: uncharacterized protein LOC101228605 [Cucumis sativus]
Length=376

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 89/144 (62%), Gaps = 20/144 (14%)
 Frame = +3

Query  201  AAAKELDVIPVQSSDSTDQQGGV-VDATER---EAEGGGDIDSIvnqvvvvggfgnegRL  368
            +A +E DVIPVQSSD TDQQ GV +   ER   E E G  +                  L
Sbjct  57   SAVEEFDVIPVQSSDFTDQQEGVALGRAERDGAEGEMGTAVGGFG-------------EL  103

Query  369  SFEGPTGFgsssssssaasssggagEELGMEKV-VDRAINATIVLAAGTFAITKLLTIDH  545
            S  G       SSS+S A   G    E  ME+V +DR INATIVLAAG++A+TKLLTID 
Sbjct  104  SLGGAGEIQGFSSSASVADGGGTETGE--MERVMIDRIINATIVLAAGSYALTKLLTIDQ  161

Query  546  NYWHGWTLFEILRYAPQHNWSAYE  617
            +YWHGWTL+EILRYAPQHNWSAYE
Sbjct  162  DYWHGWTLYEILRYAPQHNWSAYE  185



>ref|XP_008800139.1| PREDICTED: uncharacterized protein LOC103714610, partial [Phoenix 
dactylifera]
Length=351

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 89/146 (61%), Gaps = 19/146 (13%)
 Frame = +3

Query  204  AAKELDVIPVQSSDSTDQQGGVVDAT----EREAEGGGDIDSIvnqvvvvggfgnegRLS  371
            AA++L+VIPV+S DSTDQQ GVV       + E +GGG                  G  +
Sbjct  24   AAEDLNVIPVKSPDSTDQQDGVVAVAAGREQEEGDGGGS-----------SSHNEVGGFA  72

Query  372  FEGPTGFgsssssssaasssggagEELG----MEKVVDRAINATIVLAAGTFAITKLLTI  539
            FE     G ++     +  S  +   L     ++++VDRAINA IVLAAGT+AITKLLTI
Sbjct  73   FENGRVGGVTAGGGGGSLYSSPSSSSLEEGEGVDRLVDRAINAAIVLAAGTYAITKLLTI  132

Query  540  DHNYWHGWTLFEILRYAPQHNWSAYE  617
            D +YW GWTL+EILRYAPQHNW+AYE
Sbjct  133  DSDYWQGWTLYEILRYAPQHNWTAYE  158



>ref|XP_010675607.1| PREDICTED: protein SYM1-like [Beta vulgaris subsp. vulgaris]
Length=337

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 108/186 (58%), Gaps = 36/186 (19%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQS  239
            MA++  + +PQ+L  L+KP     + +H  PT++ L      ++  A A K+ D+ P +S
Sbjct  1    MASLRPI-SPQSLPPLTKP-----TKTHKPPTQITL--TTTFRRTMAVAGKD-DIFPAKS  51

Query  240  SDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssa  419
            ++S    G VV        GG D                 G+LS EG  G          
Sbjct  52   AESKVMNGAVV--------GGFD-----------------GQLSLEGVPGRVGGGGGDGN  86

Query  420  asssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQH  599
               +GG G +L  +KVVDRAINATI+LAAGTFA+TKLLTIDH+YWHGWT++EILRYAPQH
Sbjct  87   GPGNGGEGHDL--DKVVDRAINATILLAAGTFALTKLLTIDHDYWHGWTVYEILRYAPQH  144

Query  600  NWSAYE  617
            NWSAYE
Sbjct  145  NWSAYE  150



>gb|KEH38794.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=367

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 87/140 (62%), Gaps = 13/140 (9%)
 Frame = +3

Query  201  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG  380
             + +E DVI VQS+D TDQQ G++  +  E EGG           V G   NEG LS EG
Sbjct  54   VSTEEFDVIAVQSNDITDQQEGLI-VSRVEMEGGDGELGTTMTTQVNGFGANEGLLSLEG  112

Query  381  -PTGFgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
             P+            S   G   E  +EK++DR+INA+IVL AGTFA+TKLLTID +YWH
Sbjct  113  FPSS-----------SGLVGNENEENVEKLLDRSINASIVLVAGTFALTKLLTIDSDYWH  161

Query  558  GWTLFEILRYAPQHNWSAYE  617
            GWT++EI+RYAP HNW AYE
Sbjct  162  GWTIYEIVRYAPLHNWLAYE  181



>gb|KFK35762.1| hypothetical protein AALP_AA4G033000 [Arabis alpina]
Length=352

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            MEK++DR+INATIVLAAGT+AI+KLLTIDH+YWHGWTLFEILRYAPQH+W AYE
Sbjct  112  MEKMIDRSINATIVLAAGTYAISKLLTIDHDYWHGWTLFEILRYAPQHSWIAYE  165



>emb|CBI20352.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +E+++DR+INATIVLAAG+FA+TKLLTID +YWHGWT+FEILRYAPQHNWSAYE
Sbjct  18   VERLIDRSINATIVLAAGSFAVTKLLTIDADYWHGWTIFEILRYAPQHNWSAYE  71



>gb|KDO74163.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=257

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ME+++DR INATIVLA GTFAITKLLTID +YWHGWT+FEI+RYAP HNW+AYE
Sbjct  13   MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYAPLHNWTAYE  66



>gb|EPS62403.1| hypothetical protein M569_12387, partial [Genlisea aurea]
Length=247

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++DR INATIVLAAG+FAITKLLTIDH+YWHGWT +E+LRYAPQHNW AYE
Sbjct  9    KRIMDRVINATIVLAAGSFAITKLLTIDHDYWHGWTFYEVLRYAPQHNWIAYE  61



>ref|XP_006447326.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
 gb|ESR60566.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
Length=287

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +K++ RAINATIVL AGTFA+T+LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  156



>gb|KDO40773.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=287

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +K++ RAINATIVL AGTFA+T+LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  156



>gb|KDO40772.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=293

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +K++ RAINATIVL AGTFA+T+LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  156



>ref|XP_006447327.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
 ref|XP_006491636.1| PREDICTED: uncharacterized protein LOC102614505 isoform X1 [Citrus 
sinensis]
 gb|ESR60567.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
Length=346

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +K++ RAINATIVL AGTFA+T+LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  156



>gb|KDO40771.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=346

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +K++ RAINATIVL AGTFA+T+LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  156



>ref|XP_008386298.1| PREDICTED: uncharacterized protein LOC103448811 [Malus domestica]
Length=246

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
             E++VDR INA ++LAAGTFA+TKL+T+D +YWHGWTL+EIL YAPQHNWSAYE
Sbjct  40   FERLVDRTINAAVMLAAGTFALTKLITVDQDYWHGWTLYEILWYAPQHNWSAYE  93



>ref|NP_001062843.2| Os09g0315000 [Oryza sativa Japonica Group]
 dbj|BAF24757.2| Os09g0315000, partial [Oryza sativa Japonica Group]
Length=88

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
             K++DR IN  IVL A T+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  10   NKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  62



>gb|ABR17136.1| unknown [Picea sitchensis]
Length=294

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K +DRAINA +V AAG+F +TK+LTIDH+YWHGWTL+EI+RYAP HNW+AYE
Sbjct  49   KFIDRAINAAVVFAAGSFVVTKMLTIDHDYWHGWTLYEIVRYAPVHNWTAYE  100



>gb|ADM21186.1| peroxisomal membrane-like protein [Arabidopsis thaliana]
Length=245

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNW  605
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW GWTL+EILRYAP+HNW
Sbjct  120  EELTEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNW  179

Query  606  SAYE  617
             AYE
Sbjct  180  FAYE  183



>ref|XP_008230251.1| PREDICTED: uncharacterized protein LOC103329543 isoform X5 [Prunus 
mume]
Length=289

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  163



>ref|XP_008230249.1| PREDICTED: uncharacterized protein LOC103329543 isoform X3 [Prunus 
mume]
Length=294

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  163



>ref|XP_008230250.1| PREDICTED: uncharacterized protein LOC103329543 isoform X4 [Prunus 
mume]
Length=290

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  163



>ref|XP_008230252.1| PREDICTED: uncharacterized protein LOC103329543 isoform X6 [Prunus 
mume]
 ref|XP_008230253.1| PREDICTED: uncharacterized protein LOC103329543 isoform X7 [Prunus 
mume]
Length=286

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  163



>ref|XP_009357078.1| PREDICTED: uncharacterized protein LOC103947838 [Pyrus x bretschneideri]
Length=352

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  108  LDKLTSRAINALIVLGLGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  161



>ref|XP_009134349.1| PREDICTED: protein SYM1 [Brassica rapa]
Length=317

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++ R INA IVLAAGT A+TKLL+IDH+YWHGWTL+EILRYAP+HNW AYE
Sbjct  82   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWHGWTLYEILRYAPEHNWVAYE  134



>emb|CDY48204.1| BnaCnng15950D [Brassica napus]
Length=331

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++ R INA IVLAAGT A+TKLL+IDH+YWHGWTL+EILRYAP+HNW AYE
Sbjct  84   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWHGWTLYEILRYAPEHNWVAYE  136



>ref|XP_008379554.1| PREDICTED: uncharacterized protein LOC103442533 [Malus domestica]
Length=352

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  108  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  161



>ref|XP_006396570.1| hypothetical protein EUTSA_v10028802mg [Eutrema salsugineum]
 gb|ESQ38023.1| hypothetical protein EUTSA_v10028802mg [Eutrema salsugineum]
Length=323

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++ R INA IVLAAGT A+TKLL+IDH+YWHGWTL+EILRYAP+HNW AYE
Sbjct  86   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWHGWTLYEILRYAPEHNWVAYE  138



>gb|AAD11583.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAD14469.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77826.1| hypothetical protein [Arabidopsis thaliana]
Length=236

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNW  605
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW GWTL+EILRYAP+HNW
Sbjct  69   EELSEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNW  128

Query  606  SAYE  617
             AYE
Sbjct  129  FAYE  132



>ref|XP_007217251.1| hypothetical protein PRUPE_ppa007825mg [Prunus persica]
 gb|EMJ18450.1| hypothetical protein PRUPE_ppa007825mg [Prunus persica]
Length=354

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  163



>emb|CDX90887.1| BnaA03g25670D [Brassica napus]
Length=328

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++ R INA IVLAAGT A+TKLL+IDH+YWHGWTL+EILRYAP+HNW AYE
Sbjct  81   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWHGWTLYEILRYAPEHNWVAYE  133



>ref|NP_974505.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AEE82316.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=361

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNW  605
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW GWTL+EILRYAP+HNW
Sbjct  69   EELSEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNW  128

Query  606  SAYE  617
             AYE
Sbjct  129  FAYE  132



>ref|XP_009766316.1| PREDICTED: protein SYM1 [Nicotiana sylvestris]
Length=335

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  471  DRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            DR +NA IVL AGTFAITKLLTIDH+YWHGWT +EILRYAP+HNW AYE
Sbjct  96   DRFLNAAIVLGAGTFAITKLLTIDHDYWHGWTFYEILRYAPEHNWIAYE  144



>ref|XP_010095804.1| Protein SYM1 [Morus notabilis]
 gb|EXB62272.1| Protein SYM1 [Morus notabilis]
Length=349

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++  RAINA IVL  GTFAITKL TIDH+YWHGWTL+E+LRYAP+HNW AYE
Sbjct  107  LDRLTSRAINAAIVLGFGTFAITKLFTIDHDYWHGWTLYEVLRYAPEHNWIAYE  160



>gb|KJB79963.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
 gb|KJB79965.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=287

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +EK+  RAINA+IVL  GT A++KLLTIDH+YWHGWTL+E+LRY PQHNW AYE
Sbjct  102  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPQHNWIAYE  155



>gb|KJB79962.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=303

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +EK+  RAINA+IVL  GT A++KLLTIDH+YWHGWTL+E+LRY PQHNW AYE
Sbjct  102  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPQHNWIAYE  155



>ref|XP_008230248.1| PREDICTED: mpv17-like protein isoform X2 [Prunus mume]
Length=354

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  163



>ref|XP_009623041.1| PREDICTED: protein SYM1 [Nicotiana tomentosiformis]
Length=340

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  471  DRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            DR +NA IVL AGTFAITKLLTIDH+YWHGWT +EILRYAP+HNW AYE
Sbjct  101  DRFLNAAIVLGAGTFAITKLLTIDHDYWHGWTFYEILRYAPEHNWIAYE  149



>ref|XP_008230247.1| PREDICTED: mpv17-like protein isoform X1 [Prunus mume]
Length=355

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  163



>gb|ABF97329.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=306

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVL A T+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  120  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  171



>gb|ABF97328.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=301

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVL A T+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  120  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  171



>ref|XP_010422462.1| PREDICTED: LOW QUALITY PROTEIN: mpv17-like protein [Camelina 
sativa]
Length=363

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  444  EELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            E+   ++++ R INATIVLAAGT A+TKLL+IDH+YW GWTL+EILRYAP+HNW AYE
Sbjct  82   EDRDNDRLMSRGINATIVLAAGTVAVTKLLSIDHDYWQGWTLYEILRYAPEHNWVAYE  139



>ref|NP_192250.2| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AAU94426.1| At4g03410 [Arabidopsis thaliana]
 gb|AEE82315.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=317

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNW  605
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW GWTL+EILRYAP+HNW
Sbjct  69   EELSEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNW  128

Query  606  SAYE  617
             AYE
Sbjct  129  FAYE  132



>gb|EAZ27617.1| hypothetical protein OsJ_11561 [Oryza sativa Japonica Group]
Length=332

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVL A T+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  117  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  168



>gb|AAP40491.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01540.1| hypothetical protein [Arabidopsis thaliana]
Length=317

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNW  605
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW GWTL+EILRYAP+HNW
Sbjct  69   EELSEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNW  128

Query  606  SAYE  617
             AYE
Sbjct  129  FAYE  132



>gb|KJB79961.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=345

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +EK+  RAINA+IVL  GT A++KLLTIDH+YWHGWTL+E+LRY PQHNW AYE
Sbjct  102  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPQHNWIAYE  155



>gb|KJB79964.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=348

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +EK+  RAINA+IVL  GT A++KLLTIDH+YWHGWTL+E+LRY PQHNW AYE
Sbjct  102  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPQHNWIAYE  155



>gb|EEC75642.1| hypothetical protein OsI_12389 [Oryza sativa Indica Group]
Length=369

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVL A T+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  117  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  168



>ref|NP_001050563.1| Os03g0583800 [Oryza sativa Japonica Group]
 gb|AAS07184.1| putative peroxisomal membrane protein [Oryza sativa Japonica 
Group]
 gb|ABF97327.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12477.1| Os03g0583800 [Oryza sativa Japonica Group]
 dbj|BAG89204.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94010.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVL A T+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  120  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  171



>gb|KDP24169.1| hypothetical protein JCGZ_25826 [Jatropha curcas]
Length=354

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            EK + RAINA+IVL  GT A++KLLTIDH+YWHGWTL+E+LRY P+HNW AYE
Sbjct  112  EKFISRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPEHNWIAYE  164



>ref|XP_004487310.1| PREDICTED: protein SYM1-like isoform X1 [Cicer arietinum]
Length=359

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  474  RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            RAINATIVL  G FA+TKLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  84   RAINATIVLGFGAFAVTKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  131



>ref|XP_010657274.1| PREDICTED: mpv17-like protein [Vitis vinifera]
 emb|CBI28907.3| unnamed protein product [Vitis vinifera]
Length=357

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
             +++  + INATIVLA GT AIT+LLTIDH+YWHGWTL+E+LRYAP+HNW AYE
Sbjct  115  FDRLRSKTINATIVLAGGTLAITRLLTIDHDYWHGWTLYEVLRYAPEHNWVAYE  168



>ref|XP_004487311.1| PREDICTED: protein SYM1-like isoform X2 [Cicer arietinum]
Length=321

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  474  RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            RAINATIVL  G FA+TKLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  84   RAINATIVLGFGAFAVTKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  131



>ref|XP_002874865.1| hypothetical protein ARALYDRAFT_490222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51124.1| hypothetical protein ARALYDRAFT_490222 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++ R INA IVLAAGT A+TKLLTIDH+YW GWTL+EILRYAP+HNW AYE
Sbjct  75   DQLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWVAYE  127



>ref|XP_002517962.1| Peroxisomal membrane protein, putative [Ricinus communis]
 gb|EEF44480.1| Peroxisomal membrane protein, putative [Ricinus communis]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            EK++ RAINA+IVL  GT A++KLLTIDH+YWHGWTL+E+LRY P+HNW AYE
Sbjct  99   EKLMTRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPEHNWIAYE  151



>ref|NP_001151402.1| mpv17 / PMP22 family protein [Zea mays]
 gb|ACG42715.1| mpv17 / PMP22 family protein [Zea mays]
 tpg|DAA50134.1| TPA: mpv17 / PMP22 family protein [Zea mays]
Length=353

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVLAA T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  115  KMLDRGINTAIVLAASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  166



>dbj|BAJ94190.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
             K++DR INA IVL A T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  101  NKMLDRGINAAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  153



>ref|XP_011039752.1| PREDICTED: uncharacterized protein LOC105136210 isoform X2 [Populus 
euphratica]
Length=291

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            E++  RAINATIVL  GT A+++LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  107  ERMTSRAINATIVLGFGTLAVSRLLTIDHDYWHGWTLYEILRYLPEHNWIAYE  159



>ref|XP_006650305.1| PREDICTED: peroxisomal membrane protein 2-like [Oryza brachyantha]
Length=238

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  465  VVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++DR IN  IVL A T+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  1    MLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  51



>gb|KCW89501.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
Length=265

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++V R INAT+VL  GT A+TKLLT+DH+YW GWTL+E+LRYAP+HNW AYE
Sbjct  114  LQRLVGRGINATLVLGFGTLAVTKLLTVDHDYWQGWTLYEVLRYAPEHNWIAYE  167



>ref|XP_006366011.1| PREDICTED: protein SYM1-like [Solanum tuberosum]
Length=335

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  471  DRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            DR  NA+IVL AGT AIT+LLTIDH YWHGWTL+EILRYAP+HNW AYE
Sbjct  96   DRFFNASIVLGAGTLAITRLLTIDHEYWHGWTLYEILRYAPEHNWIAYE  144



>ref|XP_010455892.1| PREDICTED: protein SYM1-like [Camelina sativa]
Length=322

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  444  EELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            E+   ++++ R INA IVLAAGT A+TKLL+IDH+YW GWTL+EILRYAP+HNW AYE
Sbjct  82   EDRDNDRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWQGWTLYEILRYAPEHNWVAYE  139



>gb|KHG05370.1| Peroxisomal membrane 2 [Gossypium arboreum]
Length=362

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +EK+  RAINA+IVL  GT A++KLLTIDH+YWHGWTL+E+LRY P+HNW AYE
Sbjct  105  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPEHNWIAYE  158



>ref|XP_008353524.1| PREDICTED: PXMP2/4 family protein 1-like [Malus domestica]
Length=352

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++K+  RAINA IVL  GT A++KLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  108  LDKLTSRAINALIVLGFGTLAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  161



>ref|XP_006371588.1| hypothetical protein POPTR_0019s13430g [Populus trichocarpa]
 gb|ERP49385.1| hypothetical protein POPTR_0019s13430g [Populus trichocarpa]
Length=349

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            E++  RAINATIVL  GT A+++LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  107  ERMTSRAINATIVLGFGTLAVSRLLTIDHDYWHGWTLYEILRYLPEHNWIAYE  159



>ref|XP_011085340.1| PREDICTED: peroxisomal membrane protein 2 [Sesamum indicum]
Length=333

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  471  DRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            D  +NA IVLAAG+ AITKLLTIDH+YWHGWTL+E+LRYAP+HNW+AYE
Sbjct  97   DSLLNAAIVLAAGSLAITKLLTIDHDYWHGWTLYEVLRYAPEHNWNAYE  145



>ref|XP_011039751.1| PREDICTED: protein SYM1 isoform X1 [Populus euphratica]
Length=352

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            E++  RAINATIVL  GT A+++LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  107  ERMTSRAINATIVLGFGTLAVSRLLTIDHDYWHGWTLYEILRYLPEHNWIAYE  159



>ref|XP_006288235.1| hypothetical protein CARUB_v10001476mg [Capsella rubella]
 gb|EOA21133.1| hypothetical protein CARUB_v10001476mg [Capsella rubella]
Length=319

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +++ R INA IVLAAGT A+TKLLTIDH+YW GWTL+EILRYAP+HNW AYE
Sbjct  85   RLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWVAYE  136



>ref|XP_004982515.1| PREDICTED: uncharacterized protein LOC101756875 [Setaria italica]
Length=356

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K +DRAIN  IVL A T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  118  KALDRAINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  169



>gb|EYU26133.1| hypothetical protein MIMGU_mgv1a009627mg [Erythranthe guttata]
Length=336

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  471  DRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            DR INA IVL AG+ AITKLLTIDH+YWHGWTL+E+LRYAP+H+W+AYE
Sbjct  97   DRLINAAIVLGAGSLAITKLLTIDHDYWHGWTLYEVLRYAPEHSWNAYE  145



>ref|XP_004248154.1| PREDICTED: protein SYM1 [Solanum lycopersicum]
 ref|XP_010327063.1| PREDICTED: protein SYM1 [Solanum lycopersicum]
Length=335

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  471  DRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            DR  NA+IVL AGT A+T+LLTIDH YWHGWTL+EILRYAP+HNW AYE
Sbjct  96   DRFFNASIVLGAGTLAVTRLLTIDHEYWHGWTLYEILRYAPEHNWIAYE  144



>ref|XP_010051684.1| PREDICTED: uncharacterized protein LOC104440441 isoform X2 [Eucalyptus 
grandis]
Length=292

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++V R INAT+VL  GT A+TKLLT+DH+YW GWTL+E+LRYAP+HNW AYE
Sbjct  114  LQRLVGRGINATLVLGFGTLAVTKLLTVDHDYWQGWTLYEVLRYAPEHNWIAYE  167



>ref|XP_003562336.1| PREDICTED: uncharacterized protein LOC100846887 [Brachypodium 
distachyon]
Length=359

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVL A T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  122  KMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  173



>ref|XP_002466876.1| hypothetical protein SORBIDRAFT_01g015680 [Sorghum bicolor]
 gb|EER93874.1| hypothetical protein SORBIDRAFT_01g015680 [Sorghum bicolor]
Length=367

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVL A T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  128  KMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  179



>gb|AFW68287.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
Length=294

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K++DR IN  IVL A T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  56   KMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  107



>ref|XP_008681255.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=348

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 85/161 (53%), Gaps = 26/161 (16%)
 Frame = +3

Query  150  PTKLQLFPRPVSK-----QFAAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDID  314
            P+ L+L PRP  +     +FAAA   E DV+P   ++      G ++    E  GG  +D
Sbjct  25   PSLLRL-PRPTKRLRRALRFAAAG-DEADVLPGPGAEGEAVVPGRLEEQPDEQLGGSQLD  82

Query  315  SIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssggagEELGMEKVVDRAINATI  494
                           G L+F+G           +   +  GA    G  K++DR IN  I
Sbjct  83   --------------IGGLAFQGDV-----GGGFTGGGAGSGASGGGGGNKMLDRGINTAI  123

Query  495  VLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            VL A T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  124  VLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  164



>gb|EMT03498.1| Peroxisomal membrane protein 2 [Aegilops tauschii]
Length=237

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  465  VVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++DR INA IVL A T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  1    MLDRGINAAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  51



>ref|NP_001136458.1| hypothetical protein [Zea mays]
 ref|XP_008681254.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81975.1| unknown [Zea mays]
 gb|ACR38508.1| unknown [Zea mays]
 gb|ACR38595.1| unknown [Zea mays]
 gb|AFW68288.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
 gb|AFW68289.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
Length=351

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 85/161 (53%), Gaps = 26/161 (16%)
 Frame = +3

Query  150  PTKLQLFPRPVSK-----QFAAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDID  314
            P+ L+L PRP  +     +FAAA   E DV+P   ++      G ++    E  GG  +D
Sbjct  25   PSLLRL-PRPTKRLRRALRFAAAG-DEADVLPGPGAEGEAVVPGRLEEQPDEQLGGSQLD  82

Query  315  SIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssggagEELGMEKVVDRAINATI  494
                           G L+F+G           +   +  GA    G  K++DR IN  I
Sbjct  83   --------------IGGLAFQGDV-----GGGFTGGGAGSGASGGGGGNKMLDRGINTAI  123

Query  495  VLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            VL A T+A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  124  VLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  164



>ref|XP_010051673.1| PREDICTED: uncharacterized protein LOC104440441 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010051678.1| PREDICTED: uncharacterized protein LOC104440441 isoform X1 [Eucalyptus 
grandis]
 gb|KCW89498.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
 gb|KCW89499.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
 gb|KCW89500.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
Length=350

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++V R INAT+VL  GT A+TKLLT+DH+YW GWTL+E+LRYAP+HNW AYE
Sbjct  114  LQRLVGRGINATLVLGFGTLAVTKLLTVDHDYWQGWTLYEVLRYAPEHNWIAYE  167



>gb|KFK30935.1| hypothetical protein AALP_AA6G045100 [Arabis alpina]
Length=316

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++++ R INA IVLA G+ A+TKLLTIDH+YW GWTL+EILRYAP+HNW AYE
Sbjct  79   DRLMSRGINAAIVLATGSIAVTKLLTIDHDYWQGWTLYEILRYAPEHNWDAYE  131



>ref|XP_007043533.1| Peroxisomal membrane 22 kDa family protein [Theobroma cacao]
 gb|EOX99364.1| Peroxisomal membrane 22 kDa family protein [Theobroma cacao]
Length=451

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  456  MEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
             EK+  RAINA+IVL  GT A++KLLTIDH+YWHGWTLFE+ RY P+HNW AYE
Sbjct  208  FEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLFEVFRYVPEHNWIAYE  261



>ref|XP_010522636.1| PREDICTED: protein SYM1 [Tarenaya hassleriana]
Length=316

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +++ R INA IVL AGT A+T+LLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  78   RLMSRGINAAIVLGAGTVAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYE  129



>ref|XP_004304121.1| PREDICTED: protein SYM1 [Fragaria vesca subsp. vesca]
Length=341

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K+  RAINA IVL  GTFA++KLLTIDH+YWHGWTL+EI++Y P+HNW AYE
Sbjct  99   KLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEIVKYVPEHNWIAYE  150



>gb|KEH39092.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=318

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  474  RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            RAINA IVL  G FA+TKLLTIDH+YWHGWTL+EIL+Y P+HNW AYE
Sbjct  80   RAINAAIVLGFGAFAVTKLLTIDHDYWHGWTLYEILKYVPEHNWIAYE  127



>gb|KEH39091.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=339

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  474  RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            RAINA IVL  G FA+TKLLTIDH+YWHGWTL+EIL+Y P+HNW AYE
Sbjct  80   RAINAAIVLGFGAFAVTKLLTIDHDYWHGWTLYEILKYVPEHNWIAYE  127



>gb|KEH39090.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=344

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  474  RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            RAINA IVL  G FA+TKLLTIDH+YWHGWTL+EIL+Y P+HNW AYE
Sbjct  80   RAINAAIVLGFGAFAVTKLLTIDHDYWHGWTLYEILKYVPEHNWIAYE  127



>gb|EMT31197.1| Peroxisomal membrane protein 2 [Aegilops tauschii]
Length=237

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  465  VVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++DR INA IVL A TFA+TKLLT+D  YWHGWT+ EILRY PQHNWSAYE
Sbjct  1    MLDRGINAAIVLGAITFALTKLLTVDQEYWHGWTILEILRYMPQHNWSAYE  51



>gb|EMS63851.1| Peroxisomal membrane protein 2 [Triticum urartu]
Length=238

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  465  VVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++DR INA IVL A T A+TKLLT+D +YWHGWT+FEILRY P+HNWSAYE
Sbjct  1    MLDRGINAAIVLGASTCALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYE  51



>gb|EMS63743.1| Protein SYM1 [Triticum urartu]
Length=250

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  465  VVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++D  INA IVL A TFA+TK+LT+D +YWHGWT+FEILRY PQHNWSAYE
Sbjct  1    MLDLGINAAIVLGAITFALTKVLTVDQDYWHGWTIFEILRYMPQHNWSAYE  51



>gb|ACJ84916.1| unknown [Medicago truncatula]
Length=205

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  474  RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            RAINA IVL  G  A+TKLLTIDH+YWHGWTL+EIL+Y P+HNW AYE
Sbjct  80   RAINAAIVLGFGASAVTKLLTIDHDYWHGWTLYEILKYVPEHNWIAYE  127



>ref|XP_007149878.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris]
 gb|ESW21872.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris]
Length=316

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  480  INATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            INA IVL  GTFA+TKLLTIDH+YWHGWTL+EILRY P+HNW AYE
Sbjct  81   INAIIVLGFGTFAVTKLLTIDHDYWHGWTLYEILRYIPEHNWIAYE  126



>gb|ACU17682.1| unknown [Glycine max]
Length=196

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  480  INATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +NA I L  GTFA+TKLLTIDH+YWHGWTLFEI+RY P+HNW AYE
Sbjct  87   VNAIIALGFGTFAVTKLLTIDHDYWHGWTLFEIVRYIPEHNWIAYE  132



>ref|XP_003543349.1| PREDICTED: peroxisomal membrane protein 2 [Glycine max]
Length=322

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  480  INATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +NA IVL  GTFA+TKLLTIDH+YWHGWTLFEI+RY P+HNW AYE
Sbjct  87   VNAIIVLGFGTFAVTKLLTIDHDYWHGWTLFEIVRYIPEHNWIAYE  132



>ref|XP_008455339.1| PREDICTED: mpv17-like protein [Cucumis melo]
Length=352

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 4/62 (6%)
 Frame = +3

Query  444  EELGMEKVVD----RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSA  611
            EE G ++V+     RA+NATIVL  GT  +TKLLTIDH  WHGWTL+E+LRYAP+HNW A
Sbjct  98   EENGADEVLKGFSGRAVNATIVLGFGTLLVTKLLTIDHELWHGWTLYEVLRYAPEHNWIA  157

Query  612  YE  617
            YE
Sbjct  158  YE  159



>gb|KHN36615.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=409

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  480  INATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +NA IVL  GTFA+TKLLTIDH+YWHGWTLFEI+RY P+HNW AYE
Sbjct  87   VNAIIVLGFGTFAVTKLLTIDHDYWHGWTLFEIVRYIPEHNWIAYE  132



>ref|XP_004137017.1| PREDICTED: uncharacterized protein LOC101214701 [Cucumis sativus]
 gb|KGN43598.1| hypothetical protein Csa_7G047330 [Cucumis sativus]
Length=353

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  474  RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            RA+NATIVL  GT  +TKLLTIDH  WHGWTL+E+LRYAP+HNW AYE
Sbjct  113  RAVNATIVLGFGTLLVTKLLTIDHELWHGWTLYEVLRYAPEHNWIAYE  160



>ref|XP_004155526.1| PREDICTED: uncharacterized protein LOC101223761 [Cucumis sativus]
Length=375

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  474  RAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            RA+NATIVL  GT  +TKLLTIDH  WHGWTL+E+LRYAP+HNW AYE
Sbjct  113  RAVNATIVLGFGTLLVTKLLTIDHELWHGWTLYEVLRYAPEHNWIAYE  160



>dbj|BAD34004.1| peroxisomal membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD36403.1| peroxisomal membrane protein-like [Oryza sativa Japonica Group]
Length=364

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 92/180 (51%), Gaps = 23/180 (13%)
 Frame = +3

Query  78   LPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQ  257
            LP P+ LR    P P   +PS  + T+       +  + AAAAA+E DV+P   ++    
Sbjct  58   LPLPRLLRG-HHPPPSCSAPSLLRLTRSSRR---LRLRAAAAAAEEADVLPGPGAEGEMA  113

Query  258  QGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssgg  437
             GG ++       GG  +D               G L+F+     G       A  S G 
Sbjct  114  AGGRLEEQPEGPIGGSQVD--------------IGGLAFQ-----GDMGGGGFAGGSGGA  154

Query  438  agEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
                    K++DR IN  IVL A T+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  155  GAGGGDGNKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  214



>ref|XP_003539526.1| PREDICTED: peroxisomal membrane protein 2-like [Glycine max]
Length=322

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  483  NATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            NA IVL  GTFA+TKLLTIDH+YWHGWTL+EI+RY P+HNW AYE
Sbjct  88   NAIIVLGFGTFAVTKLLTIDHDYWHGWTLYEIVRYIPEHNWIAYE  132



>gb|KHN04274.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=332

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  483  NATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            NA IVL  GTFA+TKLLTIDH+YWHGWTL+EI+RY P+HNW AYE
Sbjct  88   NAIIVLGFGTFAVTKLLTIDHDYWHGWTLYEIVRYIPEHNWIAYE  132



>ref|XP_002530181.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32195.1| conserved hypothetical protein [Ricinus communis]
Length=306

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 102/187 (55%), Gaps = 29/187 (16%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSK---PNPKTGSPSHF---KPTKLQLFPRPVSKQ------FAAA  203
            MA+++ + +P +L  LSK   P  K    SHF   K T+  +F R   ++        + 
Sbjct  1    MASLHAI-SPHSLLPLSKSKKPTSKILPSSHFLGSKFTQSLIFSRNKQQRGESSWLLNSV  59

Query  204  AAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGP  383
              +ELDVIPVQS DS DQQ G+V  ++ E+EG   + + V+              S EG 
Sbjct  60   VQEELDVIPVQSEDSVDQQEGMV-MSQVESEGSDQLATQVSGFG-----------SSEGQ  107

Query  384  TGFgsssssssaass---sggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYW  554
              F   SS+SS++           EL M+++ DR +NA IVLAAG+FAITKLLTID +YW
Sbjct  108  LSFEGFSSASSSSGIGDDEERRQRELEMDRLADRTLNAMIVLAAGSFAITKLLTIDQDYW  167

Query  555  H-GWTLF  572
            H GW L+
Sbjct  168  HAGWKLW  174



>emb|CDP14740.1| unnamed protein product [Coffea canephora]
Length=330

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  471  DRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +R +NA IVL  GT AITKLL+IDH YWHGWTL+E+L+ AP+HNW AYE
Sbjct  101  ERLLNAAIVLGVGTLAITKLLSIDHEYWHGWTLYEVLKNAPEHNWIAYE  149



>gb|EEE59409.1| hypothetical protein OsJ_11557 [Oryza sativa Japonica Group]
Length=195

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  501  AAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
              GT+A+TKLLT+DH+YWHGWT+FEILRY P+HNWSAYE
Sbjct  33   GGGTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYE  71



>ref|XP_001774069.1| predicted protein [Physcomitrella patens]
 gb|EDQ61121.1| predicted protein [Physcomitrella patens]
Length=268

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            K +DR +NA +V  A  +AITK +T+DH+ W GWT+FEIL+YAP HNW AYE
Sbjct  18   KYLDRTVNALLVGGAILYAITKAVTVDHDVWQGWTMFEILKYAPLHNWKAYE  69



>ref|XP_001765838.1| predicted protein [Physcomitrella patens]
 gb|EDQ69429.1| predicted protein, partial [Physcomitrella patens]
Length=225

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  462  KVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            +++DR  NA +  AA ++A+TK +T+DH+ WHGWT+FE+L+YAP HNW AYE
Sbjct  5    RLLDRTFNALLAGAAISYAVTKAVTVDHDVWHGWTVFEVLKYAPLHNWHAYE  56



>ref|XP_006374188.1| hypothetical protein POPTR_0015s04090g [Populus trichocarpa]
 gb|ERP51985.1| hypothetical protein POPTR_0015s04090g [Populus trichocarpa]
Length=159

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 54/116 (47%), Gaps = 35/116 (30%)
 Frame = +3

Query  210  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  389
            KEL+VIPVQS D+ DQ  G+V++  +  EG                     RL       
Sbjct  39   KELNVIPVQSGDNVDQHEGIVESQAKR-EG----------------TKLATRLQV-----  76

Query  390  FgsssssssaasssggagEELGMEKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
                               +L  E ++D+ INA IVL  GT++ITKLLT+DHNYWH
Sbjct  77   -------------LVLMERKLESETLIDKTINAMIVLGVGTYSITKLLTVDHNYWH  119



>ref|XP_002966359.1| hypothetical protein SELMODRAFT_66864, partial [Selaginella moellendorffii]
 gb|EFJ32386.1| hypothetical protein SELMODRAFT_66864, partial [Selaginella moellendorffii]
Length=236

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++ VDR +NA+++ AA  +A+ K++T+D +YW GWT +EI++YAP HNWSAYE
Sbjct  5    DRQVDRFLNASLIAAAAAYALGKIVTVDQDYWQGWTFYEIIKYAPVHNWSAYE  57



>ref|XP_002978201.1| hypothetical protein SELMODRAFT_56885, partial [Selaginella moellendorffii]
 gb|EFJ20858.1| hypothetical protein SELMODRAFT_56885, partial [Selaginella moellendorffii]
Length=236

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWHGWTLFEILRYAPQHNWSAYE  617
            ++ VDR +NA+++ AA  +A+ K++T+D +YW GWT +EI++YAP HNWSAYE
Sbjct  5    DRQVDRFLNASLIAAAAAYALGKIVTVDQDYWQGWTFYEIIKYAPVHNWSAYE  57



>gb|ADM25596.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25606.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 6/44 (14%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWH  557
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW 
Sbjct  21   EELSEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQ  64



>ref|XP_008363403.1| PREDICTED: beta-glucosidase 13-like [Malus domestica]
Length=649

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 63/121 (52%), Gaps = 15/121 (12%)
 Frame = +3

Query  60   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPR----PVSKQ------FAAAAA  209
            MA I+ +   Q+  SL  P P+    +H KP      P+    P +KQ       +A   
Sbjct  18   MAAIHSIAA-QSFLSLPNPKPRKRIAAHPKPILTSKLPKNPTFPRNKQKGRRVLNSAVKR  76

Query  210  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  389
            +E DVIPVQSSDSTDQQ GVV A+  E+E G   D       V G   +EGRLSFEG  G
Sbjct  77   EECDVIPVQSSDSTDQQEGVV-ASRVESEAG---DQGELVSQVGGFGASEGRLSFEGAGG  132

Query  390  F  392
            F
Sbjct  133  F  133



>gb|ADM25574.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25576.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25578.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25586.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25587.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25590.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25592.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25593.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25594.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25595.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25597.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25598.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25600.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25602.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25604.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25607.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25610.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25611.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25612.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25613.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 6/44 (14%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWH  557
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW 
Sbjct  21   EELTEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQ  64



>gb|ADM25570.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25571.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25572.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25573.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25575.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25577.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25579.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25580.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25581.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25582.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25583.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25584.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25585.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25588.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25589.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25591.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25599.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25603.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25605.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 6/44 (14%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWH  557
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW 
Sbjct  21   EELTEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQ  64



>gb|ADM25609.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 6/44 (14%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWH  557
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW 
Sbjct  21   EELSEDKVEDTDRLMSRGINAAIVLAAGTGAVTKLLTIDHDYWQ  64



>gb|ADM25608.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 6/44 (14%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWH  557
            EEL  +KV D      R INA IVLAAGT A+TKLLTIDH+YW 
Sbjct  21   EELTEDKVEDTDRLMSRGINAAIVLAAGTGAVTKLLTIDHDYWQ  64



>gb|ADM25601.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  459  EKVVDRAINATIVLAAGTFAITKLLTIDHNYWH  557
            ++++ R INA IVLAAGT A+TKLLTIDH+YW 
Sbjct  32   DRLMSRGINAAIVLAAGTGAVTKLLTIDHDYWQ  64



>gb|ADM25614.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 30/44 (68%), Gaps = 6/44 (14%)
 Frame = +3

Query  444  EELGMEKVVD------RAINATIVLAAGTFAITKLLTIDHNYWH  557
            EEL  +KV D      R INA IVLAAGT A TKLLTIDH+YW 
Sbjct  21   EELTEDKVEDTDRLMSRGINAAIVLAAGTVADTKLLTIDHDYWQ  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520