BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039E03

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781599.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    277   5e-83   Nicotiana sylvestris
ref|XP_009781597.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    277   6e-83   Nicotiana sylvestris
ref|XP_009617761.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    276   2e-82   Nicotiana tomentosiformis
emb|CDP03723.1|  unnamed protein product                                265   2e-78   Coffea canephora [robusta coffee]
ref|XP_011080022.1|  PREDICTED: poly [ADP-ribose] polymerase 1          258   7e-76   Sesamum indicum [beniseed]
gb|KJB42240.1|  hypothetical protein B456_007G144300                    254   8e-75   Gossypium raimondii
gb|KJB42241.1|  hypothetical protein B456_007G144300                    254   8e-75   Gossypium raimondii
ref|XP_007050349.1|  Poly(ADP-ribose) polymerase 2 isoform 3            253   1e-74   
ref|XP_006341445.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     253   2e-74   
ref|XP_007050347.1|  Poly(ADP-ribose) polymerase 2 isoform 1            253   4e-74   
ref|XP_007050348.1|  Poly(ADP-ribose) polymerase 2 isoform 2            253   4e-74   
ref|XP_010318682.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    252   8e-74   Solanum lycopersicum
ref|XP_004235864.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    252   8e-74   Solanum lycopersicum
ref|XP_004151977.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     251   1e-73   Cucumis sativus [cucumbers]
ref|XP_002521021.1|  poly [ADP-ribose] polymerase, putative             250   2e-73   Ricinus communis
ref|XP_008461878.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    250   2e-73   Cucumis melo [Oriental melon]
ref|XP_009367709.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     233   5e-73   Pyrus x bretschneideri [bai li]
gb|KDP21330.1|  hypothetical protein JCGZ_21801                         249   5e-73   Jatropha curcas
ref|XP_010274828.1|  PREDICTED: poly [ADP-ribose] polymerase 1          249   8e-73   Nelumbo nucifera [Indian lotus]
ref|XP_008461880.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    248   1e-72   Cucumis melo [Oriental melon]
ref|XP_010652358.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   2e-72   Vitis vinifera
ref|XP_002302058.2|  poly (ADP-ribose) polymerase family protein        246   6e-72   
ref|XP_011028774.1|  PREDICTED: poly [ADP-ribose] polymerase 1          244   3e-71   Populus euphratica
ref|XP_010111892.1|  Poly [ADP-ribose] polymerase 1                     244   7e-71   
ref|XP_011457987.1|  PREDICTED: poly [ADP-ribose] polymerase 1          243   1e-70   Fragaria vesca subsp. vesca
emb|CAN75718.1|  hypothetical protein VITISV_037618                     239   3e-69   Vitis vinifera
ref|XP_006443872.1|  hypothetical protein CICLE_v10018683mg             237   2e-68   Citrus clementina [clementine]
ref|XP_009354923.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     234   1e-67   Pyrus x bretschneideri [bai li]
emb|CDY10794.1|  BnaA05g11420D                                          234   5e-67   Brassica napus [oilseed rape]
ref|XP_010522166.1|  PREDICTED: poly [ADP-ribose] polymerase 1          232   6e-67   Tarenaya hassleriana [spider flower]
ref|XP_007199702.1|  hypothetical protein PRUPE_ppa000811mg             232   8e-67   
ref|XP_010933094.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    231   1e-66   Elaeis guineensis
ref|XP_008235714.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   1e-66   Prunus mume [ume]
ref|XP_010469693.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     231   2e-66   Camelina sativa [gold-of-pleasure]
gb|KEH23887.1|  poly(ADP-ribose) polymerase domain protein              230   3e-66   Medicago truncatula
ref|XP_009144225.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    230   4e-66   Brassica rapa
ref|XP_009144226.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    230   4e-66   Brassica rapa
gb|KDO68484.1|  hypothetical protein CISIN_1g035625mg                   229   6e-66   Citrus sinensis [apfelsine]
ref|XP_008801332.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     228   1e-65   Phoenix dactylifera
ref|XP_009367708.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    229   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_009367706.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    228   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_008794292.1|  PREDICTED: poly [ADP-ribose] polymerase 1          227   4e-65   Phoenix dactylifera
ref|XP_006410264.1|  hypothetical protein EUTSA_v10016190mg             226   6e-65   
gb|EYU46476.1|  hypothetical protein MIMGU_mgv1a000724mg                226   1e-64   Erythranthe guttata [common monkey flower]
ref|XP_009398034.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    224   6e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007162524.1|  hypothetical protein PHAVU_001G159200g             224   7e-64   Phaseolus vulgaris [French bean]
ref|XP_010510210.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     223   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002881169.1|  hypothetical protein ARALYDRAFT_902162             223   1e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_010038006.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   1e-63   Eucalyptus grandis [rose gum]
ref|XP_010414140.1|  PREDICTED: poly [ADP-ribose] polymerase 1          222   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006293618.1|  hypothetical protein CARUB_v10022570mg             222   3e-63   Capsella rubella
ref|XP_004493762.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     221   5e-63   
ref|NP_850165.1|  poly [ADP-ribose] polymerase 2                        221   8e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAD20677.1|  putative poly (ADP-ribose) polymerase                   221   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521279.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    221   9e-63   Glycine max [soybeans]
ref|XP_006827512.1|  hypothetical protein AMTR_s00009p00185150          208   2e-62   
ref|XP_003554282.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     217   2e-61   Glycine max [soybeans]
ref|XP_009781598.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    213   5e-60   Nicotiana sylvestris
gb|EPS63698.1|  hypothetical protein M569_11084                         213   5e-60   Genlisea aurea
ref|XP_009617762.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    212   1e-59   
ref|XP_010679215.1|  PREDICTED: poly [ADP-ribose] polymerase 1          210   6e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK31229.1|  hypothetical protein AALP_AA6G085200                    209   1e-58   Arabis alpina [alpine rockcress]
gb|ACL53937.1|  unknown                                                 191   2e-54   Zea mays [maize]
ref|XP_010918778.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     195   9e-54   
ref|NP_001288538.1|  poly [ADP-ribose] polymerase 1                     191   3e-52   Zea mays [maize]
ref|XP_008461881.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    190   6e-52   Cucumis melo [Oriental melon]
ref|XP_006657714.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     187   1e-50   Oryza brachyantha
ref|XP_009398035.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    187   1e-50   
gb|EEC81908.1|  hypothetical protein OsI_25738                          185   6e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_001059453.1|  Os07g0413700                                       185   7e-50   
ref|XP_003557295.1|  PREDICTED: poly [ADP-ribose] polymerase 1          184   9e-50   Brachypodium distachyon [annual false brome]
ref|XP_004959167.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     181   5e-49   
ref|XP_001769461.1|  predicted protein                                  173   1e-45   
tpg|DAA39431.1|  TPA: hypothetical protein ZEAMMB73_927988              171   6e-45   
emb|CAA10889.1|  poly(ADP-ribose) polymerase                            171   6e-45   Zea mays [maize]
gb|EMT10595.1|  Poly (ADP-ribose) polymerase 1                          166   2e-44   
emb|CDY24761.1|  BnaC04g13660D                                          169   3e-44   Brassica napus [oilseed rape]
gb|EMS59386.1|  Poly [ADP-ribose] polymerase 1                          166   4e-44   Triticum urartu
gb|ADE76375.1|  unknown                                                 147   5e-38   Picea sitchensis
pdb|1V9X|A  Chain A, Solution Structure Of The First Zn-Finger Do...    132   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973881.1|  hypothetical protein SELMODRAFT_100128             143   3e-35   
gb|KHN10726.1|  Poly [ADP-ribose] polymerase 1                          142   2e-34   Glycine soja [wild soybean]
ref|XP_002969183.1|  hypothetical protein SELMODRAFT_90144              135   2e-32   
ref|XP_007050355.1|  Poly(ADP-ribose) polymerase 2, putative            124   8e-32   
ref|XP_002459755.1|  hypothetical protein SORBIDRAFT_02g009900          132   3e-31   
emb|CAA36917.1|  unnamed protein product                                115   1e-25   Gallus gallus [bantam]
sp|P26446.2|PARP1_CHICK  RecName: Full=Poly [ADP-ribose] polymera...    115   1e-25   Gallus gallus [bantam]
ref|XP_005817490.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     108   4e-25   
ref|XP_003971725.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     113   8e-25   Takifugu rubripes [tiger puffer]
ref|XP_007253978.1|  PREDICTED: poly [ADP-ribose] polymerase 1          112   2e-24   
ref|XP_005893451.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     107   3e-24   Bos mutus
ref|XP_006046141.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    111   4e-24   
ref|XP_007905391.1|  PREDICTED: poly [ADP-ribose] polymerase 1          111   5e-24   Callorhinchus milii [Australian ghost shark]
ref|XP_006625727.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     110   7e-24   
ref|NP_990594.2|  poly [ADP-ribose] polymerase 1                        110   8e-24   Gallus gallus [bantam]
gb|AAI12502.1|  PARP1 protein                                           105   8e-24   Bos taurus [bovine]
ref|XP_006046140.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    110   1e-23   Bubalus bubalis [domestic water buffalo]
ref|XP_007438803.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     104   1e-23   
ref|XP_005289622.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    109   2e-23   Chrysemys picta bellii
ref|XP_004013685.1|  PREDICTED: poly [ADP-ribose] polymerase 1          109   2e-23   
ref|XP_006268817.1|  PREDICTED: poly [ADP-ribose] polymerase 1          108   6e-23   
ref|XP_005523343.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    108   6e-23   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005690591.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    107   8e-23   
ref|XP_008285170.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    107   8e-23   Stegastes partitus
ref|XP_007552911.1|  PREDICTED: poly [ADP-ribose] polymerase 1          107   9e-23   Poecilia formosa
ref|XP_004210069.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     106   1e-22   
ref|XP_005216853.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    107   1e-22   Bos taurus [bovine]
ref|XP_005523344.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    107   1e-22   
ref|XP_006016655.1|  PREDICTED: poly [ADP-ribose] polymerase 1          106   2e-22   
ref|XP_005690590.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    106   2e-22   
ref|XP_006812383.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     106   2e-22   Saccoglossus kowalevskii
ref|XP_005454773.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    106   2e-22   
ref|XP_010851175.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    106   3e-22   Bison bison bison
ref|XP_008396025.1|  PREDICTED: poly [ADP-ribose] polymerase 1          106   3e-22   Poecilia reticulata
gb|EQB78542.1|  poly [ADP-ribose] polymerase 1                          106   3e-22   Camelus ferus
ref|XP_005914568.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    106   3e-22   
tpg|DAA21368.1|  TPA: poly [ADP-ribose] polymerase 1                    106   3e-22   Bos taurus [bovine]
ref|XP_010576040.1|  PREDICTED: poly [ADP-ribose] polymerase 1          105   3e-22   Haliaeetus leucocephalus
ref|XP_005734478.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    105   3e-22   
ref|XP_003740601.1|  PREDICTED: poly [ADP-ribose] polymerase-like       105   3e-22   
ref|XP_003216114.1|  PREDICTED: poly [ADP-ribose] polymerase 1          105   3e-22   Anolis carolinensis [Carolina anole]
ref|XP_001763712.1|  predicted protein                                97.8    4e-22   
gb|ETE69570.1|  Poly [ADP-ribose] polymerase 1                          105   4e-22   Ophiophagus hannah
ref|XP_004271024.1|  PREDICTED: poly [ADP-ribose] polymerase 1          105   5e-22   Orcinus orca [Orca]
ref|XP_010851174.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    105   6e-22   Bison bison bison
ref|XP_007210559.1|  hypothetical protein PRUPE_ppa014170mg           96.3    7e-22   
ref|XP_010732988.1|  PREDICTED: poly [ADP-ribose] polymerase 1          104   9e-22   
ref|NP_001233650.1|  poly [ADP-ribose] polymerase 1                     104   9e-22   Cricetulus griseus [Chinese hamsters]
ref|XP_009061157.1|  hypothetical protein LOTGIDRAFT_206927             104   1e-21   Lottia gigantea
gb|KFM63823.1|  Poly [ADP-ribose] polymerase 1                          102   1e-21   Stegodyphus mimosarum
ref|XP_010990763.1|  PREDICTED: poly [ADP-ribose] polymerase 1          104   1e-21   Camelus dromedarius [camel]
ref|XP_006188179.1|  PREDICTED: poly [ADP-ribose] polymerase 1          104   1e-21   Camelus ferus
ref|XP_004578951.1|  PREDICTED: poly [ADP-ribose] polymerase 1          103   2e-21   Ochotona princeps [southern American pika]
ref|XP_004313311.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    103   2e-21   
ref|XP_007464233.1|  PREDICTED: poly [ADP-ribose] polymerase 1          103   2e-21   Lipotes vexillifer [baiji]
gb|EFX75651.1|  hypothetical protein DAPPUDRAFT_55885                   103   2e-21   Daphnia pulex
ref|XP_011308727.1|  PREDICTED: poly [ADP-ribose] polymerase            103   2e-21   Fopius arisanus
gb|EFA00829.1|  hypothetical protein TcasGA2_TC003717                   103   2e-21   
ref|NP_001153714.1|  poly-(ADP-ribose) polymerase                       103   2e-21   Tribolium castaneum [rust-red flour beetle]
ref|XP_004653313.1|  PREDICTED: poly [ADP-ribose] polymerase 1          103   2e-21   Jaculus jaculus
ref|XP_008266574.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    103   2e-21   Oryctolagus cuniculus [domestic rabbit]
gb|AAH18620.1|  PARP1 protein                                         99.0    2e-21   Homo sapiens [man]
ref|XP_006797147.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     103   2e-21   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005914567.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    103   2e-21   Haplochromis burtoni
ref|XP_003449904.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    103   2e-21   Oreochromis niloticus
ref|XP_004541848.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     103   3e-21   Maylandia zebra
gb|AAH14206.1|  PARP1 protein                                         99.0    3e-21   Homo sapiens [man]
ref|XP_006812395.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     102   3e-21   Saccoglossus kowalevskii
pdb|4AV1|A  Chain A, Crystal Structure Of The Human Parp-1 Dna Bi...  98.2    3e-21   Homo sapiens [man]
ref|XP_006974251.1|  PREDICTED: poly [ADP-ribose] polymerase 1          102   3e-21   Peromyscus maniculatus bairdii
ref|XP_003462410.1|  PREDICTED: poly [ADP-ribose] polymerase 1          102   4e-21   Cavia porcellus [guinea pig]
ref|XP_007102732.1|  PREDICTED: poly [ADP-ribose] polymerase 1          102   4e-21   
ref|NP_777176.1|  poly [ADP-ribose] polymerase 1                        102   4e-21   Bos taurus [bovine]
ref|XP_006012380.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     102   4e-21   
ref|XP_011204662.1|  PREDICTED: poly [ADP-ribose] polymerase            102   4e-21   Bactrocera dorsalis [papaya fruit fly]
gb|AIZ09031.1|  poly [ADP-ribose] polymerase 1                          102   5e-21   Heterocephalus glaber [naked mole rat]
gb|ETN59550.1|  poly [adp-ribose] polymerase                            102   5e-21   Anopheles darlingi [American malaria mosquito]
emb|CAG09177.1|  unnamed protein product                              97.8    6e-21   Tetraodon nigroviridis
ref|XP_004519484.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    102   6e-21   
ref|XP_004519485.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    102   6e-21   
ref|XP_004375937.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    102   6e-21   Trichechus manatus latirostris
ref|XP_005349022.1|  PREDICTED: poly [ADP-ribose] polymerase 1          102   7e-21   Microtus ochrogaster [prairie voles]
ref|XP_006748394.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   99.0    7e-21   Leptonychotes weddellii
ref|XP_009025261.1|  hypothetical protein HELRODRAFT_95414              102   7e-21   Helobdella robusta
ref|XP_003791037.1|  PREDICTED: poly [ADP-ribose] polymerase 1          102   7e-21   Otolemur garnettii
tpd|FAA00236.1|  TPA: zinc finger protein                               100   8e-21   Ciona intestinalis [sea vase]
ref|XP_007534861.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    101   8e-21   Erinaceus europaeus [common hedgehog]
ref|XP_009184638.1|  PREDICTED: poly [ADP-ribose] polymerase 1          101   9e-21   
gb|EHH15492.1|  hypothetical protein EGK_01593                          101   9e-21   Macaca mulatta [rhesus macaque]
ref|XP_001090984.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    101   9e-21   
ref|XP_010380279.1|  PREDICTED: poly [ADP-ribose] polymerase 1          101   9e-21   Rhinopithecus roxellana
ref|XP_005541069.1|  PREDICTED: poly [ADP-ribose] polymerase 1          101   9e-21   Macaca fascicularis [crab eating macaque]
ref|XP_007986456.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    101   9e-21   Chlorocebus sabaeus
ref|XP_003357689.1|  PREDICTED: poly [ADP-ribose] polymerase 1          101   1e-20   
ref|XP_006157311.1|  PREDICTED: poly [ADP-ribose] polymerase 1          101   1e-20   Tupaia chinensis
ref|XP_004083528.1|  PREDICTED: poly [ADP-ribose] polymerase 1          101   1e-20   Oryzias latipes [Japanese rice fish]
dbj|BAE22758.1|  unnamed protein product                              95.9    1e-20   Mus musculus [mouse]
ref|XP_004605484.1|  PREDICTED: poly [ADP-ribose] polymerase 1          101   1e-20   Sorex araneus [Eurasian shrew]
ref|XP_005326600.1|  PREDICTED: poly [ADP-ribose] polymerase 1          101   1e-20   Ictidomys tridecemlineatus
emb|CDQ76498.1|  unnamed protein product                                100   2e-20   Oncorhynchus mykiss
ref|XP_009860226.1|  PREDICTED: poly [ADP-ribose] polymerase 1          100   2e-20   
ref|XP_011188189.1|  PREDICTED: poly [ADP-ribose] polymerase            100   2e-20   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_003999138.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    100   2e-20   
ref|XP_005078195.1|  PREDICTED: poly [ADP-ribose] polymerase 1          100   2e-20   Mesocricetus auratus [Syrian golden hamster]
ref|XP_011289117.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    100   2e-20   
ref|XP_004914864.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    100   2e-20   
ref|XP_002941174.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    100   2e-20   Xenopus tropicalis [western clawed frog]
sp|P11103.3|PARP1_MOUSE  RecName: Full=Poly [ADP-ribose] polymera...    100   3e-20   Mus musculus [mouse]
ref|XP_005175604.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    100   3e-20   
gb|AAB59447.1|  poly(ADP-ribose) synthetase                             100   3e-20   Homo sapiens [man]
ref|XP_005404552.1|  PREDICTED: poly [ADP-ribose] polymerase 1          100   3e-20   Chinchilla lanigera
dbj|BAG35260.1|  unnamed protein product                              99.8    4e-20   Homo sapiens [man]
gb|AAH37545.1|  Poly (ADP-ribose) polymerase 1                        99.8    4e-20   Homo sapiens [man]
ref|XP_003814976.1|  PREDICTED: poly [ADP-ribose] polymerase 1        99.8    4e-20   Pan paniscus [bonobo]
ref|XP_004519483.1|  PREDICTED: poly [ADP-ribose] polymerase-like...  99.8    4e-20   Ceratitis capitata [medfly]
gb|EAW69785.1|  poly (ADP-ribose) polymerase family, member 1, is...  99.8    4e-20   Homo sapiens [man]
gb|AAA60155.1|  poly(ADP-ribose) polymerase                           99.8    4e-20   Homo sapiens [man]
ref|NP_001609.2|  poly [ADP-ribose] polymerase 1                      99.8    4e-20   Homo sapiens [man]
dbj|BAE39743.1|  unnamed protein product                              99.8    4e-20   Mus musculus [mouse]
ref|XP_003949754.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  99.8    4e-20   
gb|ABM82562.1|  poly (ADP-ribose) polymerase family, member 1         99.8    4e-20   synthetic construct
dbj|BAE35080.1|  unnamed protein product                              99.8    4e-20   Mus musculus [mouse]
ref|XP_004700007.1|  PREDICTED: poly [ADP-ribose] polymerase 1        99.8    4e-20   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004065376.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  99.8    4e-20   
ref|NP_031441.2|  poly [ADP-ribose] polymerase 1                      99.8    4e-20   Mus musculus [mouse]
dbj|BAE31150.1|  unnamed protein product                              99.4    5e-20   Mus musculus [mouse]
dbj|BAE38574.1|  unnamed protein product                              99.8    5e-20   Mus musculus [mouse]
ref|XP_003275213.1|  PREDICTED: poly [ADP-ribose] polymerase 1        99.4    6e-20   
ref|XP_010780561.1|  PREDICTED: poly [ADP-ribose] polymerase 1        99.0    6e-20   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008820594.1|  PREDICTED: poly [ADP-ribose] polymerase 1        99.4    6e-20   Nannospalax galili
gb|AAA60137.1|  poly(ADP-ribose) polymerase                           99.0    7e-20   Homo sapiens [man]
dbj|BAE41080.1|  unnamed protein product                              99.0    8e-20   Mus musculus [mouse]
dbj|BAE27352.1|  unnamed protein product                              99.0    8e-20   Mus musculus [mouse]
ref|XP_003487068.1|  PREDICTED: poly [ADP-ribose] polymerase-like     99.0    8e-20   Bombus impatiens
gb|KFB53219.1|  AGAP003230-PA-like protein                            98.6    9e-20   Anopheles sinensis
ref|XP_002760624.1|  PREDICTED: poly [ADP-ribose] polymerase 1        98.6    1e-19   Callithrix jacchus [common marmoset]
ref|XP_003930339.1|  PREDICTED: poly [ADP-ribose] polymerase 1        98.6    1e-19   Saimiri boliviensis boliviensis
ref|XP_006897812.1|  PREDICTED: poly [ADP-ribose] polymerase 1        98.6    1e-19   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002073889.1|  GK14355                                          98.2    1e-19   Drosophila willistoni
ref|XP_004761981.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  98.2    1e-19   Mustela putorius furo [black ferret]
ref|NP_037195.1|  poly [ADP-ribose] polymerase 1                      98.2    1e-19   Rattus norvegicus [brown rat]
ref|XP_006871190.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   98.2    1e-19   Chrysochloris asiatica
ref|XP_004393605.1|  PREDICTED: poly [ADP-ribose] polymerase 1        98.2    1e-19   Odobenus rosmarus divergens
ref|XP_312938.4|  AGAP003230-PA                                       97.8    2e-19   Anopheles gambiae str. PEST
ref|XP_004761980.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  98.2    2e-19   
dbj|BAG10250.1|  poly [ADP-ribose] polymerase-1                       97.8    2e-19   synthetic construct
ref|XP_007935170.1|  PREDICTED: poly [ADP-ribose] polymerase 1        97.8    2e-19   Orycteropus afer afer
ref|XP_008311174.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  97.4    2e-19   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008311175.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  97.4    2e-19   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001862547.1|  poly                                             97.1    3e-19   Culex quinquefasciatus
ref|XP_002430760.1|  polyA polymerase, putative                       97.1    3e-19   Pediculus humanus corporis [human body lice]
gb|KFM63822.1|  Poly [ADP-ribose] polymerase 1                        97.1    4e-19   Stegodyphus mimosarum
ref|XP_001996195.1|  GH22365                                          96.3    6e-19   Drosophila grimshawi
ref|XP_006914334.1|  PREDICTED: poly [ADP-ribose] polymerase 1        96.3    6e-19   Pteropus alecto
ref|XP_007481563.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  96.3    7e-19   Monodelphis domestica
ref|XP_011254366.1|  PREDICTED: poly [ADP-ribose] polymerase          95.9    8e-19   Camponotus floridanus
ref|XP_003693603.1|  PREDICTED: poly [ADP-ribose] polymerase-like     95.9    9e-19   Apis florea [dwarf honeybee]
ref|XP_624477.3|  PREDICTED: poly [ADP-ribose] polymerase             95.9    9e-19   Apis mellifera [bee]
ref|NP_001081571.1|  poly [ADP-ribose] polymerase 1                   95.5    1e-18   Xenopus laevis [clawed frog]
ref|XP_006612556.1|  PREDICTED: poly [ADP-ribose] polymerase-like     95.5    1e-18   Apis dorsata [rock honeybee]
ref|XP_010863533.1|  PREDICTED: poly [ADP-ribose] polymerase 1        95.1    1e-18   Esox lucius
ref|XP_003396806.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  95.1    1e-18   
ref|XP_001661932.1|  AAEL011815-PA                                    95.1    1e-18   Aedes aegypti
ref|XP_005959159.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   94.7    2e-18   Pantholops hodgsonii [Tibetan antelope]
ref|NP_001191521.1|  poly-(ADP-ribose) polymerase I                   94.7    2e-18   Aplysia californica
ref|XP_007167258.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  94.4    3e-18   Balaenoptera acutorostrata scammoni
sp|Q11208.1|PARP_SARPE  RecName: Full=Poly [ADP-ribose] polymeras...  94.0    3e-18   Sarcophaga peregrina
ref|XP_001090628.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  94.0    3e-18   
gb|KFB53220.1|  AGAP003230-PA-like protein                            94.0    4e-18   Anopheles sinensis
ref|XP_009076073.1|  PREDICTED: poly [ADP-ribose] polymerase 1        94.0    4e-18   Acanthisitta chloris
gb|EJW79600.1|  hypothetical protein WUBG_09490                       88.2    5e-18   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_002109067.1|  hypothetical protein TRIADDRAFT_19562            92.8    9e-18   Trichoplax adhaerens
ref|NP_001038407.1|  poly [ADP-ribose] polymerase 1                   92.4    1e-17   Danio rerio [leopard danio]
ref|XP_006198888.1|  PREDICTED: poly [ADP-ribose] polymerase 1        92.4    1e-17   Vicugna pacos
ref|XP_001638875.1|  predicted protein                                92.0    1e-17   Nematostella vectensis
gb|EKC34863.1|  Poly [ADP-ribose] polymerase 1                        92.0    2e-17   Crassostrea gigas
ref|XP_011426298.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   91.7    2e-17   Crassostrea gigas
dbj|BAG64403.1|  unnamed protein product                              91.7    2e-17   Homo sapiens [man]
ref|XP_003138958.1|  hypothetical protein LOAG_03373                  90.5    2e-17   
gb|EHJ70647.1|  poly                                                  91.7    2e-17   
ref|XP_001947212.1|  PREDICTED: poly [ADP-ribose] polymerase          91.7    2e-17   Acyrthosiphon pisum
ref|XP_010224835.1|  PREDICTED: poly [ADP-ribose] polymerase 1        90.9    3e-17   Tinamus guttatus
ref|XP_009873185.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   86.3    4e-17   Apaloderma vittatum
ref|XP_011499146.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  90.9    4e-17   Ceratosolen solmsi marchali
ref|XP_009568032.1|  PREDICTED: poly [ADP-ribose] polymerase 1        90.5    5e-17   Cuculus canorus
gb|EJD75827.1|  WGR domain-containing protein                         90.1    7e-17   Loa loa
ref|XP_003424731.1|  PREDICTED: poly [ADP-ribose] polymerase          89.7    1e-16   Nasonia vitripennis
ref|XP_010076719.1|  PREDICTED: poly [ADP-ribose] polymerase 1        89.7    1e-16   Pterocles gutturalis
ref|XP_005830024.1|  PARP1 poly polymerase                            89.4    1e-16   Guillardia theta CCMP2712
gb|KHJ46115.1|  Poly(ADP-ribose) polymerase catalytic domain protein  89.4    1e-16   Trichuris suis
ref|XP_010284063.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   88.6    1e-16   Phaethon lepturus
ref|XP_004641229.1|  PREDICTED: poly [ADP-ribose] polymerase 1        89.4    1e-16   Octodon degus
gb|ELT93548.1|  hypothetical protein CAPTEDRAFT_223861                89.4    1e-16   Capitella teleta
ref|XP_005289623.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  89.0    1e-16   
ref|XP_007071821.1|  PREDICTED: poly [ADP-ribose] polymerase 1        89.0    2e-16   
ref|XP_010195273.1|  PREDICTED: poly [ADP-ribose] polymerase 1        89.0    2e-16   Colius striatus
ref|XP_010154380.1|  PREDICTED: poly [ADP-ribose] polymerase 1        88.6    2e-16   Eurypyga helias
ref|XP_005043071.1|  PREDICTED: poly [ADP-ribose] polymerase 1        88.6    2e-16   
ref|XP_011165140.1|  PREDICTED: poly [ADP-ribose] polymerase-like     88.6    2e-16   Solenopsis invicta [imported red fire ant]
gb|EGW11182.1|  Poly [ADP-ribose] polymerase 1                        88.2    3e-16   
ref|XP_010007824.1|  PREDICTED: poly [ADP-ribose] polymerase 1        88.2    3e-16   
ref|XP_011033029.1|  PREDICTED: uncharacterized protein LOC105131653  86.7    3e-16   
ref|XP_001901649.1|  WGR domain containing protein                    88.2    3e-16   
sp|P31669.1|PARP1_XENLA  RecName: Full=Poly [ADP-ribose] polymera...  88.2    3e-16   
ref|XP_002058751.1|  GJ11149                                          88.2    3e-16   
ref|XP_009892579.1|  PREDICTED: poly [ADP-ribose] polymerase 1        88.2    3e-16   
ref|XP_005507407.1|  PREDICTED: poly [ADP-ribose] polymerase 1        88.2    3e-16   
ref|XP_010704958.1|  PREDICTED: poly [ADP-ribose] polymerase 1        88.2    3e-16   
emb|CDP98672.1|  Protein BM-PME-1, isoform b                          87.8    3e-16   
ref|XP_009813999.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.4    4e-16   
gb|ELW49552.1|  Poly [ADP-ribose] polymerase 1                        87.8    4e-16   
ref|XP_008628789.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.8    4e-16   
ref|XP_010391791.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.8    4e-16   
ref|XP_009935626.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  87.4    5e-16   
ref|XP_009476172.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.4    5e-16   
ref|XP_010162117.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.4    5e-16   
ref|XP_009283832.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.4    5e-16   
gb|AAI00002.1|  Poly (ADP-ribose) polymerase family, member 1         87.4    5e-16   
ref|XP_009331916.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.4    6e-16   
ref|XP_009581523.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.4    6e-16   
ref|XP_001998459.1|  GI23619                                          87.4    6e-16   
ref|XP_008933052.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.0    6e-16   
ref|XP_010611507.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.0    6e-16   
ref|XP_009684683.1|  PREDICTED: poly [ADP-ribose] polymerase 1        87.0    7e-16   
ref|XP_010128757.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.3    9e-16   
ref|XP_009708662.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.7    9e-16   
ref|XP_009985630.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.3    1e-15   
ref|XP_002019344.1|  GL12354                                          86.7    1e-15   
ref|XP_002137908.2|  GA25584                                          86.7    1e-15   
ref|XP_009092024.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.3    1e-15   
ref|XP_005488534.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.3    1e-15   
ref|XP_005151917.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  86.3    1e-15   
ref|XP_005241893.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.3    1e-15   
ref|XP_009899525.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.3    1e-15   
ref|XP_009470783.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.3    1e-15   
ref|XP_005441299.1|  PREDICTED: poly [ADP-ribose] polymerase 1        86.3    1e-15   
ref|XP_009969669.1|  PREDICTED: poly [ADP-ribose] polymerase 1        85.9    1e-15   
ref|XP_010180660.1|  PREDICTED: poly [ADP-ribose] polymerase 1        85.9    2e-15   
ref|XP_009646446.1|  PREDICTED: poly [ADP-ribose] polymerase 1        85.9    2e-15   
ref|XP_005427073.1|  PREDICTED: poly [ADP-ribose] polymerase 1        85.9    2e-15   
ref|XP_008948173.1|  PREDICTED: poly [ADP-ribose] polymerase 1        85.9    2e-15   
ref|XP_003707671.1|  PREDICTED: poly [ADP-ribose] polymerase-like     85.9    2e-15   
ref|XP_011138702.1|  PREDICTED: poly [ADP-ribose] polymerase          85.5    2e-15   
ref|XP_010134097.1|  PREDICTED: poly [ADP-ribose] polymerase 1        85.5    2e-15   
ref|XP_008559441.1|  PREDICTED: poly [ADP-ribose] polymerase-like     85.5    2e-15   
gb|KFO19690.1|  Poly [ADP-ribose] polymerase 1                        85.5    2e-15   
ref|XP_009993082.1|  PREDICTED: poly [ADP-ribose] polymerase 1        85.5    2e-15   
gb|AAX27650.2|  SJCHGC03951 protein                                   80.5    3e-15   
ref|XP_011334668.1|  PREDICTED: poly [ADP-ribose] polymerase          85.1    3e-15   
ref|XP_001604917.1|  PREDICTED: poly [ADP-ribose] polymerase-like...  85.1    3e-15   
ref|XP_004926518.1|  PREDICTED: poly [ADP-ribose] polymerase          85.1    3e-15   
emb|CBY33906.1|  unnamed protein product                              82.8    3e-15   
gb|AAM93435.1|  PARP-E protein                                        84.3    3e-15   
ref|XP_004862328.1|  PREDICTED: poly [ADP-ribose] polymerase 1        84.7    4e-15   
ref|XP_004889988.1|  PREDICTED: poly [ADP-ribose] polymerase 1        84.7    4e-15   
ref|XP_010300324.1|  PREDICTED: poly [ADP-ribose] polymerase 1        84.7    4e-15   
ref|XP_011063718.1|  PREDICTED: poly [ADP-ribose] polymerase isof...  84.7    4e-15   
gb|EFB29647.1|  hypothetical protein PANDA_016433                     84.7    4e-15   
ref|XP_011063716.1|  PREDICTED: poly [ADP-ribose] polymerase isof...  84.7    4e-15   
ref|XP_007077016.1|  PREDICTED: poly [ADP-ribose] polymerase 1        84.7    5e-15   
ref|XP_010589425.1|  PREDICTED: poly [ADP-ribose] polymerase 1        84.3    5e-15   
ref|XP_002787829.1|  conserved hypothetical protein                   84.3    5e-15   
ref|XP_009947568.1|  PREDICTED: poly [ADP-ribose] polymerase 1        84.0    5e-15   
ref|XP_009910585.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  84.3    6e-15   
gb|EHB06347.1|  Poly [ADP-ribose] polymerase 1                        84.3    6e-15   
ref|XP_004472547.1|  PREDICTED: poly [ADP-ribose] polymerase 1        84.3    6e-15   
gb|KFB53218.1|  AGAP003230-PA-like protein                            84.3    6e-15   
ref|NP_001104452.1|  Poly-(ADP-ribose) polymerase                     84.0    6e-15   
ref|XP_004761979.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  84.0    7e-15   
ref|XP_004761978.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  84.0    8e-15   
ref|XP_004761977.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  84.0    8e-15   
ref|XP_008499362.1|  PREDICTED: poly [ADP-ribose] polymerase 1        83.2    1e-14   
ref|XP_002409668.1|  poly [ADP-ribose] polymerase, putative           83.2    1e-14   
ref|XP_008695580.1|  PREDICTED: poly [ADP-ribose] polymerase 1        83.2    1e-14   
emb|CBY18306.1|  unnamed protein product                              82.8    2e-14   
emb|CDS27075.1|  poly (ADP ribose) polymerase 1                       82.8    2e-14   
ref|XP_002809428.2|  PREDICTED: poly [ADP-ribose] polymerase 1        82.4    2e-14   
ref|XP_006118141.1|  PREDICTED: poly [ADP-ribose] polymerase 1        82.4    3e-14   
ref|XP_004914971.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   76.3    3e-14   
ref|XP_011232467.1|  PREDICTED: poly [ADP-ribose] polymerase 1        81.6    4e-14   
ref|XP_008579018.1|  PREDICTED: poly [ADP-ribose] polymerase 1        81.6    5e-14   
ref|XP_008203357.1|  PREDICTED: poly [ADP-ribose] polymerase-like...  80.9    6e-14   
dbj|GAA38154.2|  poly [ADP-ribose] polymerase                         80.9    8e-14   
ref|XP_547506.3|  PREDICTED: poly [ADP-ribose] polymerase 1 isofo...  80.9    8e-14   
emb|CDI99328.1|  poly (ADP ribose) polymerase 1                       80.5    9e-14   
ref|XP_004994319.1|  hypothetical protein PTSG_05004                  80.5    1e-13   
emb|CDS24039.1|  poly ADP ribose polymerase 1                         79.3    2e-13   
gb|KFD59055.1|  hypothetical protein M513_00218                       79.3    2e-13   
gb|EUB58343.1|  Poly [ADP-ribose] polymerase 1                        79.3    2e-13   
ref|XP_004690817.1|  PREDICTED: poly [ADP-ribose] polymerase 1        78.2    5e-13   
ref|XP_004356596.1|  Poly(ADPribose) polymerase catalytic domain ...  78.2    5e-13   
ref|XP_007670669.1|  PREDICTED: poly [ADP-ribose] polymerase 1        78.2    5e-13   
gb|ERL88195.1|  hypothetical protein D910_05583                       77.0    8e-13   
gb|ENN70931.1|  hypothetical protein YQE_12333                        76.3    1e-12   
pdb|2DMJ|A  Chain A, Solution Structure Of The First Zf-Parp Doma...  71.2    2e-12   
ref|XP_002090141.1|  GE20224                                          76.6    2e-12   
ref|XP_006107395.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   75.9    3e-12   
gb|KHJ86523.1|  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-fin...  74.7    3e-12   
ref|XP_008159430.1|  PREDICTED: poly [ADP-ribose] polymerase 1        75.5    4e-12   
gb|ELK36014.1|  Poly [ADP-ribose] polymerase 1                        75.5    4e-12   
ref|XP_006756108.1|  PREDICTED: poly [ADP-ribose] polymerase 1        75.1    5e-12   
gb|EYC34493.1|  hypothetical protein Y032_0001g441                    74.7    5e-12   
ref|XP_004439616.1|  PREDICTED: poly [ADP-ribose] polymerase 1        75.1    6e-12   
gb|KIH45893.1|  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-fin...  71.6    7e-12   
ref|XP_010972367.1|  PREDICTED: poly [ADP-ribose] polymerase 1        74.7    8e-12   
ref|XP_005880205.1|  PREDICTED: poly [ADP-ribose] polymerase 1        74.3    8e-12   
ref|XP_001491507.4|  PREDICTED: poly [ADP-ribose] polymerase 1 is...  74.3    9e-12   
gb|EPQ16369.1|  Poly [ADP-ribose] polymerase 1                        74.3    9e-12   
gb|KIH55409.1|  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-fin...  71.2    9e-12   
emb|CAA39606.1|  NAD(+) ADP-ribosyltransferase                        68.9    9e-12   
gb|ETN76058.1|  Poly(ADP-ribose) polymerase catalytic domain protein  73.9    1e-11   
ref|XP_008508869.1|  PREDICTED: poly [ADP-ribose] polymerase 1        73.2    2e-11   
pdb|3ODA|A  Chain A, Human Parp-1 Zinc Finger 1 (Zn1) Bound To Dna    68.9    2e-11   
pdb|2L30|A  Chain A, Human Parp-1 Zinc Finger 1                       68.6    2e-11   
ref|XP_003770730.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   73.6    2e-11   
dbj|BAK01891.1|  predicted protein                                    72.4    2e-11   
gb|KGB42320.1|  Poly [ADP-ribose] polymerase 1                        68.9    3e-11   
ref|XP_010552123.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  72.0    3e-11   
emb|CDM81761.1|  unnamed protein product                              72.0    4e-11   
pdb|4OPX|A  Chain A, Structure Of Human Parp-1 Bound To A Dna Dou...  69.3    6e-11   
gb|ADM32529.1|  parp                                                  71.2    9e-11   
gb|KFP29737.1|  Poly [ADP-ribose] polymerase 1                        65.9    1e-10   
gb|KFO82658.1|  Poly [ADP-ribose] polymerase 1                        65.9    1e-10   
ref|XP_010552121.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  70.1    1e-10   
ref|XP_010552122.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  70.1    2e-10   
gb|KFO56709.1|  Poly [ADP-ribose] polymerase 1                        64.7    3e-10   
gb|KFM11781.1|  Poly [ADP-ribose] polymerase 1                        64.7    3e-10   
gb|KFR12924.1|  Poly [ADP-ribose] polymerase 1                        64.7    3e-10   
gb|KFW77046.1|  Poly [ADP-ribose] polymerase 1                        64.7    3e-10   
gb|KFZ49576.1|  Poly [ADP-ribose] polymerase 1                        64.3    4e-10   
gb|KFV74157.1|  Poly [ADP-ribose] polymerase 1                        64.3    4e-10   
ref|WP_043550305.1|  hypothetical protein                             63.9    5e-10   
pdb|3OD8|A  Chain A, Human Parp-1 Zinc Finger 1 (Zn1) Bound To Dna    64.7    5e-10   
gb|KFP39293.1|  Poly [ADP-ribose] polymerase 1                        63.9    5e-10   
emb|CCD60678.1|  poly [ADP-ribose] polymerase, putative               68.6    6e-10   
gb|KFR05539.1|  Poly [ADP-ribose] polymerase 1                        63.5    6e-10   
ref|NP_491072.1|  Protein PME-1                                       68.6    6e-10   
gb|KFV02364.1|  Poly [ADP-ribose] polymerase 1                        63.5    7e-10   
gb|KFV67922.1|  Poly [ADP-ribose] polymerase 1                        63.5    7e-10   
gb|KFP91528.1|  Poly [ADP-ribose] polymerase 1                        63.5    7e-10   
gb|KFQ45982.1|  Poly [ADP-ribose] polymerase 1                        63.5    8e-10   
gb|KGL85418.1|  Poly [ADP-ribose] polymerase 1                        63.5    8e-10   
gb|EYC34496.1|  hypothetical protein Y032_0001g442                    68.2    8e-10   
gb|KFO89528.1|  Poly [ADP-ribose] polymerase 1                        63.2    9e-10   
gb|EYC34495.1|  hypothetical protein Y032_0001g442                    68.2    1e-09   
gb|EMT06202.1|  Bifunctional polynucleotide phosphatase/kinase        67.4    1e-09   
gb|KFV56919.1|  Poly [ADP-ribose] polymerase 1                        62.8    1e-09   
gb|KFO10691.1|  Poly [ADP-ribose] polymerase 1                        62.4    2e-09   
gb|AAM27195.1|AF499444_1  poly ADP-ribose metabolism enzyme-1         67.0    2e-09   
gb|KFU87484.1|  Poly [ADP-ribose] polymerase 1                        62.4    2e-09   
gb|KFQ27064.1|  Poly [ADP-ribose] polymerase 1                        61.6    4e-09   
gb|KFP06513.1|  Poly [ADP-ribose] polymerase 1                        61.2    4e-09   
gb|KFP98954.1|  Poly [ADP-ribose] polymerase 1                        61.2    5e-09   
gb|KFP52795.1|  Poly [ADP-ribose] polymerase 1                        61.2    5e-09   
ref|XP_011359180.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...  65.9    5e-09   
gb|KFP97914.1|  Poly [ADP-ribose] polymerase 1                        61.2    5e-09   
dbj|BAD87018.1|  putative phosphoesterase                             65.1    6e-09   
ref|XP_006644672.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  64.7    8e-09   
ref|XP_010232277.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  64.7    8e-09   
ref|XP_010232276.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  64.3    1e-08   
ref|XP_003385071.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   64.3    2e-08   
gb|ERG87001.1|  poly(adp-ribose) polymerase pme-1                     63.9    2e-08   
gb|EEE55350.1|  hypothetical protein OsJ_03379                        63.5    2e-08   
ref|XP_002459754.1|  hypothetical protein SORBIDRAFT_02g009895        58.5    2e-08   
ref|XP_004969876.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  63.2    3e-08   
ref|XP_008471547.1|  PREDICTED: poly [ADP-ribose] polymerase-like     63.2    3e-08   
emb|CDJ89547.1|  Zinc finger and PADR1 and WGR and Poly(ADP-ribos...  62.8    4e-08   
gb|KIP11907.1|  hypothetical protein PHLGIDRAFT_10425                 62.4    4e-08   
ref|XP_002456319.1|  hypothetical protein SORBIDRAFT_03g033940        62.0    6e-08   
ref|XP_004969877.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  62.0    6e-08   
emb|CDJ80849.1|  Zinc finger and PADR1 and WGR and Poly(ADP-ribos...  62.0    8e-08   
gb|KFK38839.1|  hypothetical protein AALP_AA3G167000                  61.6    9e-08   
ref|XP_008547744.1|  PREDICTED: poly [ADP-ribose] polymerase-like     61.6    1e-07   
gb|EGT58624.1|  hypothetical protein CAEBREN_29358                    61.6    1e-07   
ref|XP_007394348.1|  hypothetical protein PHACADRAFT_253668           60.8    2e-07   
ref|XP_004341800.1|  Poly(ADPribose) polymerase catalytic domain ...  61.2    2e-07   
ref|XP_011445219.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   60.1    2e-07   
ref|XP_011420788.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   60.1    2e-07   
ref|XP_002786786.1|  conserved hypothetical protein                   60.5    3e-07   
ref|XP_001177436.2|  PREDICTED: poly [ADP-ribose] polymerase 1-like   60.1    3e-07   
ref|XP_003381097.1|  poly [ADP-ribose] polymerase                     59.7    4e-07   
ref|XP_006407034.1|  hypothetical protein EUTSA_v10020510mg           59.3    5e-07   
emb|CCM01220.1|  predicted protein                                    59.3    5e-07   
gb|AES75614.2|  poly [ADP-ribose] polymerase                          55.8    5e-07   
gb|EMS49909.1|  Bifunctional polynucleotide phosphatase/kinase        58.9    6e-07   
emb|CDX82459.1|  BnaA03g33620D                                        58.9    7e-07   
ref|XP_009135410.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  58.9    7e-07   
ref|XP_009135411.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  58.5    1e-06   
emb|CDX98512.1|  BnaC05g38630D                                        58.5    1e-06   
ref|XP_008559442.1|  PREDICTED: poly [ADP-ribose] polymerase          57.8    2e-06   
gb|EMP24541.1|  Poly [ADP-ribose] polymerase 1                        57.8    2e-06   
gb|KHN85776.1|  Poly(ADP-ribose) polymerase pme-1                     57.4    2e-06   
gb|EGT41901.1|  hypothetical protein CAEBREN_31931                    57.4    3e-06   
ref|XP_003619396.1|  Poly                                             56.6    3e-06   
ref|XP_010233506.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  56.2    3e-06   
ref|XP_006297122.1|  hypothetical protein CARUB_v10013122mg           56.2    7e-06   
ref|XP_002882900.1|  predicted protein                                56.2    7e-06   
ref|XP_003096615.1|  hypothetical protein CRE_01248                   55.5    1e-05   
ref|XP_002639584.1|  C. briggsae CBR-PME-1 protein                    55.5    1e-05   
gb|KEH26631.1|  polynucleotide phosphatase/kinase                     55.1    1e-05   
gb|ABR18091.1|  unknown                                               55.1    1e-05   
ref|XP_010502295.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  55.5    1e-05   
ref|XP_011165141.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like   55.1    1e-05   
gb|KEH26632.1|  polynucleotide phosphatase/kinase                     55.1    1e-05   
ref|XP_002108332.1|  hypothetical protein TRIADDRAFT_52697            55.1    1e-05   
ref|XP_010502287.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  55.1    2e-05   
ref|XP_010502281.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  55.1    2e-05   
ref|XP_003636733.1|  Poly                                             54.7    2e-05   
ref|XP_008673411.1|  PREDICTED: diphosphonucleotide phosphatase2 ...  54.7    2e-05   
ref|XP_010502272.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  54.7    2e-05   
ref|XP_005851958.1|  hypothetical protein CHLNCDRAFT_133639           52.8    2e-05   
ref|XP_009146312.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  54.7    2e-05   
gb|ACG46104.1|  phosphoesterase                                       54.3    2e-05   
emb|CBJ31735.1|  DNA repair protein                                   54.3    2e-05   
gb|EYU45026.1|  hypothetical protein MIMGU_mgv1a007930mg              53.9    3e-05   
ref|XP_002109056.1|  hypothetical protein TRIADDRAFT_52698            54.3    3e-05   
ref|XP_009146311.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  53.5    5e-05   
gb|KIH53077.1|  PADR1 domain protein                                  53.1    6e-05   
ref|XP_009146310.1|  PREDICTED: polynucleotide 3'-phosphatase ZDP...  53.1    7e-05   
gb|KDR08085.1|  Poly [ADP-ribose] polymerase                          49.3    7e-05   



>ref|XP_009781599.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Nicotiana 
sylvestris]
Length=994

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 169/207 (82%), Gaps = 4/207 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRSSCKTCK+PIDKE  RLGKMVQATQFDG MPMW+H  CIL+KA
Sbjct  1    MANPPKPWKAEYAKSSRSSCKTCKNPIDKEVFRLGKMVQATQFDGFMPMWHHASCILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ +DVEG++ LRWEDQ+KIR+Y EGGG GSS+ P PA ME G+E SQTSRA+C+HC
Sbjct  61   KQIKSLEDVEGVDQLRWEDQQKIREYAEGGGSGSSNIPAPAAMECGIEVSQTSRASCRHC  120

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N+KI+KGEVR+SSK +GQ A+SLAWHHAKCF E S  TQV+KL GWDSL A+DQAVV SL
Sbjct  121  NQKIVKGEVRLSSKPEGQRAKSLAWHHAKCFSEISSTTQVEKLSGWDSLSAADQAVVLSL  180

Query  606  VKNSTVKVAKEEP----LXESTSTAGA  674
             K+ +    K EP      ESTS AGA
Sbjct  181  FKSYSSTGNKTEPKEELTQESTSKAGA  207



>ref|XP_009781597.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Nicotiana 
sylvestris]
Length=995

 Score =   277 bits (709),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRSSCKTCK+PIDKE  RLGKMVQATQFDG MPMW+H  CIL+KA
Sbjct  1    MANPPKPWKAEYAKSSRSSCKTCKNPIDKEVFRLGKMVQATQFDGFMPMWHHASCILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ +DVEG++ LRWEDQ+KIR+Y EGGG GSS+ P PA ME G+E SQTSRA+C+HC
Sbjct  61   KQIKSLEDVEGVDQLRWEDQQKIREYAEGGGSGSSNIPAPAAMECGIEVSQTSRASCRHC  120

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N+KI+KGEVR+SSK +GQ A+SLAWHHAKCF E S  TQV+KL GWDSL A+DQAVV SL
Sbjct  121  NQKIVKGEVRLSSKPEGQRAKSLAWHHAKCFSEISSTTQVEKLSGWDSLSAADQAVVLSL  180

Query  606  VKN-----STVKVAKEEPLXESTSTAGA  674
             K+     S     KEE   ESTS AGA
Sbjct  181  FKSYSSTGSNKTEPKEELTQESTSKAGA  208



>ref|XP_009617761.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=994

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 169/207 (82%), Gaps = 4/207 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRSSCKTCK+PIDKE  RLGKMVQATQFDG MPMW+H  CIL+KA
Sbjct  1    MANPPKPWKAEYAKSSRSSCKTCKNPIDKEIFRLGKMVQATQFDGFMPMWHHASCILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ +DVEG++ LRWEDQ+KIR+YVEGGG GSS+ P PA ME G+E SQTSRA+C+HC
Sbjct  61   KQIKSLEDVEGVDQLRWEDQQKIREYVEGGGSGSSNIPAPAAMECGIEVSQTSRASCRHC  120

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N+KI+KGEVR+SSK +GQ A+SLAWHHAKCF E S  TQV+KL GWDSL A+ Q VV SL
Sbjct  121  NQKIVKGEVRLSSKPEGQRAKSLAWHHAKCFSEISSTTQVEKLSGWDSLSAAYQTVVLSL  180

Query  606  VKNSTVKVAKEEP----LXESTSTAGA  674
             K+S+    K EP      ESTS AGA
Sbjct  181  FKSSSSTGNKTEPKEELAQESTSKAGA  207



>emb|CDP03723.1| unnamed protein product [Coffea canephora]
Length=986

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 164/203 (81%), Gaps = 2/203 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASP K WKAEYAKSSRSSCKTC+ PIDKE LRLGKMVQATQFDG MP+WNH  CILKK+
Sbjct  1    MASPPKAWKAEYAKSSRSSCKTCRMPIDKEKLRLGKMVQATQFDGFMPLWNHADCILKKS  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQI + DDVEGLE LRWEDQ++IRKYV+GGG   S+A T AV+E GVE SQTSRA+C++C
Sbjct  61   KQINSIDDVEGLELLRWEDQQRIRKYVDGGG--PSNASTAAVIERGVEVSQTSRASCRNC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             +KIMKGEVRIS+K  GQG R+LAWHHA CFME SP TQV+ L GWD+L +S +A + +L
Sbjct  119  GQKIMKGEVRISTKPDGQGPRALAWHHASCFMEMSPTTQVEGLSGWDTLSSSHRATLLAL  178

Query  606  VKNSTVKVAKEEPLXESTSTAGA  674
             K ++     +EPL +STS AGA
Sbjct  179  DKKASSNAKDKEPLLDSTSKAGA  201



>ref|XP_011080022.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sesamum indicum]
Length=995

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 165/211 (78%), Gaps = 10/211 (5%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASP KPWKAEYAKSSRSSCKTCK+PI+KE LRLGKMVQA+QFDG MPMWNH  CIL+KA
Sbjct  1    MASPPKPWKAEYAKSSRSSCKTCKNPIEKENLRLGKMVQASQFDGFMPMWNHAACILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEGLE LRWEDQ+KIRKY++G    +S A  PAV+E G+E SQTSRATC+ C
Sbjct  61   NQIKSVDDVEGLELLRWEDQQKIRKYIDGAVMSNSSA--PAVVECGIEVSQTSRATCRCC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N KI+KGE+RIS+K +GQG R L+W+HAKC+MEKSP +QV+K  GW+SL ASD A + SL
Sbjct  119  NLKIVKGEIRISTKPEGQGPRGLSWNHAKCYMEKSPTSQVEKFSGWESLSASDHAAIISL  178

Query  606  VKNST-----VKVAKEEP---LXESTSTAGA  674
            VK +       KV  EE    L ESTS  GA
Sbjct  179  VKKNPSTSKGTKVGHEEEREVLQESTSKGGA  209



>gb|KJB42240.1| hypothetical protein B456_007G144300 [Gossypium raimondii]
Length=992

 Score =   254 bits (650),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 163/210 (78%), Gaps = 8/210 (4%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS+RSSCKTCKS I+KE  RLGKMV ATQFDG MPMWNH  CIL+KA
Sbjct  1    MANPPKPWKAEYAKSARSSCKTCKSVINKEVFRLGKMVPATQFDGFMPMWNHADCILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+TDDVEG+ESLRWEDQ+KIR YVE GG  ++   TP  MEY +E S  SRATCK C
Sbjct  61   NQIKSTDDVEGIESLRWEDQQKIRNYVESGGPSNAKTVTPQAMEYAIEVSLASRATCKGC  120

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            ++KIMKGEVRISSK KGQG++ L W+HAKCF++ SP T+V+KL GW+ +P+SDQA +S+L
Sbjct  121  SQKIMKGEVRISSKPKGQGSKGLVWNHAKCFLDLSPTTEVEKLPGWEHIPSSDQASISAL  180

Query  606  VKNST-------VKVAKEEPLXESTSTAGA  674
            VK            V KE+   +STSTAGA
Sbjct  181  VKKVLAAKTGKGTDVPKEQQ-PQSTSTAGA  209



>gb|KJB42241.1| hypothetical protein B456_007G144300 [Gossypium raimondii]
Length=946

 Score =   254 bits (649),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 163/210 (78%), Gaps = 8/210 (4%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS+RSSCKTCKS I+KE  RLGKMV ATQFDG MPMWNH  CIL+KA
Sbjct  1    MANPPKPWKAEYAKSARSSCKTCKSVINKEVFRLGKMVPATQFDGFMPMWNHADCILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+TDDVEG+ESLRWEDQ+KIR YVE GG  ++   TP  MEY +E S  SRATCK C
Sbjct  61   NQIKSTDDVEGIESLRWEDQQKIRNYVESGGPSNAKTVTPQAMEYAIEVSLASRATCKGC  120

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            ++KIMKGEVRISSK KGQG++ L W+HAKCF++ SP T+V+KL GW+ +P+SDQA +S+L
Sbjct  121  SQKIMKGEVRISSKPKGQGSKGLVWNHAKCFLDLSPTTEVEKLPGWEHIPSSDQASISAL  180

Query  606  VKNST-------VKVAKEEPLXESTSTAGA  674
            VK            V KE+   +STSTAGA
Sbjct  181  VKKVLAAKTGKGTDVPKEQQ-PQSTSTAGA  209



>ref|XP_007050349.1| Poly(ADP-ribose) polymerase 2 isoform 3, partial [Theobroma cacao]
 gb|EOX94506.1| Poly(ADP-ribose) polymerase 2 isoform 3, partial [Theobroma cacao]
Length=820

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 159/209 (76%), Gaps = 7/209 (3%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCKTCK+ IDKE  RLGKMV ATQFDG MPMWNH  C+LKKA
Sbjct  1    MANPPKPWKAEYAKSGRSSCKTCKNTIDKEVFRLGKMVPATQFDGFMPMWNHANCVLKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG+ESLRWEDQ+++R YVE GG  ++ A T   MEY +E SQTSRATCKHC
Sbjct  61   NQIKSIDDVEGIESLRWEDQQRVRNYVEDGGPANTKAVTLTAMEYAIEVSQTSRATCKHC  120

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             +KIMK EVRIS+K KGQG++ L W+HA CFME SP TQV+K  GW+SL +SDQA V +L
Sbjct  121  GQKIMKEEVRISTKPKGQGSKGLVWNHAICFMELSPATQVEKFPGWESLSSSDQATVRAL  180

Query  606  VKN--STVKVAK-----EEPLXESTSTAG  671
            VK   S+ K  K     E+   +STS AG
Sbjct  181  VKKVPSSAKNDKGTEVPEDKQLQSTSRAG  209



>ref|XP_006341445.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Solanum tuberosum]
Length=991

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 165/207 (80%), Gaps = 6/207 (3%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRS+CKTCKS IDKE  R+GKMVQ+T FDG+MPMW+H  CIL+KA
Sbjct  1    MANPPKPWKAEYAKSSRSACKTCKSIIDKEVFRIGKMVQSTHFDGLMPMWHHANCILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ +DVEG++ LRWEDQ+KIR+YV+ GG  SS+ PTPA +E G+E S  SRA+C+HC
Sbjct  61   KQIKSLEDVEGVDQLRWEDQQKIREYVQVGG--SSNIPTPAAVECGIEVSPASRASCRHC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N+KI+KGEVRISSK +GQ A+SLAWHHAKCF E S   QV+KL  WDSL A+DQA V SL
Sbjct  119  NQKIVKGEVRISSKPEGQRAKSLAWHHAKCFSEISSTIQVEKLSNWDSLSAADQAAVLSL  178

Query  606  VKNSTVKVAKEEP----LXESTSTAGA  674
             K+ST+   K +P      ESTS AGA
Sbjct  179  FKSSTLTGNKTDPKEELAQESTSKAGA  205



>ref|XP_007050347.1| Poly(ADP-ribose) polymerase 2 isoform 1 [Theobroma cacao]
 gb|EOX94504.1| Poly(ADP-ribose) polymerase 2 isoform 1 [Theobroma cacao]
Length=976

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 159/209 (76%), Gaps = 7/209 (3%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCKTCK+ IDKE  RLGKMV ATQFDG MPMWNH  C+LKKA
Sbjct  1    MANPPKPWKAEYAKSGRSSCKTCKNTIDKEVFRLGKMVPATQFDGFMPMWNHANCVLKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG+ESLRWEDQ+++R YVE GG  ++ A T   MEY +E SQTSRATCKHC
Sbjct  61   NQIKSIDDVEGIESLRWEDQQRVRNYVEDGGPANTKAVTLTAMEYAIEVSQTSRATCKHC  120

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             +KIMK EVRIS+K KGQG++ L W+HA CFME SP TQV+K  GW+SL +SDQA V +L
Sbjct  121  GQKIMKEEVRISTKPKGQGSKGLVWNHAICFMELSPATQVEKFPGWESLSSSDQATVRAL  180

Query  606  VKN--STVKVAK-----EEPLXESTSTAG  671
            VK   S+ K  K     E+   +STS AG
Sbjct  181  VKKVPSSAKNDKGTEVPEDKQLQSTSRAG  209



>ref|XP_007050348.1| Poly(ADP-ribose) polymerase 2 isoform 2 [Theobroma cacao]
 gb|EOX94505.1| Poly(ADP-ribose) polymerase 2 isoform 2 [Theobroma cacao]
Length=991

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 159/209 (76%), Gaps = 7/209 (3%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCKTCK+ IDKE  RLGKMV ATQFDG MPMWNH  C+LKKA
Sbjct  1    MANPPKPWKAEYAKSGRSSCKTCKNTIDKEVFRLGKMVPATQFDGFMPMWNHANCVLKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG+ESLRWEDQ+++R YVE GG  ++ A T   MEY +E SQTSRATCKHC
Sbjct  61   NQIKSIDDVEGIESLRWEDQQRVRNYVEDGGPANTKAVTLTAMEYAIEVSQTSRATCKHC  120

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             +KIMK EVRIS+K KGQG++ L W+HA CFME SP TQV+K  GW+SL +SDQA V +L
Sbjct  121  GQKIMKEEVRISTKPKGQGSKGLVWNHAICFMELSPATQVEKFPGWESLSSSDQATVRAL  180

Query  606  VKN--STVKVAK-----EEPLXESTSTAG  671
            VK   S+ K  K     E+   +STS AG
Sbjct  181  VKKVPSSAKNDKGTEVPEDKQLQSTSRAG  209



>ref|XP_010318682.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Solanum 
lycopersicum]
Length=998

 Score =   252 bits (643),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 6/207 (3%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRS+CKTCKS IDKE  R+GKMVQ+T FDG+MPMW+H  CIL+KA
Sbjct  1    MANPPKPWKAEYAKSSRSACKTCKSIIDKEVFRIGKMVQSTHFDGLMPMWHHANCILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ +DVEG++ LRWEDQ+KIR+YV+ GG  SS+ P PA +E G+E S  SRA+C+HC
Sbjct  61   KQIKSLEDVEGVDQLRWEDQQKIREYVQTGG--SSNIPPPAAVECGIEVSPASRASCRHC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N+KI+KGEVRISSK +GQ A+SLAWHHAKCF E S  TQV+ L  WDSL A+DQA V SL
Sbjct  119  NQKIVKGEVRISSKPEGQRAKSLAWHHAKCFSEISSTTQVENLSNWDSLSAADQAAVLSL  178

Query  606  VKNSTVKVAKEEP----LXESTSTAGA  674
             K+ST+   K +P      ESTS AGA
Sbjct  179  FKSSTLTGNKTDPKEELAQESTSKAGA  205



>ref|XP_004235864.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Solanum 
lycopersicum]
Length=992

 Score =   252 bits (643),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 6/207 (3%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRS+CKTCKS IDKE  R+GKMVQ+T FDG+MPMW+H  CIL+KA
Sbjct  1    MANPPKPWKAEYAKSSRSACKTCKSIIDKEVFRIGKMVQSTHFDGLMPMWHHANCILRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ +DVEG++ LRWEDQ+KIR+YV+ GG  SS+ P PA +E G+E S  SRA+C+HC
Sbjct  61   KQIKSLEDVEGVDQLRWEDQQKIREYVQTGG--SSNIPPPAAVECGIEVSPASRASCRHC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N+KI+KGEVRISSK +GQ A+SLAWHHAKCF E S  TQV+ L  WDSL A+DQA V SL
Sbjct  119  NQKIVKGEVRISSKPEGQRAKSLAWHHAKCFSEISSTTQVENLSNWDSLSAADQAAVLSL  178

Query  606  VKNSTVKVAKEEP----LXESTSTAGA  674
             K+ST+   K +P      ESTS AGA
Sbjct  179  FKSSTLTGNKTDPKEELAQESTSKAGA  205



>ref|XP_004151977.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cucumis sativus]
 ref|XP_004160262.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cucumis sativus]
 gb|KGN57935.1| hypothetical protein Csa_3G398930 [Cucumis sativus]
Length=980

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA P KPWK EYAKSSRSSCKTCKSPI KE LR GKMVQATQFDG MPMWNH  CILKKA
Sbjct  1    MAEPQKPWKVEYAKSSRSSCKTCKSPIQKENLRFGKMVQATQFDGFMPMWNHAACILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ DDVEGL+SLRWEDQ KIR+YVE     ++   TP  +EYG+E SQTSRA+CKHC
Sbjct  61   KQIKSIDDVEGLDSLRWEDQLKIRQYVEDSVAAAAVVVTP--IEYGIEVSQTSRASCKHC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             +KIMKGEVR+S+   G+G + LAW+HA C+ME+ P  QV+KL GW +LP SDQA +S+L
Sbjct  119  KQKIMKGEVRLSTVLDGKGTKGLAWYHANCYMEQCPSAQVEKLAGWQNLPPSDQAAISTL  178

Query  606  VKNSTVKVAKEEPLXESTSTAG  671
            VK  +  V  EE   ++TS AG
Sbjct  179  VKKPSSAVKNEE--KQTTSKAG  198



>ref|XP_002521021.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
 gb|EEF41438.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
Length=982

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 160/207 (77%), Gaps = 5/207 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCKTCK PIDKE LRLGKMVQATQFDG MPMWNH  C+LKKA
Sbjct  1    MAAPPKPWKAEYAKSGRSSCKTCKKPIDKEKLRLGKMVQATQFDGFMPMWNHESCVLKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPA--VMEYGVETSQTSRATCK  419
            KQIK+ DDVEG++SLRWEDQ+KIRK VEGGG  + DA   A  VMEYG+E SQTSRATC+
Sbjct  61   KQIKSIDDVEGIDSLRWEDQQKIRKCVEGGGIATQDANANALNVMEYGIEVSQTSRATCR  120

Query  420  HCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVS  599
             C++KI+KG+VRISSK     A++LAWHHA CF++  P  QV+K+ GW+SLP SDQ  V 
Sbjct  121  RCSQKILKGQVRISSKPDEPRAKALAWHHADCFIDLHPSVQVEKMSGWESLPPSDQEAVR  180

Query  600  SLVKN--STVKVAKEEPLXESTSTAGA  674
            +L+K   ST K    E   +STS  GA
Sbjct  181  ALIKEVPSTAKAGIVEE-RKSTSAVGA  206



>ref|XP_008461878.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cucumis 
melo]
 ref|XP_008461879.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cucumis 
melo]
Length=980

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 156/201 (78%), Gaps = 4/201 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA P KPWK EYAKSSRSSCKTCKSPI KE LR GKMVQATQFDG MPMWNH  CILKKA
Sbjct  1    MAEPQKPWKVEYAKSSRSSCKTCKSPIQKENLRFGKMVQATQFDGFMPMWNHAACILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ DDVEGL+SLRWEDQ+KIR+YV+     ++   TP  +EYG+E SQT+RA+CKHC
Sbjct  61   KQIKSIDDVEGLDSLRWEDQQKIRQYVQDSAAAAAVVVTP--VEYGIEVSQTARASCKHC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             +KIMKGEVR+S+   G+G + LAW+HA C+ME+ P TQV+KL GW SLP SDQA VS L
Sbjct  119  KQKIMKGEVRLSTALDGKGTKGLAWYHANCYMEQCPSTQVEKLAGWQSLPPSDQAAVSIL  178

Query  606  VKNSTVKVAKEEPLXESTSTA  668
            VK  +  V  EE   ++TS A
Sbjct  179  VKKPSSAVKNEE--KQTTSKA  197



>ref|XP_009367709.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Pyrus x bretschneideri]
Length=234

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 8/183 (4%)
 Frame = +3

Query  78   HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIK  257
             KPWK EYAKSSRSSCKTCKSPI+KETLRLGKMVQATQFDGVMPMWNH  CI+KK+ QIK
Sbjct  7    QKPWKVEYAKSSRSSCKTCKSPIEKETLRLGKMVQATQFDGVMPMWNHADCIMKKSNQIK  66

Query  258  ATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEY-----GVETSQTSRATCKH  422
            +TD+VEGLE +RWEDQ+K+R YV+ GG   +   +PA  E+     G+E S TSRATCK 
Sbjct  67   STDEVEGLELIRWEDQQKVRSYVQSGGPPDT---SPATSEFTTKECGIEVSPTSRATCKQ  123

Query  423  CNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSS  602
            C++KI+K EVRIS+K +GQG RSLAW+HA CFME SP  +V+KL GW++LP SDQ  V +
Sbjct  124  CSQKILKTEVRISTKPEGQGPRSLAWNHANCFMELSPSIEVEKLPGWETLPVSDQEAVRA  183

Query  603  LVK  611
            LVK
Sbjct  184  LVK  186



>gb|KDP21330.1| hypothetical protein JCGZ_21801 [Jatropha curcas]
Length=982

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 159/210 (76%), Gaps = 9/210 (4%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS+RSSCKTCK PIDKE LRLGKMVQATQFDG MPMWNH  CILKKA
Sbjct  1    MATPPKPWKAEYAKSARSSCKTCKKPIDKENLRLGKMVQATQFDGFMPMWNHASCILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ +DVEG+ESLRWEDQ+ IRKYVE G   SS+A     MEYG+E SQTSRATCK C
Sbjct  61   NQIKSINDVEGIESLRWEDQQNIRKYVEAG--VSSNAKAVTAMEYGIEVSQTSRATCKLC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            ++KIMKG+VRISSK     A+ LAWHHAKCFM+ +P   V+KL GW+SLP SDQ  V +L
Sbjct  119  SQKIMKGQVRISSKPDEPRAKGLAWHHAKCFMDLNPSILVEKLSGWESLPPSDQTTVHAL  178

Query  606  -------VKNSTVKVAKEEPLXESTSTAGA  674
                   VK+  +   +++ L +STS  GA
Sbjct  179  AKEVPSAVKSGIIDGREDKELQQSTSRVGA  208



>ref|XP_010274828.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nelumbo nucifera]
Length=987

 Score =   249 bits (635),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 157/209 (75%), Gaps = 8/209 (4%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWK EYAKSSRSSCKTCK+ IDKE LRLGKMVQATQFDG MPMWNH  CILKKA
Sbjct  1    MANPPKPWKVEYAKSSRSSCKTCKNNIDKEKLRLGKMVQATQFDGFMPMWNHASCILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEGL+ LRWEDQ+KI+KYVE G   SS++   AV + G+E SQTSRATCK C
Sbjct  61   NQIKSLDDVEGLDLLRWEDQQKIKKYVESG--PSSNSTAVAVNDCGIEVSQTSRATCKRC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            NEKI+KGEVRIS+K  GQG + LAWHHA CF+E SP TQV+KL GWDSL A DQ  + +L
Sbjct  119  NEKIIKGEVRISTKPDGQGTKGLAWHHANCFVELSPSTQVEKLSGWDSLSAQDQKAIRAL  178

Query  606  VKNSTVKV------AKEEPLXESTSTAGA  674
             K  T           ++ L +STST G 
Sbjct  179  TKKGTSTARNVDTQENKDLLQQSTSTTGT  207



>ref|XP_008461880.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Cucumis 
melo]
Length=979

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 156/201 (78%), Gaps = 5/201 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA P KPWK EYAKSSRSSCKTCKSPI KE LR GKMVQATQFDG MPMWNH  CILKKA
Sbjct  1    MAEPQKPWKVEYAKSSRSSCKTCKSPIQKENLRFGKMVQATQFDGFMPMWNHAACILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ DDVEGL+SLRWEDQ+KIR+YV+     ++   TP  +EYG+E SQT+RA+CKHC
Sbjct  61   KQIKSIDDVEGLDSLRWEDQQKIRQYVQDSAAAAAVVVTP--VEYGIEVSQTARASCKHC  118

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             +KIMKGEVR+S+   G+G + LAW+HA C+ME+ P TQV+KL GW SLP SDQA VS L
Sbjct  119  KQKIMKGEVRLSTALDGKGTKGLAWYHANCYMEQCPSTQVEKLAGWQSLPPSDQAAVSIL  178

Query  606  VKNSTVKVAKEEPLXESTSTA  668
            VK  +  V  E+   ++TS A
Sbjct  179  VKKPSSAVKNEK---QTTSKA  196



>ref|XP_010652358.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Vitis vinifera]
 emb|CBI37089.3| unnamed protein product [Vitis vinifera]
Length=996

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 149/186 (80%), Gaps = 2/186 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRSSCKTCK+PIDKE  RLGKMVQA+QFDG MPMWNH GCILKKA
Sbjct  1    MANPPKPWKAEYAKSSRSSCKTCKTPIDKEKFRLGKMVQASQFDGFMPMWNHAGCILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAP--TPAVMEYGVETSQTSRATCK  419
             QIK+ DDVEG+E LRW+D++ IRKYVE GG   + A     AV E G+E SQTSRATCK
Sbjct  61   NQIKSLDDVEGIELLRWDDRQMIRKYVESGGPSKNTAKDVASAVAECGIEVSQTSRATCK  120

Query  420  HCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVS  599
             C++KIMKGEVRISSK  GQGA+ LAWHHA CF+E SP T ++KL GWD L +SDQ  V 
Sbjct  121  RCSQKIMKGEVRISSKPDGQGAKGLAWHHANCFLEMSPSTLIEKLSGWDGLSSSDQETVC  180

Query  600  SLVKNS  617
            +L+K S
Sbjct  181  ALIKKS  186



>ref|XP_002302058.2| poly (ADP-ribose) polymerase family protein [Populus trichocarpa]
 gb|EEE81331.2| poly (ADP-ribose) polymerase family protein [Populus trichocarpa]
Length=996

 Score =   246 bits (629),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 159/220 (72%), Gaps = 17/220 (8%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS+RSSCKTCKS IDKE LRLGKMV A QFDG MPMWNH  CILKKA
Sbjct  1    MANPQKAWKAEYAKSARSSCKTCKSIIDKEILRLGKMVHAKQFDGFMPMWNHASCILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSS---------DAPTPAVMEYGVETSQ  398
             QIK  DDVEG+ESLRWEDQ++IRKYVE GG G            A     MEYG+E SQ
Sbjct  61   NQIKFIDDVEGIESLRWEDQQRIRKYVEEGGGGGDDGASGSGPPSAKAAKAMEYGIELSQ  120

Query  399  TSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPA  578
            TSRATCK C+EKIMKGEVRISSK  GQG R LAWHHA CFM+  P  QVDKL GW+S+ A
Sbjct  121  TSRATCKSCSEKIMKGEVRISSKPDGQGPRGLAWHHANCFMDLYPSVQVDKLSGWESIAA  180

Query  579  SDQAVVSSLVKN--STVKVA------KEEPLXESTSTAGA  674
             DQAVV SLVK   ST K        ++E L +S+S AGA
Sbjct  181  PDQAVVHSLVKKVPSTAKTGIKNEGKEDEELQQSSSKAGA  220



>ref|XP_011028774.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Populus euphratica]
Length=996

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 159/220 (72%), Gaps = 17/220 (8%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS+RSSCKTCKS IDKE LRLGKMVQA QFDG MPMWNH  CILKKA
Sbjct  1    MANPQKAWKAEYAKSARSSCKTCKSIIDKEILRLGKMVQAKQFDGFMPMWNHASCILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSS---------DAPTPAVMEYGVETSQ  398
             QIK  DDVEG+ESLRWEDQ++IRKYVE GG G +          A     MEYG+E S 
Sbjct  61   NQIKFIDDVEGIESLRWEDQQRIRKYVEEGGGGGNDGGSGSGPPSAKAAKAMEYGIELSP  120

Query  399  TSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPA  578
            TSRA CK C+EKIMKGEVRISSK  GQG R LAWHHA CFM+  P  QVDKL GW+SL A
Sbjct  121  TSRAACKSCSEKIMKGEVRISSKPDGQGPRGLAWHHANCFMDLYPSVQVDKLSGWESLAA  180

Query  579  SDQAVVSSLVKN--STVKVA------KEEPLXESTSTAGA  674
             DQAVV SLVK   ST K        ++E L +S+S AGA
Sbjct  181  PDQAVVHSLVKKVPSTAKTGIKNEGKEDEELQQSSSKAGA  220



>ref|XP_010111892.1| Poly [ADP-ribose] polymerase 1 [Morus notabilis]
 gb|EXC31926.1| Poly [ADP-ribose] polymerase 1 [Morus notabilis]
Length=1022

 Score =   244 bits (622),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 156/208 (75%), Gaps = 9/208 (4%)
 Frame = +3

Query  78   HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIK  257
             KPWK EYAKS+RSSCK+CKS I KE LRLGKMVQATQFDG+MPMWNH  CILKKAKQIK
Sbjct  7    QKPWKVEYAKSARSSCKSCKSNIGKEVLRLGKMVQATQFDGLMPMWNHATCILKKAKQIK  66

Query  258  ATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPA-VMEYGVETSQTSRATCKHCNEK  434
            + DDVEG+E LRWEDQ+KIR YVE  G      P     +E  +E SQTSRATC+ C++K
Sbjct  67   SIDDVEGIEQLRWEDQQKIRAYVENSGAAQPSKPEAVKNVECNIEVSQTSRATCRTCSKK  126

Query  435  IMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSLVKN  614
            I KGEVRIS+K +GQGAR LAWHHA C+ME SP T+V+KLLGW++LPASDQA + SLVK 
Sbjct  127  ISKGEVRISTKPEGQGARGLAWHHANCYMESSPSTRVEKLLGWETLPASDQAALQSLVKE  186

Query  615  --------STVKVAKEEPLXESTSTAGA  674
                      +   ++E L +S++ AGA
Sbjct  187  VPSSAKSGKQINAEEDEELKQSSTKAGA  214



>ref|XP_011457987.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Fragaria vesca subsp. 
vesca]
Length=984

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 162/211 (77%), Gaps = 10/211 (5%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            MA P   KPWK EYAKSSRSSCKTC+SPI+KE LR GKMVQATQFDG +PMWNH  CI+K
Sbjct  1    MADPQNQKPWKVEYAKSSRSSCKTCRSPIEKENLRFGKMVQATQFDGFIPMWNHASCIMK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCG-----SSDAPTPAVMEYGVETSQTS  404
            KAKQIK+TDD+EGLE LRWEDQ+KIR YV+ G        SSD  T +    G+E SQTS
Sbjct  61   KAKQIKSTDDIEGLELLRWEDQKKIRDYVQSGASAGPAGPSSDTKTTSKAS-GIEVSQTS  119

Query  405  RATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASD  584
            RATC+ C+++I+KGEVRIS+K +GQGAR LAWHHAKCFME SP TQV+KL GW+++  SD
Sbjct  120  RATCRLCSQRILKGEVRISTKLEGQGARGLAWHHAKCFMESSPSTQVEKLSGWETISVSD  179

Query  585  QAVVSSLVKNSTVKVAKE--EPLXESTSTAG  671
            QA VS+L+K+     A+E  E   +STS AG
Sbjct  180  QAAVSALLKDGKKVEAQESKEIPPQSTSKAG  210



>emb|CAN75718.1| hypothetical protein VITISV_037618 [Vitis vinifera]
Length=1016

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRSSCKTCK+PIDKE  RLGKMVQA+QFDG MPMWNH GCILKKA
Sbjct  1    MANPPKPWKAEYAKSSRSSCKTCKTPIDKEKFRLGKMVQASQFDGFMPMWNHAGCILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAP--TPAVMEYGVETSQTSRATCK  419
             QIK+ DDVEG+E LRW+D++ IRKYVE GG   + A     AV E G+E SQTSRATCK
Sbjct  61   NQIKSLDDVEGIELLRWDDRQMIRKYVESGGPSKNTAKDVASAVAECGIEVSQTSRATCK  120

Query  420  HCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASD  584
             C++KIMKGEVRISSK  GQGA+ LAWHHA CF+E SP T ++KL GWD L +SD
Sbjct  121  RCSQKIMKGEVRISSKPDGQGAKGLAWHHANCFLEMSPSTLIEKLSGWDGLSSSD  175



>ref|XP_006443872.1| hypothetical protein CICLE_v10018683mg [Citrus clementina]
 ref|XP_006479562.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Citrus sinensis]
 gb|ESR57112.1| hypothetical protein CICLE_v10018683mg [Citrus clementina]
Length=996

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 159/212 (75%), Gaps = 10/212 (5%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWK EYAKS RSSC++CKS I+KE LRLGKMVQ++QFDG MPMWNH  C+L+KA
Sbjct  1    MANPPKPWKVEYAKSGRSSCRSCKSNIEKEALRLGKMVQSSQFDGFMPMWNHASCVLRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAV-MEYGVETSQTSRATCKH  422
             QIK+ DDVEG+ESLRWEDQ+KIRKYVE G    S + +     EYG+E SQTSRATC+H
Sbjct  61   NQIKSLDDVEGIESLRWEDQQKIRKYVEEGVGSGSSSKSNVTSAEYGIEVSQTSRATCRH  120

Query  423  CNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSS  602
            C++KIMKGEVRIS+K  GQG + LAWHHA CF++ SP TQV+KL GW +L  SDQ  V +
Sbjct  121  CSKKIMKGEVRISAKPDGQGTKGLAWHHANCFLDLSPSTQVEKLSGWGNLTVSDQGAVKA  180

Query  603  LV------KNST---VKVAKEEPLXESTSTAG  671
            LV      KN T   V+  KE P  +STS AG
Sbjct  181  LVNVPSTTKNGTKAAVQENKEMPAQQSTSKAG  212



>ref|XP_009354923.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Pyrus x bretschneideri]
Length=966

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 144/181 (80%), Gaps = 2/181 (1%)
 Frame = +3

Query  75   PHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQI  254
            P KPWK EYAKSSRSSCKTCKSPI+KETLRLGKMVQATQFDG MPMWNH  CI+KK+KQI
Sbjct  6    PQKPWKVEYAKSSRSSCKTCKSPIEKETLRLGKMVQATQFDGFMPMWNHARCIMKKSKQI  65

Query  255  KATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP--AVMEYGVETSQTSRATCKHCN  428
            K+TD+VEGLE LRWEDQ+KIR YV+ GG   +   T   A  E  +  S TSRATCK C+
Sbjct  66   KSTDEVEGLELLRWEDQQKIRSYVQSGGPPDTRPATSKFATKECDISVSPTSRATCKQCS  125

Query  429  EKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSLV  608
            +KI+K EVRISSK +GQG R LAWHHA CF+E SP  +V+KL GW++LP SDQ VV +LV
Sbjct  126  QKILKAEVRISSKPEGQGPRGLAWHHANCFLELSPSIKVEKLSGWETLPVSDQDVVRALV  185

Query  609  K  611
            K
Sbjct  186  K  186



>emb|CDY10794.1| BnaA05g11420D [Brassica napus]
Length=1322

 Score =   234 bits (598),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASP KPW+AEYAKSSRSSCK+CKSPI+KET RLGK+VQATQFDGVMPMW+H  CILKK 
Sbjct  1    MASPDKPWRAEYAKSSRSSCKSCKSPINKETFRLGKLVQATQFDGVMPMWHHASCILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ DDVEGLESLRWEDQ+KIR+YVE G  G+S +   +  +YG+E SQTSRA C+ C
Sbjct  61   KQIKSADDVEGLESLRWEDQQKIRQYVESGA-GNSTSTGTSTAKYGIEVSQTSRAGCRKC  119

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            +EKI+KGEVRI SK +G G + L WHHA+CF+  SP T++  L GW S+P SDQ  +  L
Sbjct  120  SEKILKGEVRIFSKPEGPGNKGLMWHHARCFLGTSPSTELKSLSGWGSIPDSDQEALLPL  179

Query  606  VK  611
            VK
Sbjct  180  VK  181


 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 88/127 (69%), Gaps = 7/127 (6%)
 Frame = +3

Query  252  IKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP-------AVMEYGVETSQTSRA  410
            +K  DDVEGLESLRWEDQ+KIR+YVE G   S+   T        A +EYG+E SQTSRA
Sbjct  418  LKPADDVEGLESLRWEDQQKIRQYVESGAGNSTSTGTSTASSGGNAKLEYGIEVSQTSRA  477

Query  411  TCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQA  590
             C+ C+EKI+KGEVRI SK +G G + L WHHA+CF+  SP T++  L GW S+P SDQ 
Sbjct  478  GCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHARCFLGTSPSTELKSLSGWGSIPDSDQE  537

Query  591  VVSSLVK  611
             +  LVK
Sbjct  538  ALLPLVK  544



>ref|XP_010522166.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tarenaya hassleriana]
Length=986

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 146/184 (79%), Gaps = 3/184 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA P KPWKAEYAKS+RSSCKTC+SPI+KE LRLGKMVQATQFDG MPMW+H  CILKKA
Sbjct  1    MAPPPKPWKAEYAKSARSSCKTCRSPINKEKLRLGKMVQATQFDGFMPMWHHADCILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSS--DAPTPAVMEYGVETSQTSRATCK  419
            KQIK+ DDVEG+ESLRWEDQ+KIRKYVE    GSS  D  T   +EYG+E S+TSRA C+
Sbjct  61   KQIKSVDDVEGIESLRWEDQQKIRKYVEEAEPGSSKNDGGTEK-LEYGIEVSKTSRANCR  119

Query  420  HCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVS  599
             C++KIMKGEVRI SK +G G + + WHHAKCF+E SP  +++ L GW S+P SD  V+ 
Sbjct  120  KCSQKIMKGEVRIYSKPEGVGNKQVMWHHAKCFLEMSPSIELENLPGWSSIPDSDHNVLL  179

Query  600  SLVK  611
             LVK
Sbjct  180  PLVK  183



>ref|XP_007199702.1| hypothetical protein PRUPE_ppa000811mg [Prunus persica]
 gb|EMJ00901.1| hypothetical protein PRUPE_ppa000811mg [Prunus persica]
Length=997

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 149/186 (80%), Gaps = 4/186 (2%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            MA+P   KPWK EYAKSSRSSCKTCKSPI+KE LRLGKMV ATQFDG MPMWNH  CI+K
Sbjct  1    MANPQPPKPWKVEYAKSSRSSCKTCKSPIEKEKLRLGKMVTATQFDGFMPMWNHADCIMK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPAVMEYGVETSQTSRAT  413
            KAKQIK+TDDVEGLE LRWEDQ++IR YV+ GG     + A T + +  G+E S TSRAT
Sbjct  61   KAKQIKSTDDVEGLELLRWEDQKEIRNYVQSGGPPDTITTATTTSKISSGIEVSPTSRAT  120

Query  414  CKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAV  593
            CK C++KI+K EVRIS+K +GQG R LAWHHA CFME SP T+V+KL GW++LP +DQA 
Sbjct  121  CKSCSQKILKAEVRISTKPEGQGPRGLAWHHANCFMELSPSTEVEKLSGWETLPVADQAA  180

Query  594  VSSLVK  611
            V +LVK
Sbjct  181  VRALVK  186



>ref|XP_010933094.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1-like [Elaeis guineensis]
Length=985

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 151/204 (74%), Gaps = 11/204 (5%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCK+CK+ IDK+ LRLGKMV ATQFDG MPMWNH GCI KK 
Sbjct  1    MANPPKPWKAEYAKSGRSSCKSCKNSIDKDQLRLGKMVAATQFDGFMPMWNHAGCIFKKG  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYG--VETSQTSRATCK  419
             QIK+ DDVEG++ LRWEDQ+KIRKYVEGG        T AV   G  +E SQTSRA C+
Sbjct  61   NQIKSVDDVEGVDLLRWEDQQKIRKYVEGGSVS-----TTAVSNDGCAMEVSQTSRAACR  115

Query  420  HCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVS  599
            HCN+KIMKG VR+S+KA GQG+R LAWHH  CF++ SP T ++K+ GWDSL   D+A V+
Sbjct  116  HCNQKIMKGMVRVSTKAAGQGSRGLAWHHVDCFIDMSPSTILEKISGWDSLSPEDKATVT  175

Query  600  SLVK----NSTVKVAKEEPLXEST  659
            +L K    N+   VA+E+   + T
Sbjct  176  ALAKKGKSNNNSAVAQEKHATKDT  199



>ref|XP_008235714.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Prunus mume]
Length=992

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 148/186 (80%), Gaps = 4/186 (2%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            MA+P   KPWK EYAKSSRSSCKTCKSPI+KE LRLGKMV ATQFDG MPMWNH  CI+K
Sbjct  1    MANPQPPKPWKVEYAKSSRSSCKTCKSPIEKEKLRLGKMVTATQFDGFMPMWNHADCIMK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPAVMEYGVETSQTSRAT  413
            KAKQIK+TDDVEGLE LRWEDQ++IR YV+ GG     +   T + +  G+E S TSRAT
Sbjct  61   KAKQIKSTDDVEGLELLRWEDQKEIRNYVQSGGPPDTITTVTTTSKVSSGIEVSPTSRAT  120

Query  414  CKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAV  593
            CK C++KI+K EVRIS+K +GQG R LAWHHA CFME SP T+V+KL GW++LP +DQA 
Sbjct  121  CKSCSQKILKAEVRISTKPEGQGPRGLAWHHANCFMELSPSTEVEKLSGWETLPVADQAA  180

Query  594  VSSLVK  611
            V +LVK
Sbjct  181  VRALVK  186



>ref|XP_010469693.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Camelina sativa]
Length=985

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 150/203 (74%), Gaps = 12/203 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASPHKPW+AEYAKSSRSSCKTCKS I KET RLGK+VQA+QFDGVMPMWNH  CILKK 
Sbjct  1    MASPHKPWRAEYAKSSRSSCKTCKSAITKETFRLGKLVQASQFDGVMPMWNHATCILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAV-----------MEYGVET  392
            KQIK+ DDVEG+ESLRWEDQ+KIRKYVE G   S+ A                +EYG+E 
Sbjct  61   KQIKSVDDVEGIESLRWEDQQKIRKYVESGAGNSTSASASTSTNTSSTANNAKLEYGIEV  120

Query  393  SQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSL  572
            SQTSRA C+ CNEKI+KGEVRI SK +G G + L WHHAKCF+E S  T+++ L GW ++
Sbjct  121  SQTSRAGCRKCNEKILKGEVRIFSKPEGPGNKGLMWHHAKCFLEMSSSTELESLPGWRNI  180

Query  573  PASDQAVVSSLVKNSTVKVAKEE  641
            P SDQ  +  LVK  T+  AK E
Sbjct  181  PDSDQEALLPLVKK-TLPAAKTE  202



>gb|KEH23887.1| poly(ADP-ribose) polymerase domain protein [Medicago truncatula]
Length=1006

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 146/191 (76%), Gaps = 11/191 (6%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            M++P   KPWKAEYAKS RSSC++CKSPI  E LRLGKMVQ+++FDG+MPMWNH  CILK
Sbjct  1    MSNPQNAKPWKAEYAKSGRSSCRSCKSPIATEKLRLGKMVQSSKFDGLMPMWNHAECILK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAV---------MEYGVET  392
            KA QIK  DDVE LESLRWEDQ+KIRKY+E GG G S  P             +EYG+E 
Sbjct  61   KANQIKLVDDVENLESLRWEDQQKIRKYIESGGGGGSGTPKSNAASKSTAGKNIEYGIEV  120

Query  393  SQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSL  572
            SQTSRATCKHC +KI+KGE+RIS+K  GQGAR LAWHHAKC +E SP  +VD L GW+SL
Sbjct  121  SQTSRATCKHCGQKIIKGEIRISTKPDGQGARGLAWHHAKCLLELSPSIEVDNLPGWNSL  180

Query  573  PASDQAVVSSL  605
             +SDQ+ VS L
Sbjct  181  SSSDQSAVSEL  191



>ref|XP_009144225.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Brassica 
rapa]
Length=967

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 7/189 (4%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASP KPW+AEYAKSSRSSCK+CKSPI+KET RLGK+VQATQFDGVMPMW+H  CILKK 
Sbjct  1    MASPDKPWRAEYAKSSRSSCKSCKSPINKETFRLGKLVQATQFDGVMPMWHHASCILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP-------AVMEYGVETSQTS  404
            KQIK+ DDVEGLESLRWEDQ+KIR+YVE G   S+   T        A +EYG+E SQTS
Sbjct  61   KQIKSADDVEGLESLRWEDQQKIRQYVESGAGNSTSTGTSTASSGGNAKLEYGIEVSQTS  120

Query  405  RATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASD  584
            RA C+ C+EKI+KGEVRI SK +G G + L WHHA+CF+  SP T++  L GW S+P SD
Sbjct  121  RAGCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHARCFLGTSPSTELKSLSGWGSIPDSD  180

Query  585  QAVVSSLVK  611
            Q  +  LVK
Sbjct  181  QEALLPLVK  189



>ref|XP_009144226.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Brassica 
rapa]
Length=966

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 7/189 (4%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASP KPW+AEYAKSSRSSCK+CKSPI+KET RLGK+VQATQFDGVMPMW+H  CILKK 
Sbjct  1    MASPDKPWRAEYAKSSRSSCKSCKSPINKETFRLGKLVQATQFDGVMPMWHHASCILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP-------AVMEYGVETSQTS  404
            KQIK+ DDVEGLESLRWEDQ+KIR+YVE G   S+   T        A +EYG+E SQTS
Sbjct  61   KQIKSADDVEGLESLRWEDQQKIRQYVESGAGNSTSTGTSTASSGGNAKLEYGIEVSQTS  120

Query  405  RATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASD  584
            RA C+ C+EKI+KGEVRI SK +G G + L WHHA+CF+  SP T++  L GW S+P SD
Sbjct  121  RAGCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHARCFLGTSPSTELKSLSGWGSIPDSD  180

Query  585  QAVVSSLVK  611
            Q  +  LVK
Sbjct  181  QEALLPLVK  189



>gb|KDO68484.1| hypothetical protein CISIN_1g035625mg [Citrus sinensis]
Length=954

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 145/182 (80%), Gaps = 1/182 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWK EYAKS RSSC++CKS I+KE LRLGKMVQ++QFDG MPMWNH  C+L+KA
Sbjct  1    MANPPKPWKVEYAKSGRSSCRSCKSNIEKEALRLGKMVQSSQFDGFMPMWNHASCVLRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAV-MEYGVETSQTSRATCKH  422
             QIK+ DDVEG+ESLRWEDQ+KIRKYVE G    S + +     EYG+E SQTSRATC+H
Sbjct  61   NQIKSLDDVEGIESLRWEDQQKIRKYVEEGVGSGSSSKSNVTAAEYGIEVSQTSRATCRH  120

Query  423  CNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSS  602
            C++KIMKGEVRIS+K  GQG + LAWHHA CF++ SP TQV+KL GW +L  SDQ  V +
Sbjct  121  CSKKIMKGEVRISAKPDGQGTKGLAWHHANCFLDLSPSTQVEKLSGWGNLTVSDQGAVKA  180

Query  603  LV  608
            LV
Sbjct  181  LV  182



>ref|XP_008801332.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Phoenix dactylifera]
Length=901

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 146/205 (71%), Gaps = 8/205 (4%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCK+CK+ I K+ LRLGKMV ATQFDG MPMWNH GCI KK 
Sbjct  1    MATPPKPWKAEYAKSGRSSCKSCKNSIGKDQLRLGKMVTATQFDGFMPMWNHAGCIFKKG  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK  DD+EGL+ LRWEDQ+KIRKY+EGG   ++        E  VE SQTSRA C+ C
Sbjct  61   NQIKFVDDIEGLDLLRWEDQQKIRKYIEGGSVSTTAVSND---ECAVEVSQTSRAACRRC  117

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N+KIMKG VR S+K +GQGAR LAWHH  CF+E SP T ++K+ GWDSL   D+  V++L
Sbjct  118  NQKIMKGMVRCSTKPEGQGARGLAWHHVNCFIEMSPSTIIEKISGWDSLSPEDKVTVTAL  177

Query  606  VK-----NSTVKVAKEEPLXESTST  665
            VK     N+TV  A E+    S  T
Sbjct  178  VKKDKSNNNTVSNAIEQEQQASKGT  202



>ref|XP_009367708.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=966

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 147/186 (79%), Gaps = 4/186 (2%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            M +P   KPWK EYAKSSRSSCKTCKSPI+KETLRLGKMVQATQFDGVMPMWNH  CI+K
Sbjct  1    MENPQAQKPWKVEYAKSSRSSCKTCKSPIEKETLRLGKMVQATQFDGVMPMWNHADCIMK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVM--EYGVETSQTSRAT  413
            K+ QIK+TD+VEGLE +RWEDQ+K+R +V+ GG   +   T      E G+E S TSRAT
Sbjct  61   KSNQIKSTDEVEGLELIRWEDQQKVRSHVQSGGPLDTSPATSKFTTKECGIEVSPTSRAT  120

Query  414  CKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAV  593
            CK C++KI+K EVRIS+K +GQG RSLAW+HA CFME SP  +V+KL GW++LP SDQ  
Sbjct  121  CKQCSQKILKTEVRISTKPEGQGPRSLAWNHANCFMELSPSIEVEKLPGWETLPVSDQEA  180

Query  594  VSSLVK  611
            V +LVK
Sbjct  181  VRALVK  186



>ref|XP_009367706.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=966

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 147/186 (79%), Gaps = 4/186 (2%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            M +P   KPWK EYAKSSRSSCKTCKSPI+KETLRLGKMVQATQFDGVMPMWNH  CI+K
Sbjct  1    MENPQAQKPWKVEYAKSSRSSCKTCKSPIEKETLRLGKMVQATQFDGVMPMWNHADCIMK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVM--EYGVETSQTSRAT  413
            K+ QIK+TD+VEGLE +RWEDQ+K+R +V+ GG   +   T      E G+E S TSRAT
Sbjct  61   KSNQIKSTDEVEGLELIRWEDQQKVRSHVQSGGPLDTSPATSKFTTKECGIEVSPTSRAT  120

Query  414  CKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAV  593
            CK C++KI+K EVRIS+K +GQG RSLAW+HA CFME SP  +V+KL GW++LP SDQ  
Sbjct  121  CKQCSQKILKTEVRISTKPEGQGPRSLAWNHANCFMELSPSIEVEKLPGWETLPVSDQEA  180

Query  594  VSSLVK  611
            V +LVK
Sbjct  181  VRALVK  186



>ref|XP_008794292.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Phoenix dactylifera]
Length=981

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 145/192 (76%), Gaps = 3/192 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCK+CK+ IDK+ LRLGKMV ATQFDG MP WNH GCI KK 
Sbjct  1    MANPPKPWKAEYAKSGRSSCKSCKNSIDKDQLRLGKMVAATQFDGFMPTWNHAGCIFKKG  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG++ LRWEDQ+KIRKYVEG   GS  A   +  E  +E SQTSRA C+ C
Sbjct  61   NQIKSVDDVEGIDLLRWEDQQKIRKYVEG---GSVSATAVSNDECAMEVSQTSRAACRRC  117

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            N+KIMKG VR+S+K +G+GAR LAWHH  CF++ SP T ++K+ GWDSL   D+A +++L
Sbjct  118  NQKIMKGMVRVSTKPEGRGARGLAWHHVNCFIDMSPSTILEKISGWDSLSPEDKATITAL  177

Query  606  VKNSTVKVAKEE  641
             +N     A+E+
Sbjct  178  AENFNSNTAQEQ  189



>ref|XP_006410264.1| hypothetical protein EUTSA_v10016190mg [Eutrema salsugineum]
 gb|ESQ51717.1| hypothetical protein EUTSA_v10016190mg [Eutrema salsugineum]
Length=966

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 3/184 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASP KPW+AEYAKS RSSCK+CKS I+KE  RLGK+VQATQFDGVMPMW+H  CILKK 
Sbjct  1    MASPQKPWRAEYAKSGRSSCKSCKSAINKEIFRLGKLVQATQFDGVMPMWHHAACILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGG---CGSSDAPTPAVMEYGVETSQTSRATC  416
            KQIK+ DDVEGLESLRWEDQ+KIR+YVE G      +S +   A +EYG+E SQTSRA C
Sbjct  61   KQIKSVDDVEGLESLRWEDQQKIREYVESGAGNSTSTSSSGGNAKLEYGIEVSQTSRAAC  120

Query  417  KHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVV  596
            + C++KI+KGEVRI SK +G G + L W+HAKCF+E S  T++D L GW S+P SDQ  +
Sbjct  121  RKCSDKILKGEVRIFSKPEGPGNKGLMWYHAKCFLEMSSSTELDSLSGWGSIPGSDQEAL  180

Query  597  SSLV  608
              LV
Sbjct  181  LPLV  184



>gb|EYU46476.1| hypothetical protein MIMGU_mgv1a000724mg [Erythranthe guttata]
Length=1002

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 155/217 (71%), Gaps = 14/217 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKSSRSSCKTCK PI+KE LRLGKMVQ++ FDG MPMWNH  CILKK 
Sbjct  1    MANPPKPWKAEYAKSSRSSCKTCKIPINKEILRLGKMVQSSHFDGFMPMWNHASCILKKP  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVE------------GGGCGSSDAPTPAVMEYGVE  389
            KQIK  DDVEGLESLRWEDQEKIRKY+                  S+ A   AV++ G+E
Sbjct  61   KQIKLVDDVEGLESLRWEDQEKIRKYINSAAVSNSPASASASASASASASASAVVQCGIE  120

Query  390  TSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDS  569
             SQTSRATC+ CNEKIMKGE+RIS+K +GQGAR LAW+HAKC+ME S  ++V+   GW+S
Sbjct  121  VSQTSRATCRCCNEKIMKGEIRISTKPEGQGARGLAWNHAKCYMEASQKSRVESFSGWES  180

Query  570  LPASDQAVVSSLVKNS--TVKVAKEEPLXESTSTAGA  674
            L  SD+A V + VK +  T    KE  L  S +  GA
Sbjct  181  LSPSDRATVLAFVKKNPQTANEEKELVLESSANKGGA  217



>ref|XP_009398034.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 144/192 (75%), Gaps = 3/192 (2%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCKTCKSPID++ LRLGKMV ATQFDG MPMWNH GCI KK 
Sbjct  1    MANPPKPWKAEYAKSGRSSCKTCKSPIDRDQLRLGKMVAATQFDGYMPMWNHAGCIFKKQ  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG++ LRWEDQ+ IRKYVE    GSS + T    E  +E SQTSRATC+HC
Sbjct  61   NQIKSLDDVEGIDLLRWEDQKSIRKYVED---GSSTSTTVDNSECAIEVSQTSRATCRHC  117

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            ++KI KG VR+S+KA+GQGAR ++WHH  CF   SP T ++K+ GWDSL   D+  +S+ 
Sbjct  118  SQKITKGTVRVSTKAEGQGARGISWHHVNCFTTMSPSTSLEKISGWDSLSPQDKESLSAF  177

Query  606  VKNSTVKVAKEE  641
             +  T K  +++
Sbjct  178  SRKDTSKKTEDQ  189



>ref|XP_007162524.1| hypothetical protein PHAVU_001G159200g [Phaseolus vulgaris]
 gb|ESW34518.1| hypothetical protein PHAVU_001G159200g [Phaseolus vulgaris]
Length=1002

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 141/186 (76%), Gaps = 6/186 (3%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            M++P   KPWKAEYAKS RSSC+TCK+PI  E+LRLGKMV++ +FDG+MPMWNH  C+L+
Sbjct  1    MSNPQDQKPWKAEYAKSGRSSCRTCKNPIATESLRLGKMVKSFKFDGIMPMWNHAACVLE  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGS----SDAPTPAVMEYGVETSQTSR  407
            KA QIK  DDVE LESLRWEDQ+ IRKY+E GG  S    S +      E  +E SQTSR
Sbjct  61   KANQIKLVDDVENLESLRWEDQQNIRKYIESGGSSSTATKSGSKDVKETECAIEVSQTSR  120

Query  408  ATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQ  587
            ATC+ C++KI+KGEVRIS+K  G GAR LAWHHAKC ME SP  QVDKL GW+SL +SDQ
Sbjct  121  ATCRDCSQKIIKGEVRISTKPDGSGARGLAWHHAKCLMELSPSIQVDKLSGWNSLSSSDQ  180

Query  588  AVVSSL  605
            + VS  
Sbjct  181  SAVSDF  186



>ref|XP_010510210.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Camelina sativa]
Length=985

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 151/203 (74%), Gaps = 12/203 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASPHKPW+AEYAKSSRSSCKTCKS I KET RLGK+VQA+QFDGVMPMWNH  CILKK 
Sbjct  1    MASPHKPWRAEYAKSSRSSCKTCKSAITKETFRLGKLVQASQFDGVMPMWNHASCILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAV-----------MEYGVET  392
            KQIK+ DDVEG+ESLRWEDQEKIRKYVE G   S+ A T              +EYG+E 
Sbjct  61   KQIKSVDDVEGIESLRWEDQEKIRKYVESGAGNSTSASTSTSTSTSSTANSAKLEYGIEV  120

Query  393  SQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSL  572
            SQTSRA C+ C+EKI+KGEVRI SK +G G + L WHHAKCF+E S  T+++ L GW S+
Sbjct  121  SQTSRAGCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHAKCFLEMSSSTELESLSGWRSI  180

Query  573  PASDQAVVSSLVKNSTVKVAKEE  641
            P SDQ  +  LVK  T+  AK E
Sbjct  181  PDSDQEALLPLVKK-TLPAAKTE  202



>ref|XP_002881169.1| hypothetical protein ARALYDRAFT_902162 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57428.1| hypothetical protein ARALYDRAFT_902162 [Arabidopsis lyrata subsp. 
lyrata]
Length=979

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 6/197 (3%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASPHKPW+AEYAKSSRSSCKTCKS I+KE  RLGK+VQ+T FDG+MPMWNH  CIL K 
Sbjct  1    MASPHKPWRAEYAKSSRSSCKTCKSVINKENFRLGKLVQSTHFDGIMPMWNHASCILNKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCG-----SSDAPTPAVMEYGVETSQTSRA  410
            KQIK+ DDVEG+ESLRWEDQ+KIRKYVE G         S     A +EYG+E SQTSRA
Sbjct  61   KQIKSVDDVEGIESLRWEDQQKIRKYVESGAGNSTSTSKSSTANNAKLEYGIEVSQTSRA  120

Query  411  TCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQA  590
             C+ C+EKI+KGEVRI SK +G G + L WHHAKCF+E S  T+++ L GW S+P +DQ 
Sbjct  121  GCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHAKCFLEMSSSTELESLSGWRSIPDADQE  180

Query  591  VVSSLVKNSTVKVAKEE  641
            V+  LVK + + VAK E
Sbjct  181  VLLPLVKKA-LPVAKTE  196



>ref|XP_010038006.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Eucalyptus grandis]
 gb|KCW49804.1| hypothetical protein EUGRSUZ_K03285 [Eucalyptus grandis]
Length=1000

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 140/185 (76%), Gaps = 5/185 (3%)
 Frame = +3

Query  75   PHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQI  254
            P KPWK EYAKS R+SCK+CK+ IDKE LRLGKMVQ++QFDG +PMWNH  CI++KA QI
Sbjct  5    PTKPWKVEYAKSGRASCKSCKNTIDKEKLRLGKMVQSSQFDGFIPMWNHADCIMRKANQI  64

Query  255  KATDDVEGLESLRWEDQEKIRKYVEGGGCGS-SDAP----TPAVMEYGVETSQTSRATCK  419
            K  DDVEG+E LRWEDQ+KIRKYVE  G  + +D P    + +  E  +E S TSRA+C+
Sbjct  65   KVIDDVEGVELLRWEDQQKIRKYVESRGPATKNDGPSTKNSSSDSECSIEASPTSRASCR  124

Query  420  HCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVS  599
             C +KIMKGE RIS K  GQG RSLAWHHA CFM+ SP  Q+DK+ GWDSLP SDQA + 
Sbjct  125  QCGQKIMKGETRISIKPDGQGPRSLAWHHAHCFMKISPSVQLDKISGWDSLPVSDQAPLI  184

Query  600  SLVKN  614
             LVK+
Sbjct  185  DLVKS  189



>ref|XP_010414140.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelina sativa]
Length=985

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 151/203 (74%), Gaps = 12/203 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASPHKPW+AEYAKSSRSSCKTCKS I KET RLGK+VQA+QFDGVMPMWNH  CILKK 
Sbjct  1    MASPHKPWRAEYAKSSRSSCKTCKSAITKETFRLGKLVQASQFDGVMPMWNHASCILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAV-----------MEYGVET  392
            KQIK+ DDVEG+ESLRWEDQEKIRKYVE G   S+ A T              +EYG+E 
Sbjct  61   KQIKSVDDVEGIESLRWEDQEKIRKYVESGAGNSTSASTSTSTSTSSTANNAKLEYGIEV  120

Query  393  SQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSL  572
            SQTSRA C+ C+EKI+KGEVRI SK +G G + L WHHAKCF+E S  T+++ L GW ++
Sbjct  121  SQTSRAGCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHAKCFLEMSSSTELESLSGWRNI  180

Query  573  PASDQAVVSSLVKNSTVKVAKEE  641
            P SDQ  +  LVK  T+  AK E
Sbjct  181  PDSDQEALLPLVKK-TLPAAKTE  202



>ref|XP_006293618.1| hypothetical protein CARUB_v10022570mg [Capsella rubella]
 gb|EOA26516.1| hypothetical protein CARUB_v10022570mg [Capsella rubella]
Length=985

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 146/195 (75%), Gaps = 11/195 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+PHKPW+AEYAKSSRSSCKTCKS I KE  RLGK+VQA+QFDGVMPMWNH  CILKKA
Sbjct  1    MATPHKPWRAEYAKSSRSSCKTCKSSITKENFRLGKLVQASQFDGVMPMWNHASCILKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCG-----------SSDAPTPAVMEYGVET  392
            KQIK+ DDVEG+ESLRWEDQ+KIRKYVE G              +S     A +EYG+E 
Sbjct  61   KQIKSVDDVEGIESLRWEDQQKIRKYVESGAGNSTSTSTSTSTSTSSTANNAKLEYGIEV  120

Query  393  SQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSL  572
            SQTSRA C+ C+EKI+KGEVRI SK +G G + L WHHAKCF+E S  T+++ L GW ++
Sbjct  121  SQTSRAGCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHAKCFLEMSSSTELESLSGWKNI  180

Query  573  PASDQAVVSSLVKNS  617
            P SDQ  +  LVK +
Sbjct  181  PESDQEALLPLVKKA  195



>ref|XP_004493762.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cicer arietinum]
Length=998

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 145/194 (75%), Gaps = 13/194 (7%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            M++P   KPWKAEYAKS RSSC++CK+PI  E LRLGKMVQ+++FDG+MPMWNH  CILK
Sbjct  1    MSNPQSQKPWKAEYAKSGRSSCRSCKTPIATEKLRLGKMVQSSKFDGLMPMWNHAECILK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVE-----GGGCGSSDAPTPA------VMEYGV  386
            K KQIK+ DDVE LESLRWEDQ+ IRKY+E      GG       TPA       +EYG+
Sbjct  61   KPKQIKSVDDVENLESLRWEDQQNIRKYIESSGGGSGGGSGGGTNTPAKSNAGKNVEYGI  120

Query  387  ETSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWD  566
            E SQTSRATCK C +KI+KGEVRIS+K  GQG R LAWHHAKC +E SP  +VD L GW+
Sbjct  121  EVSQTSRATCKPCGQKIIKGEVRISTKPDGQGPRGLAWHHAKCLLELSPSIEVDSLSGWN  180

Query  567  SLPASDQAVVSSLV  608
            SL +SDQ+ +S LV
Sbjct  181  SLSSSDQSALSDLV  194



>ref|NP_850165.1| poly [ADP-ribose] polymerase 2 [Arabidopsis thaliana]
 sp|Q9ZP54.2|PARP1_ARATH RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Arabidopsis thaliana]
 emb|CAA10482.1| poly(ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AAM13882.1| putative poly (ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AAN12901.1| putative poly(ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AEC08527.1| poly [ADP-ribose] polymerase 2 [Arabidopsis thaliana]
Length=983

 Score =   221 bits (562),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 145/193 (75%), Gaps = 9/193 (5%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASPHKPW+AEYAKSSRSSCKTCKS I+KE  RLGK+VQ+T FDG+MPMWNH  CILKK 
Sbjct  1    MASPHKPWRAEYAKSSRSSCKTCKSVINKENFRLGKLVQSTHFDGIMPMWNHASCILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGG---------CGSSDAPTPAVMEYGVETSQ  398
            KQIK+ DDVEG+ESLRWEDQ+KIRKYVE G            +S     A +EYG+E SQ
Sbjct  61   KQIKSVDDVEGIESLRWEDQQKIRKYVESGAGSNTSTSTGTSTSSTANNAKLEYGIEVSQ  120

Query  399  TSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPA  578
            TSRA C+ C+EKI+KGEVRI SK +G G + L WHHAKCF+E S  T+++ L GW S+P 
Sbjct  121  TSRAGCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHAKCFLEMSSSTELESLSGWRSIPD  180

Query  579  SDQAVVSSLVKNS  617
            SDQ  +  LVK +
Sbjct  181  SDQEALLPLVKKA  193



>gb|AAD20677.1| putative poly (ADP-ribose) polymerase [Arabidopsis thaliana]
Length=1009

 Score =   221 bits (562),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 145/193 (75%), Gaps = 9/193 (5%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MASPHKPW+AEYAKSSRSSCKTCKS I+KE  RLGK+VQ+T FDG+MPMWNH  CILKK 
Sbjct  1    MASPHKPWRAEYAKSSRSSCKTCKSVINKENFRLGKLVQSTHFDGIMPMWNHASCILKKT  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGG---------CGSSDAPTPAVMEYGVETSQ  398
            KQIK+ DDVEG+ESLRWEDQ+KIRKYVE G            +S     A +EYG+E SQ
Sbjct  61   KQIKSVDDVEGIESLRWEDQQKIRKYVESGAGSNTSTSTGTSTSSTANNAKLEYGIEVSQ  120

Query  399  TSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPA  578
            TSRA C+ C+EKI+KGEVRI SK +G G + L WHHAKCF+E S  T+++ L GW S+P 
Sbjct  121  TSRAGCRKCSEKILKGEVRIFSKPEGPGNKGLMWHHAKCFLEMSSSTELESLSGWRSIPD  180

Query  579  SDQAVVSSLVKNS  617
            SDQ  +  LVK +
Sbjct  181  SDQEALLPLVKKA  193



>ref|XP_003521279.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Glycine 
max]
Length=997

 Score =   221 bits (562),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 147/206 (71%), Gaps = 14/206 (7%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            M++P   KPWKAEYAKS RSSC+TCKSPI  ETLRLGKMVQ+T+FDG+MPMWNH  CILK
Sbjct  1    MSNPQDQKPWKAEYAKSGRSSCRTCKSPIASETLRLGKMVQSTKFDGLMPMWNHAACILK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVE----------GGGCGSSDAPTPAVMEYGVE  389
            KA QIK  +DVE LESLRWEDQ+KIRKY+E           G    SD+ T    + G+E
Sbjct  61   KANQIKLLEDVENLESLRWEDQQKIRKYIESGGGGGGGSSSGSAAKSDSKTVKDTKCGIE  120

Query  390  TSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDS  569
             SQ SRATCK C +KI+KGEVRIS+K  GQGA+ LAWHHAKC ME SP   V KL GW++
Sbjct  121  VSQNSRATCKDCGQKIIKGEVRISTKPGGQGAKGLAWHHAKCLMELSPSIDVYKLSGWNN  180

Query  570  LPASDQAVVSSLVKN--STVKVAKEE  641
            L +SDQ+ VS   K   S  K+  EE
Sbjct  181  LSSSDQSAVSDFAKKGGSDTKIETEE  206



>ref|XP_006827512.1| hypothetical protein AMTR_s00009p00185150 [Amborella trichopoda]
 gb|ERM94928.1| hypothetical protein AMTR_s00009p00185150 [Amborella trichopoda]
Length=308

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 145/210 (69%), Gaps = 10/210 (5%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            MASP+  KPWK EYAKSSRSSCKTCK  I K+ LRLGKMVQATQFDG MPMW+H GCI K
Sbjct  1    MASPNPPKPWKVEYAKSSRSSCKTCKGNIAKDVLRLGKMVQATQFDGFMPMWHHAGCIFK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCK  419
            K +QIKA +DVEG + +RW+DQ+ I  YVE     SS A   A  +Y +E S++SRA CK
Sbjct  61   KPRQIKAQEDVEGFDLIRWDDQKNIHNYVENA--TSSAAAGDASTDYAIEASKSSRAGCK  118

Query  420  HCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVS  599
            HCNEKIMKGEVR+S K   Q  R +AWHH KCF+EK P T + K+ GW+SL  +++  V 
Sbjct  119  HCNEKIMKGEVRVSIKLDPQEGRGVAWHHIKCFLEKLPATDISKVPGWESLSTNEKESVL  178

Query  600  SLVKNSTVKVAK------EEPLXESTSTAG  671
            ++VK  + K  K       E   E+TS +G
Sbjct  179  AIVKKDSTKKTKGVQAVPREVQHETTSKSG  208



>ref|XP_003554282.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Glycine max]
 gb|KHN02523.1| Poly [ADP-ribose] polymerase 1 [Glycine soja]
Length=996

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 149/206 (72%), Gaps = 14/206 (7%)
 Frame = +3

Query  66   MASPH--KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            M++P   KPWKAEYAKS RSSC+TCKSPI  ETLRLGKMVQ+T+FDG++PMWNH  C+LK
Sbjct  1    MSNPQDQKPWKAEYAKSGRSSCRTCKSPIASETLRLGKMVQSTKFDGLVPMWNHAACVLK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVE----------GGGCGSSDAPTPAVMEYGVE  389
            KA QIK  +DVE LESLRWEDQ+KIRKY+E          GG    SD+ T    + G+E
Sbjct  61   KANQIKLVEDVENLESLRWEDQQKIRKYIESGGGGGSSSGGGSAAKSDSKTVKDTKCGIE  120

Query  390  TSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDS  569
             SQ SRATCK C +KI+KGEVRIS+K  GQGA+ LAWHHAKC ++ SP  +VDKL GW++
Sbjct  121  VSQNSRATCKDCGQKIIKGEVRISTKQGGQGAKGLAWHHAKCLIDLSPSIEVDKLSGWNN  180

Query  570  LPASDQAVVSSLVKN--STVKVAKEE  641
            L +SDQ+ V    K   S  K+  EE
Sbjct  181  LSSSDQSAVIDFAKKGGSDTKIETEE  206



>ref|XP_009781598.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Nicotiana 
sylvestris]
Length=995

 Score =   213 bits (542),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 127/163 (78%), Gaps = 5/163 (3%)
 Frame = +3

Query  201  VMPMWNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEY  380
            ++ MW+H  CIL+KAKQIK+ +DVEG++ LRWEDQ+KIR+Y EGGG GSS+ P PA ME 
Sbjct  46   MIQMWHHASCILRKAKQIKSLEDVEGVDQLRWEDQQKIREYAEGGGSGSSNIPAPAAMEC  105

Query  381  GVETSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLG  560
            G+E SQTSRA+C+HCN+KI+KGEVR+SSK +GQ A+SLAWHHAKCF E S  TQV+KL G
Sbjct  106  GIEVSQTSRASCRHCNQKIVKGEVRLSSKPEGQRAKSLAWHHAKCFSEISSTTQVEKLSG  165

Query  561  WDSLPASDQAVVSSLVKN-----STVKVAKEEPLXESTSTAGA  674
            WDSL A+DQAVV SL K+     S     KEE   ESTS AGA
Sbjct  166  WDSLSAADQAVVLSLFKSYSSTGSNKTEPKEELTQESTSKAGA  208



>gb|EPS63698.1| hypothetical protein M569_11084 [Genlisea aurea]
Length=981

 Score =   213 bits (542),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 149/204 (73%), Gaps = 3/204 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+    WK EYAKSSRSSCKTCK+ I+KE LRLGKMVQAT+FDG+MPMWNH  C+L+K 
Sbjct  1    MANHPYSWKVEYAKSSRSSCKTCKNLIEKENLRLGKMVQATKFDGLMPMWNHAACVLRKP  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            KQIK+ DDVEGLE LRWEDQ+ IRKYV+G     S + + A  E G+E S+TSRATC+ C
Sbjct  61   KQIKSVDDVEGLELLRWEDQQTIRKYVDGALQSVSASASEA--ECGIEVSKTSRATCRCC  118

Query  426  NEKIMKGEVRISSKAKGQG-ARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSS  602
            N+KI+KGE+RIS+K +GQG +R L+W+HAKC+ME SP  +V+K  GWD+L ASD   + S
Sbjct  119  NQKIIKGEIRISTKLEGQGSSRGLSWNHAKCYMEMSPSCKVEKFSGWDTLTASDHDTLRS  178

Query  603  LVKNSTVKVAKEEPLXESTSTAGA  674
             +  S  K        E+ +  G+
Sbjct  179  FINGSESKCLNRGKEEETENVPGS  202



>ref|XP_009617762.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=977

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 4/162 (2%)
 Frame = +3

Query  201  VMPMWNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEY  380
            ++ MW+H  CIL+KAKQIK+ +DVEG++ LRWEDQ+KIR+YVEGGG GSS+ P PA ME 
Sbjct  29   MIQMWHHASCILRKAKQIKSLEDVEGVDQLRWEDQQKIREYVEGGGSGSSNIPAPAAMEC  88

Query  381  GVETSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLG  560
            G+E SQTSRA+C+HCN+KI+KGEVR+SSK +GQ A+SLAWHHAKCF E S  TQV+KL G
Sbjct  89   GIEVSQTSRASCRHCNQKIVKGEVRLSSKPEGQRAKSLAWHHAKCFSEISSTTQVEKLSG  148

Query  561  WDSLPASDQAVVSSLVKNSTVKVAKEEP----LXESTSTAGA  674
            WDSL A+ Q VV SL K+S+    K EP      ESTS AGA
Sbjct  149  WDSLSAAYQTVVLSLFKSSSSTGNKTEPKEELAQESTSKAGA  190



>ref|XP_010679215.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=983

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 138/183 (75%), Gaps = 1/183 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS+R++C+TCK  I KE LR GKMVQ++ FDG MPMW+H  CI+KKA
Sbjct  1    MAAPEKPWKAEYAKSARAACRTCKDNIGKEILRFGKMVQSSHFDGFMPMWHHATCIMKKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSS-DAPTPAVMEYGVETSQTSRATCKH  422
             QIK+ D++EG+ESLRWEDQ+KIRKY++G G  S   A T A   YG+E SQTSRA CK 
Sbjct  61   NQIKSIDEIEGVESLRWEDQQKIRKYIDGNGVVSDAGAATRAPAAYGIEVSQTSRAACKR  120

Query  423  CNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSS  602
            C++KI+KGEVRIS+K  G+  + L+W+HA C++E  P T +D L GW SL + DQA + +
Sbjct  121  CSQKIIKGEVRISAKIDGKATKGLSWYHAACYLESFPSTLLDSLSGWQSLSSDDQASLQA  180

Query  603  LVK  611
              K
Sbjct  181  TTK  183



>gb|KFK31229.1| hypothetical protein AALP_AA6G085200 [Arabis alpina]
Length=984

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 143/189 (76%), Gaps = 8/189 (4%)
 Frame = +3

Query  75   PHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQI  254
            P K W+AEYAKS+RSSCKTCKS I+KET RLGK+VQATQFDGVMPMWNH  C+LKK KQI
Sbjct  6    PQKAWRAEYAKSARSSCKTCKSTINKETFRLGKLVQATQFDGVMPMWNHADCVLKKTKQI  65

Query  255  KATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQTSRA  410
            K+ DDVE LESLRWEDQ+KIRKYVE G   S+ A           A +EYG+E SQTSRA
Sbjct  66   KSVDDVESLESLRWEDQQKIRKYVEFGAGNSTSASKNTGSSSSGNAKLEYGIEVSQTSRA  125

Query  411  TCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQA  590
             C+ C++KI+K EVRI SK +G G + L WHHAKCF+E S  T+++ L GW S+P S+Q 
Sbjct  126  GCRKCSDKILKEEVRIFSKPEGPGNKGLMWHHAKCFLETSSSTELESLSGWRSIPDSEQK  185

Query  591  VVSSLVKNS  617
            ++ +LVK +
Sbjct  186  ILLTLVKKA  194



>gb|ACL53937.1| unknown [Zea mays]
Length=446

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS R+SCK+C+SPI K+ LRLGKMVQA+QFDG MPMWNH  CI  K 
Sbjct  1    MAAPPKAWKAEYAKSGRASCKSCRSPIAKDQLRLGKMVQASQFDGFMPMWNHARCIFSKK  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG+++LRW+DQEKIR YV     G+S    P   +  +E + ++R +C+ C
Sbjct  61   NQIKSVDDVEGIDALRWDDQEKIRNYVGSASAGTSSTAAPP-EKCTIEIAPSARTSCRRC  119

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            +EKI KG VR+S+K + +G + + W+HA CF E SP   V+K  GWD+L   D+  +  L
Sbjct  120  SEKITKGSVRLSAKLESEGPKGIPWYHANCFFEVSPSATVEKFSGWDTLSDEDKRTMLDL  179

Query  606  VK  611
            VK
Sbjct  180  VK  181



>ref|XP_010918778.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Elaeis guineensis]
Length=947

 Score =   195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 115/164 (70%), Gaps = 5/164 (3%)
 Frame = +3

Query  174  MVQATQFDGVMPMWNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSD  353
            MV ATQFDG MP WNH GCI KK  QIK+ DDVEG++ LRWEDQ+KIRKY+EGG   ++ 
Sbjct  1    MVTATQFDGFMPTWNHAGCIFKKGNQIKSVDDVEGIDLLRWEDQQKIRKYIEGGSVSTTA  60

Query  354  APTPAVMEYGVETSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSP  533
                   E  +E SQTSRA C+ CN+KIMKG VR+S+K +GQGAR LAWHH  CF+E SP
Sbjct  61   VSND---ECTIEVSQTSRAACRRCNQKIMKGMVRVSTKPEGQGARGLAWHHVNCFIEMSP  117

Query  534  VTQVDKLLGWDSLPASDQAVVSSLVK--NSTVKVAKEEPLXEST  659
             T ++K+ GWDSL   D+  V++LVK   S    A+E+ L + T
Sbjct  118  STIIEKMSGWDSLSPEDKVTVTALVKKDKSNKNTAQEQQLSKGT  161



>ref|NP_001288538.1| poly [ADP-ribose] polymerase 1 [Zea mays]
 sp|Q9ZSV1.1|PARP1_MAIZE RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Zea mays]
 gb|AAC79704.1| poly(ADP)-ribose polymerase [Zea mays]
 tpg|DAA39432.1| TPA: poly [ADP-ribose] polymerase 1(NAD(+) ADP-ribosyltransferase 
1) [Zea mays]
Length=980

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS R+SCK+C+SPI K+ LRLGKMVQA+QFDG MPMWNH  CI  K 
Sbjct  1    MAAPPKAWKAEYAKSGRASCKSCRSPIAKDQLRLGKMVQASQFDGFMPMWNHARCIFSKK  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG+++LRW+DQEKIR YV     G+S    P   +  +E + ++R +C+ C
Sbjct  61   NQIKSVDDVEGIDALRWDDQEKIRNYVGSASAGTSSTAAPP-EKCTIEIAPSARTSCRRC  119

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            +EKI KG VR+S+K + +G + + W+HA CF E SP   V+K  GWD+L   D+  +  L
Sbjct  120  SEKITKGSVRLSAKLESEGPKGIPWYHANCFFEVSPSATVEKFSGWDTLSDEDKRTMLDL  179

Query  606  VK  611
            VK
Sbjct  180  VK  181



>ref|XP_008461881.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Cucumis 
melo]
Length=932

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 115/153 (75%), Gaps = 4/153 (3%)
 Frame = +3

Query  210  MWNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVE  389
            MWNH  CILKKAKQIK+ DDVEGL+SLRWEDQ+KIR+YV+     ++   TP  +EYG+E
Sbjct  1    MWNHAACILKKAKQIKSIDDVEGLDSLRWEDQQKIRQYVQDSAAAAAVVVTP--VEYGIE  58

Query  390  TSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDS  569
             SQT+RA+CKHC +KIMKGEVR+S+   G+G + LAW+HA C+ME+ P TQV+KL GW S
Sbjct  59   VSQTARASCKHCKQKIMKGEVRLSTALDGKGTKGLAWYHANCYMEQCPSTQVEKLAGWQS  118

Query  570  LPASDQAVVSSLVKNSTVKVAKEEPLXESTSTA  668
            LP SDQA VS LVK  +  V  EE   ++TS A
Sbjct  119  LPPSDQAAVSILVKKPSSAVKNEE--KQTTSKA  149



>ref|XP_006657714.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Oryza brachyantha]
Length=976

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 133/203 (66%), Gaps = 13/203 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCK+C+SPI K+ LRLGKMVQATQFDG MPMWNH  CIL K 
Sbjct  1    MAAPPKPWKAEYAKSGRSSCKSCRSPIGKDQLRLGKMVQATQFDGFMPMWNHASCILSKK  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK  DDVEG+++LRW+DQEKIR YV G     + +      +  +E ++++R  C+  
Sbjct  61   NQIKFVDDVEGIDTLRWDDQEKIRSYV-GSAPAMASSAGAISDKCTIEVAKSARTFCRRY  119

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             EKI KG VR+SSK +GQG     W+H  CF+E SP   V+K  GW+ L   D+  V  L
Sbjct  120  GEKITKGTVRVSSKLEGQG-----WYHTSCFLEMSPAANVEKFTGWEVLSHEDKGAVLDL  174

Query  606  VKNSTVKVAKEEPLXESTSTAGA  674
            VK       K+ P  E T++ G+
Sbjct  175  VK-------KDAPKTEQTTSKGS  190



>ref|XP_009398035.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=959

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 130/192 (68%), Gaps = 26/192 (14%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS RSSCKTCKSPID++ LRLGKMV ATQFDG MPMWNH GCI KK 
Sbjct  1    MANPPKPWKAEYAKSGRSSCKTCKSPIDRDQLRLGKMVAATQFDGYMPMWNHAGCIFKKQ  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG++ LRWEDQ+ IRKYVE    GSS + T    E  +E SQTSRATC+HC
Sbjct  61   NQIKSLDDVEGIDLLRWEDQKSIRKYVED---GSSTSTTVDNSECAIEVSQTSRATCRHC  117

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            ++KI KG VR+S+KA+GQGAR                       GWDSL   D+  +S+ 
Sbjct  118  SQKITKGTVRVSTKAEGQGAR-----------------------GWDSLSPQDKESLSAF  154

Query  606  VKNSTVKVAKEE  641
             +  T K  +++
Sbjct  155  SRKDTSKKTEDQ  166



>gb|EEC81908.1| hypothetical protein OsI_25738 [Oryza sativa Indica Group]
Length=977

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 135/203 (67%), Gaps = 13/203 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS RSSCK+C+SPI K+ LRLGKMVQATQFDG MPMWNH  CIL K 
Sbjct  1    MAAPPKAWKAEYAKSGRSSCKSCRSPIGKDQLRLGKMVQATQFDGFMPMWNHASCILSKK  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG+++LRW+DQEKIR YV G    ++ +      +  +E ++++R +C+ C
Sbjct  61   NQIKSVDDVEGIDTLRWDDQEKIRNYV-GSAPATASSAAAISDKCTIEVAKSARTSCRRC  119

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             EKI KG VR+SSK +GQG     W+HA CF+E SP   V+   GW+ L   D+  V  L
Sbjct  120  GEKITKGAVRVSSKLEGQG-----WYHASCFLEMSPAATVENFSGWEILSHEDKRAVLDL  174

Query  606  VKNSTVKVAKEEPLXESTSTAGA  674
            VK       K+ P    TS+ G+
Sbjct  175  VK-------KDAPSSGQTSSKGS  190



>ref|NP_001059453.1| Os07g0413700 [Oryza sativa Japonica Group]
 sp|Q7EYV7.1|PARP1_ORYSJ RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Oryza sativa Japonica 
Group]
 dbj|BAC84104.1| putative poly(ADP)-ribose polymerase [Oryza sativa Japonica Group]
 dbj|BAF21367.1| Os07g0413700 [Oryza sativa Japonica Group]
 gb|EEE67019.1| hypothetical protein OsJ_23951 [Oryza sativa Japonica Group]
Length=977

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 136/203 (67%), Gaps = 13/203 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS RSSCK+C+SPI K+ LRLGKMVQATQFDG+MPMWNH  CIL K 
Sbjct  1    MAAPPKAWKAEYAKSGRSSCKSCRSPIGKDQLRLGKMVQATQFDGLMPMWNHASCILSKK  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG+++LRW+DQEKIR YV G    ++ +      +  +E ++++R +C+ C
Sbjct  61   NQIKSVDDVEGIDTLRWDDQEKIRNYV-GSAPATASSAAAISDKCTIEVAKSARTSCRRC  119

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
             EKI KG VR+SSK +GQG     W+HA CF+E SP   V+   GW+ L   D+  V  L
Sbjct  120  GEKIKKGTVRVSSKLEGQG-----WYHASCFLEMSPAATVENFSGWEILSHEDKRAVLDL  174

Query  606  VKNSTVKVAKEEPLXESTSTAGA  674
            VK       K+ P    TS+ G+
Sbjct  175  VK-------KDAPSSGQTSSKGS  190



>ref|XP_003557295.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Brachypodium distachyon]
Length=975

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 131/185 (71%), Gaps = 6/185 (3%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+  K WK EYAKS RSSCK+CKSPI K+ LRLGKMVQ+TQFDG MP+WNH  CI+ K 
Sbjct  1    MAATPKAWKVEYAKSGRSSCKSCKSPIGKDALRLGKMVQSTQFDGFMPLWNHASCIISKK  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
             QIK+ DDVEG+++LRW+DQEKIR YV G    ++ +      +  +E +Q++RA+C+HC
Sbjct  61   NQIKSVDDVEGIDALRWDDQEKIRNYV-GNSSATASSKAAISDKCTIEVAQSARASCRHC  119

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            +EKI KG VR+S+K +GQG     W+H  CF+E SP   V+K+ GW++L   D+  +  +
Sbjct  120  SEKIAKGNVRVSAKVEGQG-----WYHVSCFLEMSPTATVEKIPGWEALSHEDKGAIHDV  174

Query  606  VKNST  620
            VK  T
Sbjct  175  VKKCT  179



>ref|XP_004959167.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Setaria italica]
Length=845

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 132/205 (64%), Gaps = 10/205 (5%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS R+SCK+C+SPI K+ LRLGKMVQATQFDG MPMWNH  CI  K 
Sbjct  1    MAAPPKAWKAEYAKSGRASCKSCRSPIAKDQLRLGKMVQATQFDGFMPMWNHARCIFGKK  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVE---GGGCGSSDAPTPAVMEYGVETSQTSRATC  416
             QIK+ DDVEG+++LRW+DQEKIR YVE        ++  P        ++ + ++R +C
Sbjct  61   NQIKSVDDVEGIDTLRWDDQEKIRNYVESASAATSSTATVPDKCT----IDVAPSARTSC  116

Query  417  KHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVV  596
            + C++KI KG VR+S+K +GQ ++ + W+H  CF+E S    V+K  GWD+L   D+  V
Sbjct  117  RRCSQKITKGTVRVSAKLEGQASKGIPWYHVNCFLEVSISATVEKFSGWDTLSDEDKRTV  176

Query  597  SSLVKNSTVKVAKEEPLXESTSTAG  671
              LVK     V   EP   S    G
Sbjct  177  LDLVKKD---VGHNEPTKGSKRKKG  198



>ref|XP_001769461.1| predicted protein [Physcomitrella patens]
 gb|EDQ65830.1| predicted protein [Physcomitrella patens]
Length=989

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 125/187 (67%), Gaps = 5/187 (3%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            +P KPWK+EYAKS R+SC+TC SPI K+  RL KMVQ+TQFDG+M  W+H GCI KK KQ
Sbjct  5    APQKPWKSEYAKSGRASCRTCSSPIAKDAFRLAKMVQSTQFDGMMAYWHHAGCIFKKKKQ  64

Query  252  IKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHCNE  431
            I   +DVEG ++LRWEDQ+ +RK++E    G ++    +  EY +E +++SR+TCK CNE
Sbjct  65   IHDWNDVEGADTLRWEDQQNLRKFIEAKTKGVNEDGDESSGEYAIENAKSSRSTCKSCNE  124

Query  432  KIMKGEVRISSKAKGQGARSLA----WHHAKCFMEKSPVT-QVDKLLGWDSLPASDQAVV  596
            KI KG+VRIS+     G R       W HAKCF+     +  +  L GWD+L + DQA V
Sbjct  125  KIDKGQVRISTMVAADGGRFRGKVPQWRHAKCFLSMGHFSGPLASLPGWDTLTSEDQAQV  184

Query  597  SSLVKNS  617
             +L K S
Sbjct  185  QTLAKPS  191



>tpg|DAA39431.1| TPA: hypothetical protein ZEAMMB73_927988 [Zea mays]
Length=969

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 122/182 (67%), Gaps = 12/182 (7%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS R+SCK+C+SPI K+ LRLGKMVQA+QFDG MPMWNH        
Sbjct  1    MAAPPKAWKAEYAKSGRASCKSCRSPIAKDQLRLGKMVQASQFDGFMPMWNHA-------  53

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
                + DDVEG+++LRW+DQEKIR YV     G+S    P   +  +E + ++R +C+ C
Sbjct  54   ----SVDDVEGIDALRWDDQEKIRNYVGSASAGTSSTAAPP-EKCTIEIAPSARTSCRRC  108

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            +EKI KG VR+S+K + +G + + W+HA CF E SP   V+K  GWD+L   D+  +  L
Sbjct  109  SEKITKGSVRLSAKLESEGPKGIPWYHANCFFEVSPSATVEKFSGWDTLSDEDKRTMLDL  168

Query  606  VK  611
            VK
Sbjct  169  VK  170



>emb|CAA10889.1| poly(ADP-ribose) polymerase [Zea mays]
Length=969

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 122/182 (67%), Gaps = 12/182 (7%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P K WKAEYAKS R+SCK+C+SPI K+ LRLGKMVQA+QFDG MPMWNH        
Sbjct  1    MAAPPKAWKAEYAKSGRASCKSCRSPIAKDQLRLGKMVQASQFDGFMPMWNHA-------  53

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
                + DDVEG+++LRW+DQEKIR YV     G+S    P   +  +E + ++R +C+ C
Sbjct  54   ----SVDDVEGIDALRWDDQEKIRNYVGSASAGTSSTAAPP-EKCTIEIAPSARTSCRRC  108

Query  426  NEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDSLPASDQAVVSSL  605
            +EKI KG VR+S+K + +G + + W+HA CF E SP   V+K  GWD+L   D+  +  L
Sbjct  109  SEKITKGSVRLSAKLESEGPKGIPWYHANCFFEVSPSATVEKFSGWDTLSDEDKRTMLDL  168

Query  606  VK  611
            VK
Sbjct  169  VK  170



>gb|EMT10595.1| Poly (ADP-ribose) polymerase 1 [Aegilops tauschii]
Length=552

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 125/201 (62%), Gaps = 25/201 (12%)
 Frame = +3

Query  69   ASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAK  248
            A P K WKAEYAKS RSSCK+CKSPI K+ LR GKMVQATQFDG MPMWNH  CIL K  
Sbjct  3    APPPKAWKAEYAKSGRSSCKSCKSPIAKDALRPGKMVQATQFDGFMPMWNHAKCILNKKN  62

Query  249  QIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVM-----EYGVETSQTSRAT  413
            QIK+ DDVEG+++LRW+DQEKIR Y       S+   T +       +  +E +Q++RA+
Sbjct  63   QIKSVDDVEGIDALRWDDQEKIRNYAANSSTTSTATATASSTAAISDKCAIEVAQSARAS  122

Query  414  CKHCNEKIMK---------------GEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVD  548
            C+ C+EKI K               G VR+SSK  GQG     W+H  CF+E SP   V+
Sbjct  123  CRRCSEKIAKGTLTKYKEILTFNTSGRVRVSSKLDGQG-----WYHVSCFLEMSPTASVE  177

Query  549  KLLGWDSLPASDQAVVSSLVK  611
            K  GW++L   D+  +  +VK
Sbjct  178  KFPGWETLSHDDRGAIIDVVK  198



>emb|CDY24761.1| BnaC04g13660D [Brassica napus]
Length=918

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 6/140 (4%)
 Frame = +3

Query  210  MWNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP------AV  371
            MW+H  CILKK KQIK+ DDVEGLESLRWEDQ+KIR+YVE G   ++ + +       A 
Sbjct  1    MWHHASCILKKTKQIKSADDVEGLESLRWEDQQKIRQYVESGAGNNTTSTSTASSGGNAK  60

Query  372  MEYGVETSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDK  551
            +EYG+E SQTSRA C+ C+EKI+KGEVR+ SK +G G + L WHHA+CF+E SP T++  
Sbjct  61   LEYGIEVSQTSRAGCRKCSEKILKGEVRVFSKPEGPGNKGLMWHHARCFLEMSPSTELKS  120

Query  552  LLGWDSLPASDQAVVSSLVK  611
            L GW S+P SDQ  +  LVK
Sbjct  121  LSGWGSIPDSDQEALLPLVK  140



>gb|EMS59386.1| Poly [ADP-ribose] polymerase 1 [Triticum urartu]
Length=605

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 126/201 (63%), Gaps = 25/201 (12%)
 Frame = +3

Query  69   ASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAK  248
            A P K WKAEYAKS RSSCK+CKSPI K+ LRLGKMVQATQFDG MPMWNH  CIL K  
Sbjct  3    APPPKAWKAEYAKSGRSSCKSCKSPIAKDALRLGKMVQATQFDGFMPMWNHAKCILNKKN  62

Query  249  QIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVM-----EYGVETSQTSRAT  413
            QIK+ DDVEG+++LRW+DQEKIR Y       S+   T +       +  +E +Q++R++
Sbjct  63   QIKSVDDVEGIDALRWDDQEKIRNYAANSSTTSTATATASSTAAIPDKCAIEVAQSARSS  122

Query  414  CKHCNEKIMK---------------GEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVD  548
            C+ C+ KI K               G VR+SSK  GQG     W+H  CF+E SP   V+
Sbjct  123  CRRCSVKIAKGTLTKYKEILTFNTSGRVRVSSKLDGQG-----WYHVSCFLEMSPTASVE  177

Query  549  KLLGWDSLPASDQAVVSSLVK  611
            K  GW++L   D+A +  +VK
Sbjct  178  KFPGWETLLHDDRAAIIDVVK  198



>gb|ADE76375.1| unknown [Picea sitchensis]
Length=395

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 132/220 (60%), Gaps = 22/220 (10%)
 Frame = +3

Query  66   MASPH---KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCIL  236
            M +P+   KPWK EYAKSSRSSCKTCK PI K +LR+ KMV A QF+GVMP+WNH  CIL
Sbjct  1    MENPNPTGKPWKVEYAKSSRSSCKTCKQPIGKGSLRIAKMVAARQFEGVMPIWNHVECIL  60

Query  237  KKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPA------VMEYGVETSQ  398
            K   Q +  DDVEGL+ L  EDQ+KI+KY EG   GS  APT A      + E  +E S+
Sbjct  61   KYPGQFRTIDDVEGLDILESEDQKKIKKYFEGLCEGS--APTNAYKAVEGIDESSIEKSK  118

Query  399  TSRATCKHCNEKIMKGEVRISSKAKGQG----ARSLAWHHAKCFME----KSPVTQVDKL  554
            +SRATCK CN+KI KGE+RIS+ A  +          W HAKCF+E     SP   ++ +
Sbjct  119  SSRATCKSCNQKIAKGEIRISTMADPENPWFRGTVAVWRHAKCFLEIGWWTSP---IENM  175

Query  555  LGWDSLPASDQAVVSSLVKNSTVKVAKEEPLXESTSTAGA  674
             GW+SL   D+  V SL          E    + TS  G+
Sbjct  176  SGWESLSPEDKHAVQSLANQYIQDTKHEAEEKQETSPQGS  215



>pdb|1V9X|A Chain A, Solution Structure Of The First Zn-Finger Domain Of 
Poly(Adp-Ribose) Polymerase-1
Length=114

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  57   GVKMASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCIL  236
            G   +S HKPW+AEYAKSSRSSCKTCKS I+KE  RLGK+VQ+T FDG+MPMWNH  CIL
Sbjct  1    GSSGSSGHKPWRAEYAKSSRSSCKTCKSVINKENFRLGKLVQSTHFDGIMPMWNHASCIL  60

Query  237  KKAKQIKATDDVEGLESLRWEDQEKIRKYVEGG  335
            KK KQIK+ DDVEG+ESLRWEDQ+KIRKYVE G
Sbjct  61   KKTKQIKSVDDVEGIESLRWEDQQKIRKYVESG  93



>ref|XP_002973881.1| hypothetical protein SELMODRAFT_100128 [Selaginella moellendorffii]
 gb|EFJ24836.1| hypothetical protein SELMODRAFT_100128 [Selaginella moellendorffii]
Length=969

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 121/188 (64%), Gaps = 11/188 (6%)
 Frame = +3

Query  75   PHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQI  254
            P  PW+AEYAKSSR++C  C   IDK+ LRLG+MV++ +FDG +P+W+H  CI +K   I
Sbjct  3    PDHPWRAEYAKSSRAACGACHDKIDKDELRLGRMVESPKFDGWIPVWHHYSCIARKKNTI  62

Query  255  KATDDVEGLESLRWEDQEKIRKYVEGGGCGSSD---------APTPAVMEYGVETSQTSR  407
             + +DV+G ++LRW DQ+K+RKY+EG   G+ +             +  E+ +E ++ SR
Sbjct  63   SSIEDVDGFDNLRWGDQKKLRKYIEGDEAGALEDNEEEKIEQEEETSSFEHTIEIAKASR  122

Query  408  ATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQ-VDKLLGWDSLPASD  584
            A C+ C EK++KGE RIS+  + +  RS  + HAKCF+E     Q +++L GWD+L  S+
Sbjct  123  AICRVCKEKLVKGEARIST-VENEKYRSPTFRHAKCFVEFFSWDQPIEELDGWDTLDESE  181

Query  585  QAVVSSLV  608
            Q  +  ++
Sbjct  182  QKCLRPVL  189



>gb|KHN10726.1| Poly [ADP-ribose] polymerase 1 [Glycine soja]
Length=1526

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 99/155 (64%), Gaps = 15/155 (10%)
 Frame = +3

Query  213  WNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGG----------CGSSDAPT  362
            WN    + ++ ++I   +DVE LESLRWEDQ+KIRKY+E GG             SD+ T
Sbjct  586  WNS---LSREMREIALLEDVENLESLRWEDQQKIRKYIESGGGGGSSSGGGSAAKSDSKT  642

Query  363  PAVMEYGVETSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQ  542
                + G+E SQ SRATCK C +KI+KGEVRIS+K  GQGA+ LAWHHAKC ME SP   
Sbjct  643  VKDTKCGIEVSQNSRATCKDCGQKIIKGEVRISTKPGGQGAKGLAWHHAKCLMELSPSID  702

Query  543  VDKLLGWDSLPASDQAVVSSLVK--NSTVKVAKEE  641
            V KL GW++L +SDQ+ VS   K   S  K+  EE
Sbjct  703  VYKLSGWNNLSSSDQSAVSDFAKKGGSDTKIETEE  737



>ref|XP_002969183.1| hypothetical protein SELMODRAFT_90144 [Selaginella moellendorffii]
 gb|EFJ30299.1| hypothetical protein SELMODRAFT_90144 [Selaginella moellendorffii]
Length=965

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 118/183 (64%), Gaps = 6/183 (3%)
 Frame = +3

Query  75   PHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQI  254
            P  PW+AEYAKSSR++C  C   IDK+ LRLG+MV++ +FDG +P+W+H  CI  K   I
Sbjct  3    PDHPWRAEYAKSSRAACGACHEKIDKDELRLGRMVESPKFDGWIPVWHHYSCIAVKKNTI  62

Query  255  KATDDVEGLESLRWEDQEKIRKYV----EGGGCGSSDAPTPAVMEYGVETSQTSRATCKH  422
             + +DV+G ++LRW DQ+K+RKY+    E G   +      +  E+ +E ++ SRA C+ 
Sbjct  63   SSIEDVDGFDNLRWGDQKKLRKYIEGKKEKGKQKTEQEEETSSFEHTIEIAKASRAICRV  122

Query  423  CNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQ-VDKLLGWDSLPASDQAVVS  599
            C EK++KGE RIS+  + +  RS  + HAKCF+E     Q +++L GWD+L  S+Q  + 
Sbjct  123  CKEKLVKGEARIST-VENEKYRSPTFRHAKCFVEFFAWDQPIEELDGWDTLDESEQKCLR  181

Query  600  SLV  608
             ++
Sbjct  182  PVL  184



>ref|XP_007050355.1| Poly(ADP-ribose) polymerase 2, putative [Theobroma cacao]
 gb|EOX94512.1| Poly(ADP-ribose) polymerase 2, putative [Theobroma cacao]
Length=124

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA+P KPWKAEYAKS+R SCKT ++ IDKE  RL KM  ATQFD  MPMW+H  C+ +KA
Sbjct  1    MANPPKPWKAEYAKSARLSCKTYRNTIDKEVFRLVKMAPATQFDAFMPMWSHANCVPRKA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVME  377
             QIK+ DDVEG+ESLRWEDQ+++R YVE  G  ++ A T   M+
Sbjct  61   NQIKSIDDVEGIESLRWEDQQRVRNYVEDCGPANTKAVTLTAMD  104



>ref|XP_002459755.1| hypothetical protein SORBIDRAFT_02g009900 [Sorghum bicolor]
 gb|EER96276.1| hypothetical protein SORBIDRAFT_02g009900 [Sorghum bicolor]
Length=931

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = +3

Query  210  MWNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVE  389
            MWNH  CI  K  QIK+ DDVEG+++LRW+DQEKIR Y+ G    ++ +   A  +  +E
Sbjct  1    MWNHARCIFSKKNQIKSVDDVEGIDALRWDDQEKIRNYI-GSASAATSSTAAAPDKCTIE  59

Query  390  TSQTSRATCKHCNEKIMKGEVRISSKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGWDS  569
             + ++R +C+ C+EKI KG VR+S+K + QG++ + W+HA CF E SP   V+K  GWD+
Sbjct  60   IAPSARTSCRRCSEKIAKGSVRLSAKLESQGSKGIPWYHANCFFEVSPSATVEKFSGWDT  119

Query  570  LPASDQAVVSSLVK  611
            L   D+  V  LVK
Sbjct  120  LSDEDKRTVLDLVK  133



>emb|CAA36917.1| unnamed protein product [Gallus gallus]
Length=1011

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 19/190 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            KP++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+A+ +  
Sbjct  7    KPYRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMFDGKVPHWHHYSCFWKRARIVSH  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQTSRATC  416
            T D++G   LRWEDQEKI+K +E G        T         ++ ++  E ++++R+TC
Sbjct  67   T-DIDGFPELRWEDQEKIKKAIETGALQEEKGGTRKEVGKAEKSLTDFAAEYAKSNRSTC  125

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKLLGWD  566
            K C +KI KG++RIS K     K Q      W+H  CF+ +       P     +LLG+ 
Sbjct  126  KGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAYGATQLLGFS  185

Query  567  SLPASDQAVV  596
             L A D+  +
Sbjct  186  ILKAEDKETL  195



>sp|P26446.2|PARP1_CHICK RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Gallus 
gallus]
Length=1011

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 19/190 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            KP++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+A+ +  
Sbjct  7    KPYRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMFDGKVPHWHHYSCFWKRARIVSH  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQTSRATC  416
            T D++G   LRWEDQEKI+K +E G        T         ++ ++  E ++++R+TC
Sbjct  67   T-DIDGFPELRWEDQEKIKKAIETGALQEEKGGTRKEVGKAEKSLTDFAAEYAKSNRSTC  125

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKLLGWD  566
            K C +KI KG++RIS K     K Q      W+H  CF+ +       P     +LLG+ 
Sbjct  126  KGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAYGATQLLGFS  185

Query  567  SLPASDQAVV  596
             L A D+  +
Sbjct  186  ILKAEDKETL  195



>ref|XP_005817490.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Xiphophorus 
maculatus]
Length=207

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 21/188 (11%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCI-LKKAKQIK  257
            K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  L+ A Q  
Sbjct  8    KLYKAEYAKSGRASCKKCKDSIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWLRAAAQ--  65

Query  258  ATDDVEGLESLRWEDQEKIRKYVEGGGC-----GSSDAPTPA---VMEYGVETSQTSRAT  413
            +T D+ G   LRWEDQEK++K +E GG      GS  +       + ++ VE ++++R+T
Sbjct  66   STADIAGFSDLRWEDQEKVKKAIESGGAVGIGKGSQKSAAKGEKTLNDFAVEYAKSNRST  125

Query  414  CKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGW  563
            CK C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+
Sbjct  126  CKGCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFRPECNAAQLKGF  185

Query  564  DSLPASDQ  587
            ++L A DQ
Sbjct  186  NALRAEDQ  193



>ref|XP_003971725.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Takifugu rubripes]
Length=1013

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 111/186 (60%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYKAEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-AAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSRATCK  419
            T D++G   LRWEDQEKI+K VE GG   G +D+ + A     + E+ VE ++++R+TCK
Sbjct  67   TSDIDGFSGLRWEDQEKIKKAVESGGATGGGTDSKSGAKEEKTLNEFAVEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME------KSPVTQVDKLLGWDS  569
             C +KI K ++R+S K+    K Q      W+H  CF+         P     +L G+ +
Sbjct  127  GCEQKIEKDQIRVSKKSVDPEKPQLGLIDRWYHTACFVSWREELVFKPEYNASQLKGFSN  186

Query  570  LPASDQ  587
            L A D+
Sbjct  187  LRAEDK  192



>ref|XP_007253978.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Astyanax mexicanus]
Length=1024

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 110/190 (58%), Gaps = 18/190 (9%)
 Frame = +3

Query  69   ASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAK  248
            A   K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C   +A 
Sbjct  4    AQDDKRYKAEYAKSGRASCKKCKDNIAKDSLRMAIMVQSPMFDGKVPRWHHFSCFWHQA-  62

Query  249  QIKATDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSR  407
             ++AT D+ G   LRWEDQEK++K +EGGG     SD    A     + ++ VE ++++R
Sbjct  63   AVQATSDISGFTDLRWEDQEKVKKAIEGGGAPGAKSDQKGAAKGEKTLNDFAVEYAKSNR  122

Query  408  ATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLL  557
            +TCK C++KI K ++R+S K     K Q      W+H  CF+ +       P     +L 
Sbjct  123  STCKGCDQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTSCFVSRREELVFKPEYSAAQLK  182

Query  558  GWDSLPASDQ  587
            G+ +L A D+
Sbjct  183  GFAALRAEDK  192



>ref|XP_005893451.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Bos 
mutus]
Length=239

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 104/192 (54%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKVGFS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I   D +VEG   LRW+DQ+ I+K  E GG       G        ++++G   ++++R+
Sbjct  64   IWHPDVEVEGFSELRWDDQQTIKKMAETGGATGKGQDGVGSKTEKTLIDFGAGYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H KCF++K       P     +L+G
Sbjct  124  TCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQLMG  183

Query  561  WDSLPASDQAVV  596
            +  L A DQ  +
Sbjct  184  FSVLTAEDQETL  195



>ref|XP_006046141.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Bubalus 
bubalis]
Length=1013

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 105/192 (55%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  KP++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKPYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKVGYS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I   D +VEG   LRW+DQ+ I+K  E GG       G        ++++G   ++++R+
Sbjct  64   IWHPDVEVEGFSELRWDDQQTIKKMAETGGATGKGQDGVGSKTEKTLIDFGAGYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H KCF++K       P     +L+G
Sbjct  124  TCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQLMG  183

Query  561  WDSLPASDQAVV  596
            +  L A DQ  +
Sbjct  184  FSVLTAEDQETL  195



>ref|XP_007905391.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Callorhinchus milii]
Length=1007

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 105/186 (56%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K +KAEYAKS R+SCK C   I KE LRL  MVQ+  FDG +P W+H  C  KKA+ +  
Sbjct  5    KLYKAEYAKSGRASCKKCGENISKEALRLAIMVQSPMFDGKIPHWHHYACFWKKARVV-V  63

Query  261  TDDVEGLESLRWEDQEKIRKYVE-------GGGCGSSDAPTPAVMEYGVETSQTSRATCK  419
              D++GL  LRWEDQEKIRK +E        GG    D     + ++ VE ++++R+TCK
Sbjct  64   QGDIDGLTDLRWEDQEKIRKSIETGGAPGGKGGAQGGDGKGQTLSDFSVEYAKSNRSTCK  123

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKLLGWDS  569
             C++KI K  VRIS K     K Q      W+H  CF+ K       PV    +L+G+ +
Sbjct  124  GCSKKIDKDTVRISKKMIDVEKPQLGMIDRWYHTDCFVAKRAELGFLPVYSATQLMGFQT  183

Query  570  LPASDQ  587
            L   D+
Sbjct  184  LAGEDR  189



>ref|XP_006625727.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Lepisosteus oculatus]
Length=1007

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 108/185 (58%), Gaps = 17/185 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++   +++
Sbjct  8    KLYKAEYAKSGRASCKKCKDNIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRV-SVQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVE-GGGCGSSDAPTPA-----VMEYGVETSQTSRATCKH  422
              D+ G   LRWEDQEK++K +E GG  G  DA   A     + ++ VE ++++R+TCK 
Sbjct  67   PGDISGFTDLRWEDQEKVKKAIETGGATGKGDAKGGAKGEKTLNDFAVEYAKSNRSTCKG  126

Query  423  CNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSL  572
            CNEKI K ++R+S K     K Q      W+H  CF+ +       P     +L G+ +L
Sbjct  127  CNEKIEKDQIRVSKKTIDPEKPQLGLIDRWYHTGCFVSRREELDFKPAYCASQLKGFAAL  186

Query  573  PASDQ  587
             A D+
Sbjct  187  RAEDK  191



>ref|NP_990594.2| poly [ADP-ribose] polymerase 1 [Gallus gallus]
Length=1011

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 19/190 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            KP++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+A+ +  
Sbjct  7    KPYRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMFDGKVPHWHHYSCFWKRARIVSH  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQTSRATC  416
            T D++G   LRWEDQEKI+K +E GG                 ++ ++  E ++++R+TC
Sbjct  67   T-DIDGFPELRWEDQEKIKKAIETGGPAGGKGGDQEGGGKAEKSLTDFAAEYAKSNRSTC  125

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKLLGWD  566
            K C +KI KG++RIS K     K Q      W+H  CF+ +       P     +LLG+ 
Sbjct  126  KGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAYGATQLLGFS  185

Query  567  SLPASDQAVV  596
             L A D+  +
Sbjct  186  ILKAEDKETL  195



>gb|AAI12502.1| PARP1 protein [Bos taurus]
Length=232

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 104/195 (53%), Gaps = 20/195 (10%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKVGFS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC---------GSSDAPTPAVMEYGVETSQT  401
            I   D +VEG   LRW+DQ+ I+K  E GG          G        ++++G   +++
Sbjct  64   IWHPDVEVEGFSELRWDDQQTIKKMAETGGATDVSGKGQDGVGSKTEKTLIDFGAGYAKS  123

Query  402  SRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDK  551
            +R+TCK C EKI KG+VR+S K     K Q      W+H KCF++K       P     +
Sbjct  124  NRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQ  183

Query  552  LLGWDSLPASDQAVV  596
            L+G+  L A DQ  +
Sbjct  184  LMGFSVLTAEDQETL  198



>ref|XP_006046140.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bubalus 
bubalis]
Length=1016

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 105/195 (54%), Gaps = 20/195 (10%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  KP++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKPYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKVGYS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC---------GSSDAPTPAVMEYGVETSQT  401
            I   D +VEG   LRW+DQ+ I+K  E GG          G        ++++G   +++
Sbjct  64   IWHPDVEVEGFSELRWDDQQTIKKMAETGGATDVSGKGQDGVGSKTEKTLIDFGAGYAKS  123

Query  402  SRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDK  551
            +R+TCK C EKI KG+VR+S K     K Q      W+H KCF++K       P     +
Sbjct  124  NRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQ  183

Query  552  LLGWDSLPASDQAVV  596
            L+G+  L A DQ  +
Sbjct  184  LMGFSVLTAEDQETL  198



>ref|XP_007438803.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Python bivittatus]
Length=213

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 109/196 (56%), Gaps = 20/196 (10%)
 Frame = +3

Query  66   MASP-HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKK  242
            MA P  K ++AEYAKS R+SCK CK  I K++LRL  MVQ+  FDG +P W+H  C  K+
Sbjct  1    MAEPAEKLYRAEYAKSGRASCKKCKDNIAKDSLRLAIMVQSPMFDGKVPHWHHYSCFWKR  60

Query  243  AKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQ  398
            A Q+ +  D++G   LRWEDQEKI+K +E GG  +              ++ ++  E ++
Sbjct  61   A-QLLSHADLDGFSELRWEDQEKIKKSIESGGAAAGKGSGQEEGSKREKSLNDFAAEYAK  119

Query  399  TSRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVD  548
            ++R+TCK C +KI KG++RIS K     K Q      W+H  CF          P     
Sbjct  120  SNRSTCKGCEQKIEKGQIRISKKMVLSEKPQLGMIDNWYHLACFSSHRTDLGFLPTFSAS  179

Query  549  KLLGWDSLPASDQAVV  596
            +L G++ L A D+  +
Sbjct  180  QLQGFELLKAEDKETL  195



>ref|XP_005289622.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Chrysemys 
picta bellii]
Length=1011

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 107/196 (55%), Gaps = 20/196 (10%)
 Frame = +3

Query  66   MASP-HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKK  242
            MA P  K ++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+
Sbjct  1    MAEPADKLYRAEYAKSGRASCKKCGESIAKDSLRLAIMVQSPMFDGKVPHWHHYTCFWKR  60

Query  243  AKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQ  398
            A+ +    DV+G   LRWEDQEKI+K +E GG  +              ++ ++  E ++
Sbjct  61   ARLVSHA-DVDGFPELRWEDQEKIKKAIETGGVAAGKGTDQEGGGKAEKSLNDFAAEYAK  119

Query  399  TSRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVD  548
            ++R+TCK C +KI KG++RIS K     K Q      W+H  CF+         P     
Sbjct  120  SNRSTCKGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDCFVSHRAELGFLPAFGAS  179

Query  549  KLLGWDSLPASDQAVV  596
            +L G+  L A D+  +
Sbjct  180  QLQGFGMLKAEDKEAL  195



>ref|XP_004013685.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ovis aries]
Length=1013

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 105/192 (55%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W+H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWHHLSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I   D +VEG   LRW+DQ+KI+K  E GG       G        ++++G   ++++R+
Sbjct  64   IWHPDVEVEGFSELRWDDQQKIKKMAETGGATGKGQDGVGSKTEKTLIDFGAGYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++K       P     +L+G
Sbjct  124  TCKSCMEKIEKGQVRLSKKVVYPDKPQLGMVDCWYHPNCFVQKREELGFRPEFSASQLMG  183

Query  561  WDSLPASDQAVV  596
            +  L A DQ  +
Sbjct  184  FSLLTAEDQETL  195



>ref|XP_006268817.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Alligator mississippiensis]
Length=1011

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 107/193 (55%), Gaps = 20/193 (10%)
 Frame = +3

Query  66   MASP-HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKK  242
            MA P  K ++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+
Sbjct  1    MAEPADKLYRAEYAKSGRASCKKCGESIAKDSLRLAIMVQSPMFDGKVPHWHHYTCFWKR  60

Query  243  AKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQ  398
            A+ I +  D++G   LRWEDQEKI+K +E GG  +              ++ ++ VE ++
Sbjct  61   AR-ITSHADIDGFPELRWEDQEKIKKTIEAGGPATGKGGDQEGGGKAEKSLHDFAVEYAK  119

Query  399  TSRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVD  548
            ++R+TCK C  KI K ++RIS K     K Q      W+H  CF+ +       P     
Sbjct  120  SNRSTCKGCELKIEKSQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAFGAS  179

Query  549  KLLGWDSLPASDQ  587
            +L G+  L A D+
Sbjct  180  QLQGFGILVAEDK  192



>ref|XP_005523343.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Pseudopodoces 
humilis]
Length=1011

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 110/196 (56%), Gaps = 20/196 (10%)
 Frame = +3

Query  66   MASP-HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKK  242
            MA P  K ++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+
Sbjct  1    MAEPAEKLYRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMFDGKVPHWHHYSCFWKR  60

Query  243  AKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQ  398
            A+ +  T D++G   LRWEDQEKI+K +E GG G               ++ ++  E ++
Sbjct  61   ARIVSHT-DIDGFPELRWEDQEKIKKSIETGGPGGGKGGEQEGGGKAEKSLNDFAAEYAK  119

Query  399  TSRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVD  548
            ++R+TCK C +KI KG++RIS K     K Q      W+H  CF+ +       P     
Sbjct  120  SNRSTCKGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAYGAT  179

Query  549  KLLGWDSLPASDQAVV  596
            +LLG+  L A D+  +
Sbjct  180  QLLGFSILKAEDKETL  195



>ref|XP_005690591.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Capra hircus]
Length=1013

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 105/192 (55%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W+H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWHHLSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I   D +VEG   LRW+DQ+KI+K  + GG       G        ++++G   ++++R+
Sbjct  64   IWHPDVEVEGFSELRWDDQQKIKKMAKTGGATGKGQDGVGSKTEKTLIDFGAGYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++K       P     +L+G
Sbjct  124  TCKSCMEKIEKGQVRLSKKVVYPDKPQLGMVDCWYHPNCFIQKREELGFRPEFSASQLMG  183

Query  561  WDSLPASDQAVV  596
            +  L A DQ  +
Sbjct  184  FSLLTAEDQETL  195



>ref|XP_008285170.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Stegastes partitus]
Length=1007

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 109/186 (59%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYRAEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRAAA-QS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSRATCK  419
            T D+ G   LRWEDQEK++K +E GG   G  D  + A     + ++ VE ++++R+TCK
Sbjct  67   TADIAGYSDLRWEDQEKVKKAIESGGAAGGKGDQKSGAKGEKTLNDFAVEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+++
Sbjct  127  GCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKPEYNAAQLKGFNA  186

Query  570  LPASDQ  587
            L A D+
Sbjct  187  LRAEDK  192



>ref|XP_007552911.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Poecilia formosa]
Length=1015

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 21/188 (11%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCI-LKKAKQIK  257
            K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  L+ A Q  
Sbjct  8    KLYKAEYAKSGRASCKKCKDSIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWLRAAPQ--  65

Query  258  ATDDVEGLESLRWEDQEKIRKYVEGGGC-----GSSDAPTPA---VMEYGVETSQTSRAT  413
            +T D+ G   LRWEDQEK++K +E GG      GS  +       + ++ VE ++++R+T
Sbjct  66   STADIAGFSDLRWEDQEKVKKAIESGGAVGIGKGSQKSAAKGEKTLNDFAVEYAKSNRST  125

Query  414  CKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGW  563
            CK C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+
Sbjct  126  CKGCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFRPEYGAAQLKGF  185

Query  564  DSLPASDQ  587
            ++L A DQ
Sbjct  186  NALRAEDQ  193



>ref|XP_004210069.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Hydra 
vulgaris]
Length=568

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 107/185 (58%), Gaps = 23/185 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+ AEYAKS R+ CK+CK  I K++LR+ KMVQ+  FDG +P W H  C  KK K +  +
Sbjct  206  PYNAEYAKSGRAGCKSCKCNIGKDSLRIAKMVQSPHFDGKIPQWYHYSCFFKKFKPLNVS  265

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSS----DAPTPAVM--EYGVETSQTSRATCKHC  425
             D++  +SLRW+DQEK+R+ +   GC       D P+ + +  ++ +E +++ RA C+ C
Sbjct  266  -DIKNFDSLRWDDQEKLREQI---GCPQKKDVVDGPSNSTVNKDFCIEYAKSGRAKCRKC  321

Query  426  NEKIMKGEVRI-----SSKAKGQGARSLAWHHAKCF------MEKSPVTQVDKLLGWDSL  572
             EKI K  +RI     S ++K +G     W+H KCF      +E   +T  +++ GW  L
Sbjct  322  EEKIEKDIIRIAKIMESEESKFKGLIPF-WYHVKCFALSKSELEAQNLTS-NEIDGWGEL  379

Query  573  PASDQ  587
               DQ
Sbjct  380  SEEDQ  384



>ref|XP_005216853.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bos taurus]
Length=1013

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 104/192 (54%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKVGFS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I   D +VEG   LRW+DQ+ I+K  E GG       G        ++++G   ++++R+
Sbjct  64   IWHPDVEVEGFSELRWDDQQTIKKMAETGGATGKGQDGVGSKTEKTLIDFGAGYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H KCF++K       P     +L+G
Sbjct  124  TCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQLMG  183

Query  561  WDSLPASDQAVV  596
            +  L A DQ  +
Sbjct  184  FSVLTAEDQETL  195



>ref|XP_005523344.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Pseudopodoces 
humilis]
Length=1009

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 110/194 (57%), Gaps = 18/194 (9%)
 Frame = +3

Query  66   MASP-HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKK  242
            MA P  K ++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+
Sbjct  1    MAEPAEKLYRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMFDGKVPHWHHYSCFWKR  60

Query  243  AKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT------PAVMEYGVETSQTS  404
            A+ +  T D++G   LRWEDQEKI+K +E GG G             ++ ++  E ++++
Sbjct  61   ARIVSHT-DIDGFPELRWEDQEKIKKSIETGGPGGGGEQEGGGKAEKSLNDFAAEYAKSN  119

Query  405  RATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKL  554
            R+TCK C +KI KG++RIS K     K Q      W+H  CF+ +       P     +L
Sbjct  120  RSTCKGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAYGATQL  179

Query  555  LGWDSLPASDQAVV  596
            LG+  L A D+  +
Sbjct  180  LGFSILKAEDKETL  193



>ref|XP_006016655.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Alligator sinensis]
Length=1049

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 104/187 (56%), Gaps = 19/187 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+A+ I +
Sbjct  45   KLYRAEYAKSGRASCKKCGESIAKDSLRLAIMVQSPMFDGKVPHWHHYTCFWKRAR-ITS  103

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQTSRATC  416
              D++G   LRWEDQEKI+K +E GG  +              ++ ++ VE ++++R+TC
Sbjct  104  HADIDGFPELRWEDQEKIKKTIEAGGPATGKGGDQEGGGKAEKSLHDFAVEYAKSNRSTC  163

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKLLGWD  566
            K C  KI K ++RIS K     K Q      W+H  CF+ +       P     +L G+ 
Sbjct  164  KGCELKIEKSQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAFGASQLQGFG  223

Query  567  SLPASDQ  587
             L A D+
Sbjct  224  ILVAEDK  230



>ref|XP_005690590.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Capra hircus]
Length=1016

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 105/195 (54%), Gaps = 20/195 (10%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W+H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWHHLSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC---------GSSDAPTPAVMEYGVETSQT  401
            I   D +VEG   LRW+DQ+KI+K  + GG          G        ++++G   +++
Sbjct  64   IWHPDVEVEGFSELRWDDQQKIKKMAKTGGATDVSGKGQDGVGSKTEKTLIDFGAGYAKS  123

Query  402  SRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDK  551
            +R+TCK C EKI KG+VR+S K     K Q      W+H  CF++K       P     +
Sbjct  124  NRSTCKSCMEKIEKGQVRLSKKVVYPDKPQLGMVDCWYHPNCFIQKREELGFRPEFSASQ  183

Query  552  LLGWDSLPASDQAVV  596
            L+G+  L A DQ  +
Sbjct  184  LMGFSLLTAEDQETL  198



>ref|XP_006812383.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Saccoglossus 
kowalevskii]
Length=1004

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 100/178 (56%), Gaps = 19/178 (11%)
 Frame = +3

Query  66   MASPHK--PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILK  239
            MA  H   P+KAEYAKSSR+SCK CK  I KE+LRL KMVQ+  FDG MP W H  C  K
Sbjct  1    MADEHHDYPFKAEYAKSSRASCKFCKGSISKESLRLAKMVQSPHFDGKMPNWFHYSCFWK  60

Query  240  KAKQIKATDDVEGLESLRWEDQEKIRKYVEG------GGCGSSDAPTPAVMEYGVETSQT  401
            + K   +  +  GLE+LRW+DQ+KI+  + G       G G  D       E+ +  +++
Sbjct  61   RNKAT-SHGEFGGLETLRWDDQQKIKDKIAGKDSGATKGEGDGDDTGSLGDEFSLGYAKS  119

Query  402  SRATCKHCNEKIMKGEVRIS----SKAKGQGARSLAWHHAKCFMEKSPVTQVDKLLGW  563
            +R+ C+ CNEKIMK   RI+       +G       WHH  CF EK     +D+ LGW
Sbjct  120  NRSVCRGCNEKIMKDTFRIARILMETQRGIHMAVEKWHHLDCFCEK-----LDE-LGW  171



>ref|XP_005454773.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Oreochromis 
niloticus]
Length=1012

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 106/184 (58%), Gaps = 16/184 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYRVEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-SAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPA-----VMEYGVETSQTSRATCKHC  425
            T D+ G   LRW+DQ+K++K +E GG    D    A     + ++ VE ++++R+TCK C
Sbjct  67   TADIAGFSDLRWDDQQKVKKAIESGGAAGGDQKGGAKGEKTLNDFAVEYAKSNRSTCKGC  126

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+++L 
Sbjct  127  EQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKPEYSAAQLKGFNALR  186

Query  576  ASDQ  587
            A D+
Sbjct  187  AEDK  190



>ref|XP_010851175.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Bison bison 
bison]
Length=1013

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 102/187 (55%), Gaps = 17/187 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W H  C  K    I   D
Sbjct  9    YRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKVGFSIWHPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +VEG   LRW+DQ+ I+K  E GG       G        ++++G   ++++R+TCK C
Sbjct  69   VEVEGFSELRWDDQQTIKKMAETGGATGKGQDGVGSKTEKTLIDFGAGYAKSNRSTCKSC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG+VR+S K     K Q      W+H KCF++K       P     +L+G+  L 
Sbjct  129  MEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQLMGFSVLT  188

Query  576  ASDQAVV  596
            A DQ  +
Sbjct  189  AEDQETL  195



>ref|XP_008396025.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Poecilia reticulata]
Length=1015

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 108/188 (57%), Gaps = 21/188 (11%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCI-LKKAKQIK  257
            K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  L+ A Q  
Sbjct  8    KLYKAEYAKSGRASCKKCKDSIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWLRAAPQ--  65

Query  258  ATDDVEGLESLRWEDQEKIRKYVEGGGC-----GSSDAPTPA---VMEYGVETSQTSRAT  413
            +T D+ G   LRW+DQEK++K +E GG      GS  +       + ++ VE ++++R+T
Sbjct  66   STADIAGFSDLRWDDQEKVKKAIESGGAVGIGKGSQKSAAKGEKTLNDFAVEYAKSNRST  125

Query  414  CKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGW  563
            CK C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+
Sbjct  126  CKGCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFRPEYGAAQLKGF  185

Query  564  DSLPASDQ  587
            ++L A DQ
Sbjct  186  NALRAEDQ  193



>gb|EQB78542.1| poly [ADP-ribose] polymerase 1 [Camelus ferus]
Length=1199

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 114/211 (54%), Gaps = 23/211 (11%)
 Frame = +3

Query  12   IAVTG-KQCSRERKGEGVKMA-SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQA  185
            +A +G + CS +R+    +MA S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+
Sbjct  93   VAASGSRSCSGKRR----RMAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQS  148

Query  186  TQFDGVMPMWNHGGCILKKAKQIKATD-DVEGLESLRWEDQEKIRKYVEGGGC------G  344
              FDG +P W H  C  K    I+  D +V+G   LRW+DQ+K++K  E GG       G
Sbjct  149  PMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDG  208

Query  345  SSDAPTPAVMEYGVETSQTSRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAK  512
            +S      + ++  E ++++R+TCK C EKI KG+VR+S K     K Q      W+H  
Sbjct  209  ASSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPN  268

Query  513  CFMEK------SPVTQVDKLLGWDSLPASDQ  587
            CF++        P     +  G+  L A D+
Sbjct  269  CFVQNREELGFRPEYSASQFKGFSLLSAEDK  299



>ref|XP_005914568.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Haplochromis 
burtoni]
Length=1012

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 106/184 (58%), Gaps = 16/184 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYRVEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-SAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPA-----VMEYGVETSQTSRATCKHC  425
            T D+ G   LRW+DQ+K++K +E GG    D    A     + ++ VE ++++R+TCK C
Sbjct  67   TADIAGFSDLRWDDQQKVKKAIESGGAAGGDQKGGAKGEKTLNDFAVEYAKSNRSTCKGC  126

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+++L 
Sbjct  127  EQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKPEYSAAQLKGFNALR  186

Query  576  ASDQ  587
            A D+
Sbjct  187  AEDK  190



>tpg|DAA21368.1| TPA: poly [ADP-ribose] polymerase 1 [Bos taurus]
Length=1016

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 104/195 (53%), Gaps = 20/195 (10%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKVGFS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC---------GSSDAPTPAVMEYGVETSQT  401
            I   D +VEG   LRW+DQ+ I+K  E GG          G        ++++G   +++
Sbjct  64   IWHPDVEVEGFSELRWDDQQTIKKMAETGGATDVSGKGQDGVGSKTEKTLIDFGAGYAKS  123

Query  402  SRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDK  551
            +R+TCK C EKI KG+VR+S K     K Q      W+H KCF++K       P     +
Sbjct  124  NRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQ  183

Query  552  LLGWDSLPASDQAVV  596
            L+G+  L A DQ  +
Sbjct  184  LMGFSVLTAEDQETL  198



>ref|XP_010576040.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Haliaeetus leucocephalus]
Length=1008

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 111/193 (58%), Gaps = 17/193 (9%)
 Frame = +3

Query  66   MASP-HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKK  242
            MA P  K ++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+
Sbjct  1    MAEPAEKLYRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMFDGKVPHWHHYSCFWKR  60

Query  243  AKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT-----PAVMEYGVETSQTSR  407
            A+ I +  D++G   LRWEDQEKI+K +E GG G  +         ++ ++  E ++++R
Sbjct  61   AR-IVSHADIDGFPELRWEDQEKIKKAIETGGPGGGEQEGSGKAEKSLNDFAAEYAKSNR  119

Query  408  ATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKLL  557
            +TCK C +KI KG++RIS K     K Q      W+H  CF+ +       P     +LL
Sbjct  120  STCKGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDCFVSRRAELGFLPAYGATQLL  179

Query  558  GWDSLPASDQAVV  596
            G+  L A D+  +
Sbjct  180  GFSILKAEDKETL  192



>ref|XP_005734478.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Pundamilia 
nyererei]
Length=1012

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 106/184 (58%), Gaps = 16/184 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYRVEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-SAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPA-----VMEYGVETSQTSRATCKHC  425
            T D+ G   LRW+DQ+K++K +E GG    D    A     + ++ VE ++++R+TCK C
Sbjct  67   TADIAGFSDLRWDDQQKVKKAIESGGAAGGDQKGGAKGEKTLNDFAVEYAKSNRSTCKGC  126

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+++L 
Sbjct  127  EQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKPEYSAAQLKGFNALR  186

Query  576  ASDQ  587
            A D+
Sbjct  187  AEDK  190



>ref|XP_003740601.1| PREDICTED: poly [ADP-ribose] polymerase-like [Metaseiulus occidentalis]
Length=973

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 119/213 (56%), Gaps = 24/213 (11%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            MA    P+K +YAKS R+SC++CKSPI K+ LRL  +VQ++ FDG M  W H  C   K 
Sbjct  1    MAEVDLPFKVDYAKSGRASCRSCKSPISKDDLRLASVVQSSSFDGKMTKWFHFACFFLKN  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDA----------PTPAVMEYGVETS  395
            K  ++T D++G  +++++DQ++I K V G G G++D              A +EY VE +
Sbjct  61   KP-RSTGDIDGFSNIKYDDQKRIEKKV-GSGGGTADLVGRKSVSAKEKKNATLEYSVEYA  118

Query  396  QTSRATCKHCNEKIMKGEVRISSKAKGQGARSLA------WHHAKCFMEKSPVTQ----V  545
            +TSR+TC+ C+  I K +VRI SK      R+LA      W+H +CF+      Q     
Sbjct  119  KTSRSTCRGCDMLIAKDQVRI-SKMVYDSERALAYGPYPGWYHVECFIANREQLQWFLPA  177

Query  546  DKLLGWDSLPASDQAVVSSLV-KNSTVKVAKEE  641
              L G+ SL   +Q ++   + K + VK + EE
Sbjct  178  QDLPGYKSLGIEEQKMLKEKIPKLAPVKRSAEE  210



>ref|XP_003216114.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Anolis carolinensis]
Length=1006

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 96/156 (62%), Gaps = 7/156 (4%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  KP++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+A+ 
Sbjct  4    SAEKPYRAEYAKSGRASCKKCGDNIAKDSLRLAIMVQSPMFDGKVPHWHHFSCFWKRARL  63

Query  252  IKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--PAVMEYGVETSQTSRATCKHC  425
            I    DV+G   LRWEDQEKI+K +E GG G+  A      + ++ V  ++++R+TCK C
Sbjct  64   ISHA-DVDGFSELRWEDQEKIKKSIEAGGAGTGKAGKTEKNLNDFAVGYAKSNRSTCKGC  122

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFM  521
             +KI KG +RIS K     K Q      W+H  CF+
Sbjct  123  EQKIEKGHIRISKKMVNPEKPQLGMIDNWYHTSCFI  158



>ref|XP_001763712.1| predicted protein [Physcomitrella patens]
 gb|EDQ71602.1| predicted protein [Physcomitrella patens]
Length=106

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            + S HKPWKAEYAKSSRSSC+ C  PI K+  RL K+  A QF+GVMP+WNH  C+ +  
Sbjct  5    IESAHKPWKAEYAKSSRSSCRACNKPIVKDAFRLAKVQTAHQFNGVMPLWNHASCVFQNE  64

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGC  341
             +IK+ ++++GLE LR  D + +RKY+EG  C
Sbjct  65   NEIKSLEEIDGLEDLRAGDLQNLRKYIEGLRC  96



>gb|ETE69570.1| Poly [ADP-ribose] polymerase 1 [Ophiophagus hannah]
Length=1334

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 111/196 (57%), Gaps = 20/196 (10%)
 Frame = +3

Query  66   MASP-HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKK  242
            MA P  K ++AEYAKS R+SCK CK  I K++LRL  MVQ+  FDG +P W+H  C  ++
Sbjct  1    MAEPVEKLYRAEYAKSGRASCKKCKENIAKDSLRLAIMVQSPMFDGKIPHWHHYSCFWER  60

Query  243  AKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQ  398
            A Q+ +  D++G   LRWEDQEKI+K++E GG  +              ++ ++  E ++
Sbjct  61   A-QLLSHADLDGFSELRWEDQEKIKKHIESGGAAAGKGGGQEGGGKREKSLNDFAAEYAK  119

Query  399  TSRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVD  548
            ++R+TCK C +KI KG++RIS K     K Q      W+H  CF  +       P     
Sbjct  120  SNRSTCKGCEQKIEKGQIRISKKMVLPEKPQLGMIDNWYHLACFSSRRTNLGFLPTFNAS  179

Query  549  KLLGWDSLPASDQAVV  596
            ++ G++ L A D+  +
Sbjct  180  QIQGFELLKAEDKETL  195



>ref|XP_004271024.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Orcinus orca]
Length=1013

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 101/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++AEYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRAEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKVQDGVGSKTEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF+E        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVENREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLAAEDK  192



>ref|XP_010851174.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bison bison 
bison]
Length=1016

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 102/190 (54%), Gaps = 20/190 (11%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK CK  I K+++R+  MVQ+  FDG +P W H  C  K    I   D
Sbjct  9    YRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKVGFSIWHPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC---------GSSDAPTPAVMEYGVETSQTSRATC  416
             +VEG   LRW+DQ+ I+K  E GG          G        ++++G   ++++R+TC
Sbjct  69   VEVEGFSELRWDDQQTIKKMAETGGATDVSGKGQDGVGSKTEKTLIDFGAGYAKSNRSTC  128

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWD  566
            K C EKI KG+VR+S K     K Q      W+H KCF++K       P     +L+G+ 
Sbjct  129  KSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQLMGFS  188

Query  567  SLPASDQAVV  596
             L A DQ  +
Sbjct  189  VLTAEDQETL  198



>ref|XP_007210559.1| hypothetical protein PRUPE_ppa014170mg [Prunus persica]
 gb|EMJ11758.1| hypothetical protein PRUPE_ppa014170mg [Prunus persica]
Length=82

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  174  MVQATQFDGVMPMWNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGG  338
            MV ATQFDG MPMWN   CI+KKAKQIK+TDDVEGLE LRWEDQ++IR YV+ GG
Sbjct  1    MVTATQFDGFMPMWNQADCIMKKAKQIKSTDDVEGLELLRWEDQKEIRNYVQSGG  55



>ref|XP_010732988.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Larimichthys crocea]
Length=1014

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 108/186 (58%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYKAEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-AAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSRATCK  419
            T D+ G   LRWEDQEK++K +E GG   G  D  + A     + ++ VE ++++R+TCK
Sbjct  67   TADIGGYSDLRWEDQEKVKKAIESGGATGGKGDQKSGAKGEKTLNDFAVEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C +KI K ++R+S K     K Q      W+H  CF+ +             +L G+++
Sbjct  127  GCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKSEYSAAQLKGFNA  186

Query  570  LPASDQ  587
            L A D+
Sbjct  187  LRAEDK  192



>ref|NP_001233650.1| poly [ADP-ribose] polymerase 1 [Cricetulus griseus]
 sp|Q9R152.3|PARP1_CRIGR RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Cricetulus 
griseus]
 gb|AAD45817.1|AF168781_1 poly ADP-ribose polymerase [Cricetulus griseus]
Length=1013

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 101/187 (54%), Gaps = 17/187 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+TCK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKSEKTLGDFAAEYAKSNRSTCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG+VR+S K     K Q      W+H  CF++        P     +L G+  L 
Sbjct  129  MEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPTCFVKNREELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQAVV  596
            A D+ V+
Sbjct  189  AEDKEVL  195



>ref|XP_009061157.1| hypothetical protein LOTGIDRAFT_206927 [Lottia gigantea]
 gb|ESO88129.1| hypothetical protein LOTGIDRAFT_206927 [Lottia gigantea]
Length=987

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+KAEYAKS RSSCK CK+ I K++LRL  MVQ+  FDG +P W H  C  ++A  ++  
Sbjct  8    PFKAEYAKSDRSSCKACKTKIGKDSLRLAVMVQSPHFDGKVPNWFHYSCFWRRAGDVEQV  67

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPA----VMEYGVETSQTSRATCKHCNE  431
            DD+ G  +LRWEDQ+K++  + G    + D         ++ +  E ++++R+ C+ C  
Sbjct  68   DDIHGYHTLRWEDQQKLKSRISGETTATDDVDGKIEEHDLLSFRTEYAKSNRSQCQSCRT  127

Query  432  KIMKGEVRISSKAKGQ---GARSLAWHHAKCFME  524
            KI +GEVRIS K       GA    W+H  CF++
Sbjct  128  KIDQGEVRISCKEVDDPKYGAVD-KWYHVDCFVQ  160



>gb|KFM63823.1| Poly [ADP-ribose] polymerase 1, partial [Stegodyphus mimosarum]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 106/183 (58%), Gaps = 13/183 (7%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+  EY+KSSR+SCK CK+ I+K+ LR+G MVQ+TQFDG  P+W+H  C  K   +   T
Sbjct  6    PYIIEYSKSSRASCKICKNKIEKDCLRMGVMVQSTQFDGKFPVWHHADCFFKDKDKKVKT  65

Query  264  D-DVEGLESLRWEDQEKIRKYV-EGGGCGSSDAPTPAVMEYGVETSQTSRATCKHCNEKI  437
              D+   +++RWEDQ+KI+  + E      +        E+ +E +++SR++C+ C EKI
Sbjct  66   TADIANFDNIRWEDQKKIKDQMDENAANNPTSEEATENSEFLIEYAKSSRSSCRDCGEKI  125

Query  438  MKGEVRI------SSKAKGQGARSLAWHHAKCFMEKSP----VTQVDKLLGWDSLPASDQ  587
             KGEVRI      S+ A+  G   L W HA CF++           ++L G+ +L   D+
Sbjct  126  KKGEVRIAKIDTKSTDAQRYGP-ILGWRHADCFVKNRQDLGFTEDAERLPGFKTLSDGDK  184

Query  588  AVV  596
             V+
Sbjct  185  EVI  187



>ref|XP_010990763.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelus dromedarius]
Length=1013

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 102/192 (53%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G+S      + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGASSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +  G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVQNREELGFRPEYSASQFKG  183

Query  561  WDSLPASDQAVV  596
            +  L A D+  +
Sbjct  184  FSLLSAEDKEAL  195



>ref|XP_006188179.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelus ferus]
Length=1013

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 102/192 (53%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G+S      + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGASSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +  G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVQNREELGFRPEYSASQFKG  183

Query  561  WDSLPASDQAVV  596
            +  L A D+  +
Sbjct  184  FSLLSAEDKEAL  195



>ref|XP_004578951.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ochotona princeps]
Length=930

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 103/192 (54%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSEKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+KI+K  E GG       G  +     + ++  E ++++R+
Sbjct  64   IRQPDVEVDGFSELRWDDQQKIKKTAEAGGVTGKGQDGIGNKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQAVV  596
            ++ L A D+  +
Sbjct  184  FNLLSAEDKEAL  195



>ref|XP_004313311.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1-like [Tursiops truncatus]
Length=1022

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGSKTEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF+E        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVENREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLAAEDK  192



>ref|XP_007464233.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Lipotes vexillifer]
Length=1013

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGSKTEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF+E        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVENREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLTAEDK  192



>gb|EFX75651.1| hypothetical protein DAPPUDRAFT_55885 [Daphnia pulex]
Length=1004

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 106/191 (55%), Gaps = 20/191 (10%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P++AEYAK+ R+SCK CK  I + TLRL  + QA +FDG M  W H  C  ++ +  K+ 
Sbjct  6    PFRAEYAKTGRASCKKCKENIPQGTLRLAVIFQAAKFDGKMVSWYHFDCFFERQRP-KSA  64

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSS-----DAPTPAVME----YGVETSQTSRATC  416
             D+E  + LRWEDQEKI + ++ G    S        T  V+E    + +E +++ RA C
Sbjct  65   GDIEHFDQLRWEDQEKINQMLKSGIAEPSKKGKGKGKTAKVVEPFSDFLIEYAKSGRAAC  124

Query  417  KHCNEKIMKGEVRISSK---AKG---QGARSLAWHHAKCFMEKSP----VTQVDKLLGWD  566
            + C EKI K E+RIS K    KG    G     W+H KCF E+      V+ VD + G+ 
Sbjct  125  RGCLEKIGKDELRISKKGYDTKGGMRHGQMLDMWYHVKCFKERREELEFVSGVDTIPGFK  184

Query  567  SLPASDQAVVS  599
             L A D+ V+S
Sbjct  185  DLTADDKKVLS  195



>ref|XP_011308727.1| PREDICTED: poly [ADP-ribose] polymerase [Fopius arisanus]
Length=989

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 107/198 (54%), Gaps = 24/198 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+  EYAKS R++CK CK+PI KE+LR+ K+VQ+   DG +P W H  C   KAK +K  
Sbjct  6    PFLVEYAKSGRAACKACKAPIIKESLRIAKIVQSPFHDGTLPHWYHEQCFWSKAK-VKTV  64

Query  264  DDVEGLESLRWEDQEKIRKYVE-------------GGGCGSSDAPTPAV-MEYGVETSQT  401
             D+  LE+L WEDQEKIR  ++              GG  S   P+  +  ++ VE +++
Sbjct  65   GDIGNLENLLWEDQEKIRSKIDSTDATDTVDPTDSSGGKQSRKRPSAKLHTDFSVEYAKS  124

Query  402  SRATCKHCNEKIMKGEVRISSK----AKGQGARSLA-WHHAKCFMEKSPVTQV----DKL  554
            +R+TC  C   I+KG +RIS K     KGQ    +  WHH  CF+      +     D +
Sbjct  125  NRSTCVGCEAPILKGSIRISKKDFESEKGQLLGGVPRWHHLDCFLNLRSSLEFYDSGDAI  184

Query  555  LGWDSLPASDQAVVSSLV  608
             G++SL   D+  + S +
Sbjct  185  PGFESLSKEDKKTLKSKI  202



>gb|EFA00829.1| hypothetical protein TcasGA2_TC003717 [Tribolium castaneum]
Length=956

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 105/194 (54%), Gaps = 27/194 (14%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P++AEYAKS RS+C+ CKSPI + T+RL  MVQ+   DG+MP W+H  C   K +  K+ 
Sbjct  4    PYRAEYAKSGRSNCRGCKSPIGQGTVRLAVMVQSPFHDGMMPNWHHLHCFFNKQRP-KSE  62

Query  264  DDVEGLESLRWEDQEKIRKYV---------EGGGCGSSDAPT------PAVMEYGVETSQ  398
            DD+   E+LR EDQE IR+ +         E  G G     T       A+ ++ +E ++
Sbjct  63   DDIYHFETLRLEDQEIIREKLSNMGSIIVPEKKGKGKKRDATAIAQKNAALKDFKIEYAK  122

Query  399  TSRATCKHCNEKIMKGEVRISSK------AKGQGARSLAWHHAKCF----MEKSPVTQVD  548
            + RA C+ C +KI+K E+RIS K       K  G + + WHH  CF     E       D
Sbjct  123  SGRAACRGCEQKILKDEIRISKKDFETDIGKKYGGQDM-WHHVTCFAQLRAELGYFESAD  181

Query  549  KLLGWDSLPASDQA  590
            +L G+ SL   DQA
Sbjct  182  QLPGFKSLKKEDQA  195



>ref|NP_001153714.1| poly-(ADP-ribose) polymerase [Tribolium castaneum]
Length=991

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 104/194 (54%), Gaps = 27/194 (14%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P++AEYAKS  S+C+ CKSPI + T+RL  MVQ+   DG+MP W+H  C   K +  K+ 
Sbjct  4    PYRAEYAKSGSSNCRGCKSPIGQGTVRLAVMVQSPFHDGMMPNWHHLHCFFNKQRP-KSE  62

Query  264  DDVEGLESLRWEDQEKIRKYV---------EGGGCGSSDAPT------PAVMEYGVETSQ  398
            DD+   E+LR EDQE IR+ +         E  G G     T       A+ ++ +E ++
Sbjct  63   DDIYHFETLRLEDQEIIREKLSNMGSIIVPEKKGKGKKRDATAIAQKNAALKDFKIEYAK  122

Query  399  TSRATCKHCNEKIMKGEVRISSK------AKGQGARSLAWHHAKCF----MEKSPVTQVD  548
            + RA C+ C +KI+K E+RIS K       K  G + + WHH  CF     E       D
Sbjct  123  SGRAACRGCEQKILKDEIRISKKDFETDIGKKYGGQDM-WHHVTCFAQLRAELGYFESAD  181

Query  549  KLLGWDSLPASDQA  590
            +L G+ SL   DQA
Sbjct  182  QLPGFKSLKKEDQA  195



>ref|XP_004653313.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Jaculus jaculus]
Length=1014

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 101/187 (54%), Gaps = 17/187 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++AEYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRAEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       G+       + ++  E ++++R+TCK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVTGKGQNGAGGKAEKTLGDFAAEYAKSNRSTCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG+VR+S K     K Q      W+H  CF++        P     +L G+  L 
Sbjct  129  MEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQAVV  596
            A D+  +
Sbjct  189  AEDKETL  195



>ref|XP_008266574.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Oryctolagus cuniculus]
Length=1013

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 101/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G+       + ++  E ++++R+
Sbjct  64   IRQPDSEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGTGSKTEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLSAEDK  192



>gb|AAH18620.1| PARP1 protein, partial [Homo sapiens]
Length=232

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 100/192 (52%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQAVV  596
            +  L   D+  +
Sbjct  184  FSLLATEDKEAL  195



>ref|XP_006797147.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Neolamprologus 
brichardi]
Length=1014

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 107/186 (58%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYRVEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-SAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSRATCK  419
            T D+ G   LRW+DQ+K++K +E GG   G  D    A     + ++ VE ++++R+TCK
Sbjct  67   TADITGFSDLRWDDQQKVKKAIESGGAAGGKGDQKGGAKGEKTLNDFAVEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+++
Sbjct  127  GCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKPEYSAAQLKGFNA  186

Query  570  LPASDQ  587
            L A D+
Sbjct  187  LRAEDK  192



>ref|XP_005914567.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Haplochromis 
burtoni]
Length=1014

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 107/186 (58%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYRVEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-SAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSRATCK  419
            T D+ G   LRW+DQ+K++K +E GG   G  D    A     + ++ VE ++++R+TCK
Sbjct  67   TADIAGFSDLRWDDQQKVKKAIESGGAAGGKGDQKGGAKGEKTLNDFAVEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+++
Sbjct  127  GCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKPEYSAAQLKGFNA  186

Query  570  LPASDQ  587
            L A D+
Sbjct  187  LRAEDK  192



>ref|XP_003449904.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Oreochromis 
niloticus]
Length=1014

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 107/186 (58%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYRVEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-SAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSRATCK  419
            T D+ G   LRW+DQ+K++K +E GG   G  D    A     + ++ VE ++++R+TCK
Sbjct  67   TADIAGFSDLRWDDQQKVKKAIESGGAAGGKGDQKGGAKGEKTLNDFAVEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+++
Sbjct  127  GCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKPEYSAAQLKGFNA  186

Query  570  LPASDQ  587
            L A D+
Sbjct  187  LRAEDK  192



>ref|XP_004541848.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Maylandia zebra]
 ref|XP_005734477.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Pundamilia 
nyererei]
Length=1014

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 107/186 (58%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYRVEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-SAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSRATCK  419
            T D+ G   LRW+DQ+K++K +E GG   G  D    A     + ++ VE ++++R+TCK
Sbjct  67   TADIAGFSDLRWDDQQKVKKAIESGGAAGGKGDQKGGAKGEKTLNDFAVEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+++
Sbjct  127  GCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSRREELVFKPEYSAAQLKGFNA  186

Query  570  LPASDQ  587
            L A D+
Sbjct  187  LRAEDK  192



>gb|AAH14206.1| PARP1 protein, partial [Homo sapiens]
Length=250

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 100/192 (52%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQAVV  596
            +  L   D+  +
Sbjct  184  FSLLATEDKEAL  195



>ref|XP_006812395.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Saccoglossus 
kowalevskii]
Length=557

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 104/191 (54%), Gaps = 15/191 (8%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            M+    P+KAEYAKS RSSCK C+  I K ++RL KM+Q+  FDG +P W H  C  K A
Sbjct  1    MSDSDFPFKAEYAKSDRSSCKKCRGGIKKGSVRLAKMMQSPFFDGKVPTWYHYSCFWKMA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSS-----DAPTPAVMEYGVETSQTSRA  410
             ++KAT ++ G + LRW DQEKIR  + G     S      +      ++ +E ++++R+
Sbjct  61   -EVKATSEIVGYDGLRWTDQEKIRNKIAGDETKESVEDKVVSKETTTSDFSMEYAKSNRS  119

Query  411  TCKHCNEKIMKGEVRIS-SKAKGQGARSLAWHHAKCFMEKSPVTQ--------VDKLLGW  563
            TC+ C EKI K E+RI+ S+          WHH  CF +   + +        V K+ G+
Sbjct  120  TCRACKEKIAKDELRIAISETDPHDKIIENWHHLDCFCDPMKLVEFGWKKEYDVKKIQGF  179

Query  564  DSLPASDQAVV  596
              L   D+ +V
Sbjct  180  SCLKKEDKDIV  190



>pdb|4AV1|A Chain A, Crystal Structure Of The Human Parp-1 Dna Binding Domain 
In Complex With Dna
 pdb|4AV1|B Chain B, Crystal Structure Of The Human Parp-1 Dna Binding Domain 
In Complex With Dna
 pdb|4AV1|C Chain C, Crystal Structure Of The Human Parp-1 Dna Binding Domain 
In Complex With Dna
 pdb|4AV1|D Chain D, Crystal Structure Of The Human Parp-1 Dna Binding Domain 
In Complex With Dna
Length=223

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+ 
Sbjct  28   KLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRH  87

Query  261  TD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCK  419
             D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+TCK
Sbjct  88   PDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCK  147

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G+  
Sbjct  148  GCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSL  207

Query  570  LPASDQAVV  596
            L   D+  +
Sbjct  208  LATEDKEAL  216



>ref|XP_006974251.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Peromyscus maniculatus 
bairdii]
Length=1013

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+TCK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFAAEYAKSNRSTCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG+VR+S K     K Q      W+H  CF++        P     +L G+  L 
Sbjct  129  MEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPSCFVKNREELGFRPEYNASQLKGFGLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>ref|XP_003462410.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Cavia porcellus]
Length=1011

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 103/192 (54%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++AEYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRAEYAKSGRASCKKCGESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRQPDIEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P    ++L G
Sbjct  124  TCKGCMEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPDCFVKNREELGFRPEYSANQLKG  183

Query  561  WDSLPASDQAVV  596
            +  L A D+  +
Sbjct  184  FSLLTAEDKETL  195



>ref|XP_007102732.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Physeter catodon]
Length=1013

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGSKTEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVQNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLTAEDK  192



>ref|NP_777176.1| poly [ADP-ribose] polymerase 1 [Bos taurus]
 sp|P18493.2|PARP1_BOVIN RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Bos 
taurus]
 dbj|BAA14114.1| poly(ADP-ribose) synthetase [Bos taurus]
Length=1016

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 103/195 (53%), Gaps = 20/195 (10%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK CK  I K+++R+  MV++  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVESPMFDGKIPHWYHLSCFWKVGFS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC---------GSSDAPTPAVMEYGVETSQT  401
            I   D +VEG   LRW+DQ+ I+K  E GG          G        ++++G   +++
Sbjct  64   IWHPDVEVEGFSELRWDDQQTIKKMAETGGRTDVSGKGQDGVGSKTEKTLIDFGAGYAKS  123

Query  402  SRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDK  551
            +R+TCK C EKI KG+VR+S K     K Q      W+H KCF++K       P      
Sbjct  124  NRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSATH  183

Query  552  LLGWDSLPASDQAVV  596
            L+G+  L A DQ  +
Sbjct  184  LMGFSVLTAEDQETL  198



>ref|XP_006012380.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Latimeria chalumnae]
Length=746

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 104/185 (56%), Gaps = 17/185 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K + AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+A+ + +
Sbjct  9    KLFSAEYAKSGRASCKKCGESIAKDSLRLAIMVQSPMFDGKVPHWHHYSCFWKRAR-VLS  67

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT------PAVMEYGVETSQTSRATCKH  422
              D+ G  +LRWEDQEKI+K +E GG    D           + ++ VE ++++R+TCK 
Sbjct  68   QGDINGFSNLRWEDQEKIKKAIETGGGAGGDQGGGGGKGEKTLTDFAVEYAKSNRSTCKG  127

Query  423  CNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKLLGWDSL  572
            CN+KI K ++R+S K     K Q      W+H  CF+ +       P     +L G+  L
Sbjct  128  CNQKIEKDKIRVSKKMIDAEKPQLGMIDRWYHPDCFVSRRAELGFMPAYSATQLKGFSIL  187

Query  573  PASDQ  587
             A D+
Sbjct  188  KAEDK  192



>ref|XP_011204662.1| PREDICTED: poly [ADP-ribose] polymerase [Bactrocera dorsalis]
Length=994

 Score =   102 bits (254),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 79/220 (36%), Positives = 113/220 (51%), Gaps = 41/220 (19%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+K+EYAKS R+SCK CK  I + +LRL  MVQ+   DG  PMW H  C  KK +  ++ 
Sbjct  6    PYKSEYAKSGRASCKMCKCSIAQGSLRLAAMVQSAFHDGKQPMWFHEDCFFKKQRP-QSV  64

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSSD-----------APTPAVMEYGVETSQTSRA  410
             D+E  E++R+EDQE+I+  +E     S+D           A   A+ ++G+E ++TSRA
Sbjct  65   GDIENFENIRFEDQERIKLKIEKSSEVSADSSAKKGKKRGTAEVNALKDFGIEYAKTSRA  124

Query  411  TCKHCNEKIMKGEVRISSKAKGQ------GARSLAWHHAKCFMEKSPVTQVDKLLGW---  563
            TC+ C +KI+K +VRI             G + L WHH +CF+      Q+   LGW   
Sbjct  125  TCRGCEQKILKDQVRIKKTVYDTEVGMKYGGQPL-WHHVECFV------QLRNELGWFGS  177

Query  564  -DSLPA------SDQAVVSSLV------KNSTVKVAKEEP  644
             D +P        DQ  V  L+          +K  K EP
Sbjct  178  GDCVPGFKGLKKDDQTTVLKLLPAIDAGSACKIKKVKTEP  217



>gb|AIZ09031.1| poly [ADP-ribose] polymerase 1 [Heterocephalus glaber]
Length=1008

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 102/189 (54%), Gaps = 17/189 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+ 
Sbjct  7    KLYRAEYAKSGRASCKKCGESIPKDSLRMALMVQSPMFDGKVPHWYHFSCFWKMGHTIRH  66

Query  261  TD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCK  419
             D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+TCK
Sbjct  67   PDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGGKAEKTLGDFAAEYARSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C EKI KG++R+S K     K Q      W+H  CF++        P     +L G++ 
Sbjct  127  GCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPDCFVKNREELGFQPEYNASQLKGFNL  186

Query  570  LPASDQAVV  596
            L A D+  +
Sbjct  187  LSAEDKEAL  195



>gb|ETN59550.1| poly [adp-ribose] polymerase [Anopheles darlingi]
Length=1002

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 108/198 (55%), Gaps = 25/198 (13%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+ AEY+KS+R+SC+ CK  IDK+ LRL  MVQ+   DG +P W H  C  KK +     
Sbjct  7    PFLAEYSKSNRASCRLCKQKIDKDVLRLAAMVQSPVHDGKVPQWYHEDCFFKKQRPT-TE  65

Query  264  DDVEGLESLRWEDQEKIRKYV-------------EGGGCGSSDAPTPAVMEYGVETSQTS  404
             DV   E+LR+EDQ+K+R  +             +G G   S A   A+ +YGVE + + 
Sbjct  66   GDVAHFEALRYEDQKKLRDKIAALASVTVVPTSTKGKGKKRSAAEGQALKDYGVEYAASG  125

Query  405  RATCKHCNEKIMKGEVRISSKAKG------QGARSLAWHHAKCFME-KSPVTQVDK---L  554
            RA C+ C +KI+K EVRI   A         G + L WHHA+CF + ++ +   DK   L
Sbjct  126  RALCRGCEQKILKDEVRIKKVAYDTEVGMKYGGQPL-WHHAECFAKLRAELGYFDKAESL  184

Query  555  LGWDSLPASDQAVVSSLV  608
             G+ S+  +DQ  +  L+
Sbjct  185  PGFRSMKKADQNQLKELL  202



>emb|CAG09177.1| unnamed protein product [Tetraodon nigroviridis]
Length=233

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 111/213 (52%), Gaps = 45/213 (21%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  ++A   ++
Sbjct  8    KLYKAEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQRA-AAQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTSRATCK  419
            T D++G  SLRWEDQEK++K +E GG   G + +   A     + E+ VE ++++R+TCK
Sbjct  67   TSDIDGFSSLRWEDQEKVKKAIESGGATGGGTHSKGGAKAEKTLSEFAVEYAKSNRSTCK  126

Query  420  HCNEKI---------------------------MKGEVRISSKA----KGQGARSLAWHH  506
             C +KI                            + ++R+S K     K Q      W+H
Sbjct  127  GCEQKIEKVGTEVYLDIKTIETLRVHHYFLSLLFQDQIRVSKKTIDPEKPQLGLIDRWYH  186

Query  507  AKCFMEK------SPVTQVDKLLGWDSLPASDQ  587
              CF+ +       P     +L G+++L A D+
Sbjct  187  TACFVSRREELLFKPEYSASQLKGFNTLRAEDK  219



>ref|XP_004519484.1| PREDICTED: poly [ADP-ribose] polymerase-like isoform X2 [Ceratitis 
capitata]
Length=991

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 113/210 (54%), Gaps = 25/210 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+KAEYAKS R+SCK CKS I + TLRL  MVQ+   DG  P+W H  C  KK +   A 
Sbjct  6    PYKAEYAKSGRASCKMCKSSIAQGTLRLAAMVQSAFHDGKQPLWFHEDCFFKKQRP-SAV  64

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSS-------DAPTPAVMEYGVETSQTSRATCKH  422
             D++  E++R+EDQ++I+  VE     +S        A    + ++GVE +++SR++C+ 
Sbjct  65   GDIDNFENMRFEDQQRIKLKVENLVSATSSKKGKKRSADDSTLKDFGVEYAKSSRSSCRG  124

Query  423  CNEKIMKGEVRISSKAKG------QGARSLAWHHAKCFMEKSP----VTQVDKLLGWDSL  572
            C +KI+K +VRI   A         G + L WHH +CF +       + + D L G+ SL
Sbjct  125  CEQKILKDQVRIRKTAYDTEVGMKYGGQPL-WHHVECFAQLRNELGWLQKGDCLPGYKSL  183

Query  573  PASDQAVVSSLV------KNSTVKVAKEEP  644
               DQ+ +   +          VK AK EP
Sbjct  184  KKEDQSDILKFLPALKSESGLVVKKAKVEP  213



>ref|XP_004519485.1| PREDICTED: poly [ADP-ribose] polymerase-like isoform X3 [Ceratitis 
capitata]
Length=799

 Score =   102 bits (253),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 78/210 (37%), Positives = 113/210 (54%), Gaps = 25/210 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+KAEYAKS R+SCK CKS I + TLRL  MVQ+   DG  P+W H  C  KK +   A 
Sbjct  6    PYKAEYAKSGRASCKMCKSSIAQGTLRLAAMVQSAFHDGKQPLWFHEDCFFKKQRP-SAV  64

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSS-------DAPTPAVMEYGVETSQTSRATCKH  422
             D++  E++R+EDQ++I+  VE     +S        A    + ++GVE +++SR++C+ 
Sbjct  65   GDIDNFENMRFEDQQRIKLKVENLVSATSSKKGKKRSADDSTLKDFGVEYAKSSRSSCRG  124

Query  423  CNEKIMKGEVRISSKAKGQ------GARSLAWHHAKCFM----EKSPVTQVDKLLGWDSL  572
            C +KI+K +VRI   A         G + L WHH +CF     E   + + D L G+ SL
Sbjct  125  CEQKILKDQVRIRKTAYDTEVGMKYGGQPL-WHHVECFAQLRNELGWLQKGDCLPGYKSL  183

Query  573  PASDQAVVSSLV------KNSTVKVAKEEP  644
               DQ+ +   +          VK AK EP
Sbjct  184  KKEDQSDILKFLPALKSESGLVVKKAKVEP  213



>ref|XP_004375937.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Trichechus 
manatus latirostris]
 ref|XP_004375938.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 2 [Trichechus 
manatus latirostris]
Length=1013

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 104/192 (54%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++AEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRAEYAKSGRASCKKCKENIPKDSLRMAIMVQSPIFDGRVPHWYHFPCFWKVGHT  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            +   D DV+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+
Sbjct  64   LLHPDVDVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSDGKVEKTLSDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P   V +++G
Sbjct  124  TCKGCMEKIEKGQMRLSKKMLDPEKPQMGVIDRWYHPNCFVQNREKLGFRPEYSVSQIVG  183

Query  561  WDSLPASDQAVV  596
            +  L   D+  +
Sbjct  184  FPLLTPEDKEFL  195



>ref|XP_005349022.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Microtus ochrogaster]
Length=1013

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+TCK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFTAEYAKSNRSTCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG+VR+S K     K Q      W+H  CF++        P     +L G+  L 
Sbjct  129  MEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPTCFVKNREELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>ref|XP_006748394.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Leptonychotes 
weddellii]
Length=337

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 101/192 (53%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAESGGVTGKGQDGGGGKTDKTLADFTAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCLEKIEKGQIRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQAVV  596
            +  L A D+  +
Sbjct  184  FSLLAAEDKETL  195



>ref|XP_009025261.1| hypothetical protein HELRODRAFT_95414 [Helobdella robusta]
 gb|ESN96355.1| hypothetical protein HELRODRAFT_95414 [Helobdella robusta]
Length=1045

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 107/193 (55%), Gaps = 24/193 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P++ EYAKS RS CK C+  ID  +LRL  M+Q+  FDG MP W+H  C   + + +K T
Sbjct  8    PYQVEYAKSGRSICKLCRHLIDCGSLRLAIMLQSPHFDGKMPNWHHYECFWNRVRCLK-T  66

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVM----------EYGVETSQTSRAT  413
            DD+ G + +RW+DQEKI+K +E    G   A   +            +Y VE +++SR+T
Sbjct  67   DDIHGFKKIRWDDQEKIKKSIEAVKGGKKSAKGSSSSGGKAEDIFYGDYKVEYAKSSRST  126

Query  414  CKHCNEKIMKGEVRI------SSKAKGQGARSLAWHHAKCFME-----KSPVTQVDKLL-  557
            C+ C+  I K E+R+      S KA   G +   WHH KCF E     + P +   K+L 
Sbjct  127  CRSCHCYIDKDELRVSKKDYTSEKALMYGPQD-EWHHLKCFNEHRLQLQFPESMDPKMLS  185

Query  558  GWDSLPASDQAVV  596
            G+ SL A DQ +V
Sbjct  186  GFKSLSADDQKLV  198



>ref|XP_003791037.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Otolemur garnettii]
Length=1014

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 101/192 (53%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRWEDQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDMEVDGFSELRWEDQQKVKKTSEAGGVTGKGQAGGGSKTEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQAVV  596
            +  L A D+  +
Sbjct  184  FSLLTAEDKEAL  195



>tpd|FAA00236.1| TPA: zinc finger protein [Ciona intestinalis]
Length=565

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 104/185 (56%), Gaps = 14/185 (8%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+ AEYAKSSR+SCK C S I+K++LR+  MVQ+  FDG  P W+H  C   + +  K  
Sbjct  28   PYLAEYAKSSRASCKLCMSHIEKDSLRIALMVQSRHFDGKQPNWHHYTCFFGRCRP-KFV  86

Query  264  DDVEGLESLRWEDQEKIRKYVE--GGGCGSSDAPTPAVMEYGVETSQTSRATCKHCNEKI  437
            D++    +LRW+DQEKIR  +E  GGG  S  +    + ++ V+ + ++R+TCK C EKI
Sbjct  87   DEISKFHNLRWDDQEKIRAQIERGGGGGPSKKSSKKTLQDFVVQYALSNRSTCKKCEEKI  146

Query  438  MKGEVRISSK----AKGQGARSLAWHHAKCFMEKSP-------VTQVDKLLGWDSLPASD  584
             K E+RIS K     K Q      WHH  CF++              D L G+  L + D
Sbjct  147  EKDEIRISHKEIDPEKPQVGLIDRWHHVGCFIKSRKDLGWIDGQFTSDMLKGFKGLDSED  206

Query  585  QAVVS  599
            +A +S
Sbjct  207  RATIS  211



>ref|XP_007534861.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Erinaceus europaeus]
Length=937

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 91/157 (58%), Gaps = 8/157 (5%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+ 
Sbjct  7    KLYRVEYAKSGRASCKKCSESIAKDSLRMAIMVQSPMFDGKVPNWYHFACFWKIGHSIRQ  66

Query  261  TD-DVEGLESLRWEDQEKIRKYVEGGGC---GSSDAPTPAVMEYGVETSQTSRATCKHCN  428
             D +V+G   LRW+DQ+K++K  E GG    G        + ++  E ++++R+TCK C 
Sbjct  67   PDAEVDGFSELRWDDQQKVKKTAEAGGLSGKGVGSKAEKTLGDFAAEYAKSNRSTCKGCM  126

Query  429  EKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK  527
            EKI KG+VR+S K     K Q      W+H  CF++K
Sbjct  127  EKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPDCFVKK  163



>ref|XP_009184638.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Papio anubis]
Length=1085

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLAAEDK  192



>gb|EHH15492.1| hypothetical protein EGK_01593 [Macaca mulatta]
Length=1014

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQAGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLAAEDK  192



>ref|XP_001090984.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 4 [Macaca mulatta]
Length=1014

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQAGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLAAEDK  192



>ref|XP_010380279.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Rhinopithecus roxellana]
Length=1014

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLAAEDK  192



>ref|XP_005541069.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Macaca fascicularis]
 gb|EHH50496.1| hypothetical protein EGM_01339 [Macaca fascicularis]
Length=1014

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQAGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLAAEDK  192



>ref|XP_007986456.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Chlorocebus sabaeus]
Length=1014

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLAAEDK  192



>ref|XP_003357689.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sus scrofa]
Length=1018

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHA  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDIEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGHVRLSKKMLDPEKPQLGMIDRWYHPNCFVQNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLTAEDK  192



>ref|XP_006157311.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tupaia chinensis]
Length=1014

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 101/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+ 
Sbjct  7    KLYRAEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRH  66

Query  261  TD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCK  419
             D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+TCK
Sbjct  67   PDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGSKTEKTLGDFAAEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDS  569
             C EKI KG++R+S K     K Q      W+H  CF++        P     +L G+  
Sbjct  127  GCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPSCFVKNRAELGFRPEYSASQLKGFSL  186

Query  570  LPASDQAVV  596
            L A D+  +
Sbjct  187  LTAEDKETL  195



>ref|XP_004083528.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Oryzias latipes]
Length=1015

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 105/187 (56%), Gaps = 19/187 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS ++SCK CK  I K++LR+  +VQ+  FDG +P W+H  C  ++A  +++
Sbjct  8    KLFRAEYAKSGQASCKKCKEKIAKDSLRMAIVVQSPMFDGKVPHWHHFSCFWQRA-SVQS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGC--------GSSDAPTPAVMEYGVETSQTSRATC  416
            T DV G   LRW DQE ++K +E GG         G +      + ++ VE ++++R+TC
Sbjct  67   TADVGGFSDLRWADQEAVKKAIESGGVAGTGKGNSGGAAKGEKTLNDFAVEYAKSNRSTC  126

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWD  566
            K C +KI K ++R+S K     K Q      W+H  CF+ +       P     +L G++
Sbjct  127  KGCQQKIEKDQIRVSKKVVDAEKPQLGLIDRWYHTACFVSRREELAFKPDYSAAQLKGFN  186

Query  567  SLPASDQ  587
             L A D+
Sbjct  187  VLRAEDK  193



>dbj|BAE22758.1| unnamed protein product [Mus musculus]
Length=190

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 97/181 (54%), Gaps = 17/181 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  A  578
            A
Sbjct  189  A  189



>ref|XP_004605484.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sorex araneus]
Length=1015

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 101/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SADKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFTCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G+       + ++  E ++++R+
Sbjct  64   IQQPDVEVDGFSELRWDDQQKVKKTAEAGGMTGKGPDGAGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREGLGFRPEYSATQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FGLLKAEDK  192



>ref|XP_005326600.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ictidomys tridecemlineatus]
Length=1014

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 100/189 (53%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKIPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +++G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRQPDLEIDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLSAEDK  192



>emb|CDQ76498.1| unnamed protein product [Oncorhynchus mykiss]
Length=1013

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 96/163 (59%), Gaps = 14/163 (9%)
 Frame = +3

Query  69   ASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCI-LKKA  245
            A   K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  L+ +
Sbjct  4    AQEDKLYKAEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWLRAS  63

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGC--GSSDAPTPA-----VMEYGVETSQTS  404
             Q  A  D+ G   LRWEDQEK++K +E GG   G  D    A     + ++ VE ++++
Sbjct  64   AQSPA--DIAGFSDLRWEDQEKVKKAIETGGAAGGKGDVKGGAKGEKTLNDFAVEYAKSN  121

Query  405  RATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFM  521
            R+TCK C +KI K ++R+S K     K Q      W+H  CF+
Sbjct  122  RSTCKGCEQKIEKDQIRVSKKTIDPEKPQLGLIDRWYHTACFV  164



>ref|XP_009860226.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ciona intestinalis]
Length=980

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 104/185 (56%), Gaps = 14/185 (8%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+ AEYAKSSR+SCK C S I+K++LR+  MVQ+  FDG  P W+H  C   + +  K  
Sbjct  7    PYLAEYAKSSRASCKLCMSHIEKDSLRIALMVQSRHFDGKQPNWHHYTCFFGRCRP-KFV  65

Query  264  DDVEGLESLRWEDQEKIRKYVE--GGGCGSSDAPTPAVMEYGVETSQTSRATCKHCNEKI  437
            D++    +LRW+DQEKIR  +E  GGG  S  +    + ++ V+ + ++R+TCK C EKI
Sbjct  66   DEISKFHNLRWDDQEKIRAQIERGGGGGPSKKSSKKTLQDFVVQYALSNRSTCKKCEEKI  125

Query  438  MKGEVRISSK----AKGQGARSLAWHHAKCFMEKSP-------VTQVDKLLGWDSLPASD  584
             K E+RIS K     K Q      WHH  CF++              D L G+  L + D
Sbjct  126  EKDEIRISHKEIDPEKPQVGLIDRWHHVGCFIKSRKDLGWIDGQFTSDMLKGFKGLDSED  185

Query  585  QAVVS  599
            +A +S
Sbjct  186  RATIS  190



>ref|XP_011188189.1| PREDICTED: poly [ADP-ribose] polymerase [Bactrocera cucurbitae]
Length=997

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 75/218 (34%), Positives = 114/218 (52%), Gaps = 33/218 (15%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+++EYAKS R+SCK CK  I + +LRL  +VQ+   DG  PMW H  C  KK +   + 
Sbjct  6    PYRSEYAKSGRASCKMCKCSIAQGSLRLAALVQSAFHDGKQPMWFHENCFFKKQRP-GSV  64

Query  264  DDVEGLESLRWEDQEKIRKYVEGG---------------GCGSSDAPTPAVMEYGVETSQ  398
             D+E  E++R+EDQE+I+  +E                 G   S     A+ ++G+E ++
Sbjct  65   GDIENFENIRFEDQERIKLKIEKSLEVSSSTSTSTSTKKGNKRSAGEGNAIKDFGIEYAK  124

Query  399  TSRATCKHCNEKIMKGEVRI------SSKAKGQGARSLAWHHAKCFM----EKSPVTQVD  548
            +SRA C+ C +KI+K +VRI      +      G + L WHH +CF     E   +++ D
Sbjct  125  SSRAACRGCEQKILKDQVRIRKTVYTTEVGMKYGGQPL-WHHVECFAQLRGELGWLSKGD  183

Query  549  KLLGWDSLPASDQAVVSSLV------KNSTVKVAKEEP  644
             + G+ SL   DQ V+  L+        S +K AK EP
Sbjct  184  CIPGFKSLKKDDQTVILKLLPAIDANSGSIIKKAKIEP  221



>ref|XP_003999138.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Felis catus]
Length=1013

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 93/163 (57%), Gaps = 11/163 (7%)
 Frame = +3

Query  69   ASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAK  248
            AS  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K   
Sbjct  3    ASSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGH  62

Query  249  QIKATD-DVEGLESLRWEDQEKIRKYVEGGGCG--SSDA----PTPAVMEYGVETSQTSR  407
             I+  D +V+G   LRW+DQ+K++K  E GG      DA        + ++  E +++SR
Sbjct  63   SIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGRGQDAGGGKAEKTLADFAAEYAKSSR  122

Query  408  ATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME  524
            +TCK C EKI KG++R+S K     K Q      W+H  CF++
Sbjct  123  STCKGCMEKIEKGQIRLSKKMLDPEKPQLGMIDRWYHPDCFVK  165



>ref|XP_005078195.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Mesocricetus auratus]
Length=1013

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  + GG       GS       + ++  E ++++R+TCK C
Sbjct  69   IEVDGFSELRWDDQQKVKKTAQAGGVAGKGQDGSVGKAEKTLGDFAAEYAKSNRSTCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG+VR+S K     K Q      W+H  CF++        P     +L G+  L 
Sbjct  129  MEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPTCFVKNREELGFRPEYSAGQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>ref|XP_011289117.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Felis catus]
Length=985

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 93/163 (57%), Gaps = 11/163 (7%)
 Frame = +3

Query  69   ASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAK  248
            AS  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K   
Sbjct  3    ASSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGH  62

Query  249  QIKATD-DVEGLESLRWEDQEKIRKYVEGGGCG--SSDA----PTPAVMEYGVETSQTSR  407
             I+  D +V+G   LRW+DQ+K++K  E GG      DA        + ++  E +++SR
Sbjct  63   SIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGRGQDAGGGKAEKTLADFAAEYAKSSR  122

Query  408  ATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME  524
            +TCK C EKI KG++R+S K     K Q      W+H  CF++
Sbjct  123  STCKGCMEKIEKGQIRLSKKMLDPEKPQLGMIDRWYHPDCFVK  165



>ref|XP_004914864.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=1030

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 113/206 (55%), Gaps = 21/206 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK C   I KE+LRL  MVQ+  FDG +P W+H  C  K+A+ + +
Sbjct  7    KLYRAEYAKSGRASCKKCGDNIAKESLRLALMVQSPMFDGKVPHWHHYSCFWKRAR-VLS  65

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP-------AVMEYGVETSQTSRATCK  419
              D++G   LRW+DQEKI+K VE GG  +              + ++ VE ++++R+TCK
Sbjct  66   HGDIDGFTELRWDDQEKIKKAVETGGASAGAGGDAKGGKGEMTLNDFAVEYAKSNRSTCK  125

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME------KSPVTQVDKLLGWDS  569
             C +KI KG++RIS K     + Q      W+H+ CF+         P     +L  +  
Sbjct  126  GCEKKIEKGQIRISKKMVDVERPQLGMIDRWYHSDCFVSCREELGFLPSYSASQLKAFSI  185

Query  570  LPASDQAVVSSL---VKNSTVKVAKE  638
            L A D+  + ++   VKN   + A E
Sbjct  186  LKAEDKDALKAMLPAVKNEGKRKADE  211



>ref|XP_002941174.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Xenopus 
(Silurana) tropicalis]
Length=1013

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 96/158 (61%), Gaps = 12/158 (8%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK C   I KE+LRL  MVQ+  FDG +P W+H  C  K+A+ + +
Sbjct  7    KLYRAEYAKSGRASCKKCGDNIAKESLRLALMVQSPMFDGKVPHWHHYSCFWKRAR-VLS  65

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP-------AVMEYGVETSQTSRATCK  419
              D++G   LRW+DQEKI+K VE GG  +              + ++ VE ++++R+TCK
Sbjct  66   HGDIDGFTELRWDDQEKIKKAVETGGASAGAGGDAKGGKGEMTLNDFAVEYAKSNRSTCK  125

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFM  521
             C +KI KG++RIS K     + Q      W+H+ CF+
Sbjct  126  GCEKKIEKGQIRISKKMVDVERPQLGMIDRWYHSDCFV  163



>sp|P11103.3|PARP1_MOUSE RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1; Short=msPARP 
[Mus musculus]
 emb|CAA32421.1| unnamed protein product [Mus musculus]
Length=1013

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 101/187 (54%), Gaps = 17/187 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ +YAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K  + I+  D
Sbjct  9    YRVQYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGQSIRHPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFAAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQAVV  596
            A D+  +
Sbjct  189  AEDKEAL  195



>ref|XP_005175604.1| PREDICTED: poly [ADP-ribose] polymerase isoform X1 [Musca domestica]
 ref|XP_005175605.1| PREDICTED: poly [ADP-ribose] polymerase isoform X2 [Musca domestica]
Length=1002

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 99/187 (53%), Gaps = 30/187 (16%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+KAEYAK+ R+ CK CK+ I + +LR+  MVQ+   DG  P W H  C  KK +   + 
Sbjct  8    PFKAEYAKTGRAGCKGCKTNIGQGSLRIAAMVQSAFHDGKQPNWFHESCFFKKQRP-GSV  66

Query  264  DDVEGLESLRWEDQEKIRKYVE------------GGGCGSSDAPTPAVMEYGVETSQTSR  407
             DVE  ESLR+EDQE+IRK ++             GG   + A   A+ ++G+E +++ R
Sbjct  67   GDVENFESLRFEDQERIRKKIDECSSVVESLGSSKGGKKRNIAENSAIKDFGLEYAKSGR  126

Query  408  ATCKHCNEKIMKGEVRISSKAKG------QGARSLAWHHAKCFMEKSPVTQVDKLLGW--  563
            A C+ C  KI+KG++RI             G + L WHH +CF       Q+   LGW  
Sbjct  127  AACRGCELKILKGQIRIRKTVYDTEVGMKYGGQPL-WHHVECF------AQLRGELGWFA  179

Query  564  --DSLPA  578
              D LP 
Sbjct  180  AGDILPG  186



>gb|AAB59447.1| poly(ADP-ribose) synthetase [Homo sapiens]
Length=1014

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSERASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>ref|XP_005404552.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Chinchilla lanigera]
Length=1013

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 102/192 (53%), Gaps = 18/192 (9%)
 Frame = +3

Query  66   MASP-HKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKK  242
            MA P  + ++AEYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K 
Sbjct  1    MAEPSDRLYRAEYAKSGRASCKKCGESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV  60

Query  243  AKQIKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQT  401
               I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E +++
Sbjct  61   GHSIRQPDVEVDGFSELRWDDQQKVKKAAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS  120

Query  402  SRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDK  551
            +R+TCK C EKI KG++R+S K     K Q      W+H  CF++        P     +
Sbjct  121  NRSTCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPDCFVKNREELGFRPEYSASQ  180

Query  552  LLGWDSLPASDQ  587
            L G+  L   D+
Sbjct  181  LKGFSLLAEEDK  192



>dbj|BAG35260.1| unnamed protein product [Homo sapiens]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>gb|AAH37545.1| Poly (ADP-ribose) polymerase 1 [Homo sapiens]
 gb|ABM85752.1| poly (ADP-ribose) polymerase family, member 1 [synthetic construct]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>ref|XP_003814976.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pan paniscus]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>ref|XP_004519483.1| PREDICTED: poly [ADP-ribose] polymerase-like isoform X1 [Ceratitis 
capitata]
Length=994

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 113/213 (53%), Gaps = 28/213 (13%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+KAEYAKS R+SCK CKS I + TLRL  MVQ+   DG  P+W H  C  KK +   A 
Sbjct  6    PYKAEYAKSGRASCKMCKSSIAQGTLRLAAMVQSAFHDGKQPLWFHEDCFFKKQRP-SAV  64

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSS----------DAPTPAVMEYGVETSQTSRAT  413
             D++  E++R+EDQ++I+  V+     S+           A    + ++GVE +++SR++
Sbjct  65   GDIDNFENMRFEDQQRIKLKVDNPSDSSAATSSKKGKKRSADDSTLKDFGVEYAKSSRSS  124

Query  414  CKHCNEKIMKGEVRISSKAKG------QGARSLAWHHAKCFMEKSP----VTQVDKLLGW  563
            C+ C +KI+K +VRI   A         G + L WHH +CF +       + + D L G+
Sbjct  125  CRGCEQKILKDQVRIRKTAYDTEVGMKYGGQPL-WHHVECFAQLRNELGWLQKGDCLPGY  183

Query  564  DSLPASDQAVVSSLV------KNSTVKVAKEEP  644
             SL   DQ+ +   +          VK AK EP
Sbjct  184  KSLKKEDQSDILKFLPALKSESGLVVKKAKVEP  216



>gb|EAW69785.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_b 
[Homo sapiens]
Length=1008

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 98/183 (54%), Gaps = 16/183 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHCN  428
            I+  D +V+G   LRW+DQ+K++K  E GG          + ++  E ++++R+TCK C 
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTEK-----TLGDFAAEYAKSNRSTCKGCM  118

Query  429  EKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLPA  578
            EKI KG+VR+S K     K Q      W+H  CF++        P     +L G+  L  
Sbjct  119  EKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLAT  178

Query  579  SDQ  587
             D+
Sbjct  179  EDK  181



>gb|AAA60155.1| poly(ADP-ribose) polymerase [Homo sapiens]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>ref|NP_001609.2| poly [ADP-ribose] polymerase 1 [Homo sapiens]
 sp|P09874.4|PARP1_HUMAN RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Homo 
sapiens]
 gb|AAM75364.1|AF524947_1 ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase) [Homo 
sapiens]
 gb|AAA51663.1| NAD+ ADP-ribosyltransferase [Homo sapiens]
 gb|EAW69783.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_a 
[Homo sapiens]
 gb|EAW69784.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_a 
[Homo sapiens]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>dbj|BAE39743.1| unnamed protein product [Mus musculus]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>ref|XP_003949754.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Pan troglodytes]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>gb|ABM82562.1| poly (ADP-ribose) polymerase family, member 1 [synthetic construct]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>dbj|BAE35080.1| unnamed protein product [Mus musculus]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>ref|XP_004700007.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Echinops telfairi]
Length=1016

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 92/162 (57%), Gaps = 11/162 (7%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++AEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRAEYAKSGRASCKKCKENIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHC  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            +   D DV+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   LPHPDVDVDGFSELRWDDQQKVKKTAEAGGVTGKGHDGGGSKADKTLNDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME  524
            TCK C EKI KG++R+S K     K Q      W+H  CF++
Sbjct  124  TCKGCMEKIEKGQMRLSKKMLDPEKPQMGVIDRWYHPNCFIQ  165



>ref|XP_004065376.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Gorilla gorilla gorilla]
Length=1021

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>ref|NP_031441.2| poly [ADP-ribose] polymerase 1 [Mus musculus]
 gb|AAH12041.1| Poly (ADP-ribose) polymerase family, member 1 [Mus musculus]
 dbj|BAC27173.1| unnamed protein product [Mus musculus]
 dbj|BAC40500.1| unnamed protein product [Mus musculus]
 gb|EDL13152.1| poly (ADP-ribose) polymerase family, member 1 [Mus musculus]
Length=1014

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>dbj|BAE31150.1| unnamed protein product [Mus musculus]
Length=973

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>dbj|BAE38574.1| unnamed protein product [Mus musculus]
Length=1014

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>ref|XP_003275213.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nomascus leucogenys]
Length=955

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 101/191 (53%), Gaps = 21/191 (11%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC--------GSSDAPTPAVMEYGVETSQTS  404
            I+  D +V+G   LRW+DQ+K++K  E GG         GS    T  + ++  E ++++
Sbjct  64   IRHPDIEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDRIGSKAEKT--LGDFAAEYAKSN  121

Query  405  RATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKL  554
            R+TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L
Sbjct  122  RSTCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYSASQL  181

Query  555  LGWDSLPASDQ  587
             G+  L   D+
Sbjct  182  KGFSLLATEDK  192



>ref|XP_010780561.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Notothenia coriiceps]
Length=802

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 103/184 (56%), Gaps = 16/184 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++A YAKSSR+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C   +A   ++
Sbjct  8    KLYQAVYAKSSRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWSRAAA-QS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVME-----YGVETSQTSRATCKHC  425
            T D+ G   LRW+DQEK++K +E GG    D    A  E     + VE ++++R+ CK C
Sbjct  67   TADIAGYSDLRWDDQEKVKKAIESGGAVGGDQKGGATGEKTLNDFAVEYAKSNRSKCKGC  126

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
            + KI K ++R+S K     K Q      W+H  CF+         P     +L G+++L 
Sbjct  127  DLKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFVSSREELAFKPEYSAAQLKGFNALR  186

Query  576  ASDQ  587
            A D+
Sbjct  187  AEDK  190



>ref|XP_008820594.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nannospalax galili]
Length=1013

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 90/159 (57%), Gaps = 11/159 (7%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+ 
Sbjct  7    KLYRVEYAKSGRASCKKCSDSIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQ  66

Query  261  TD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCK  419
             D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+TCK
Sbjct  67   PDIEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGIGGKAEKTLGDFAAEYAKSNRSTCK  126

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME  524
             C EKI KG+VR+S K     K Q      W+H  CF++
Sbjct  127  GCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVK  165



>gb|AAA60137.1| poly(ADP-ribose) polymerase [Homo sapiens]
Length=1014

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 98/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D  V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVQVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>dbj|BAE41080.1| unnamed protein product [Mus musculus]
Length=1014

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMTIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>dbj|BAE27352.1| unnamed protein product [Mus musculus]
Length=1014

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMTIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG       GS       + ++  E ++++R+ CK C
Sbjct  69   VEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFLAEYAKSNRSMCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++K       P     +L G+  L 
Sbjct  129  LEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>ref|XP_003487068.1| PREDICTED: poly [ADP-ribose] polymerase-like [Bombus impatiens]
Length=990

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 109/201 (54%), Gaps = 23/201 (11%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            +P  P+  EYAKSSR+SC+ CK  I+K++LRL  +VQ+   DG +P W H  C   K + 
Sbjct  2    NPDLPYSVEYAKSSRASCQNCKKNIEKDSLRLAVIVQSPVHDGKVPKWYHPPCFFMKQRP  61

Query  252  IKATDDVEGLESLRWEDQEKIRKYVEGGGC-------------GSSDAPTPAVMEYGVET  392
             K T D+   +++RWEDQ+++++ +E                 G   A T  + ++ V+ 
Sbjct  62   -KTTADIANFDNIRWEDQKELQRRIEEASTLPLPASRKGRKRSGGGTAATGPLHDFLVQY  120

Query  393  SQTSRATCKHCNEKIMKGEVRISSK-AKGQGARSLA----WHHAKCFMEKSPVTQV----  545
            ++++++TCK C EKI++GE+R+S K  + +  R       WHH +CF +     Q     
Sbjct  121  AKSNKSTCKACEEKIVQGEIRVSKKDFESEHGRRYGGIDRWHHLECFAKVRESLQFYESG  180

Query  546  DKLLGWDSLPASDQAVVSSLV  608
            D L G D L   DQ  + S++
Sbjct  181  DSLPGKDELSKDDQKKLKSVL  201



>gb|KFB53219.1| AGAP003230-PA-like protein [Anopheles sinensis]
Length=1000

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 109/205 (53%), Gaps = 26/205 (13%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            M +   P+ AEY+KS+R+SC+ CK  IDK+ LRL  MVQ+   DG +P W H  C  KK 
Sbjct  1    MDAQQLPFLAEYSKSNRASCRLCKQKIDKDVLRLAAMVQSPMHDGKIPQWYHEDCFFKKQ  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYV----------EGG----GCGSSDAPTPAVMEYG  383
            +  K   DV   E+LR+EDQ+KIR  +           GG    G   S     ++ ++G
Sbjct  61   RP-KTEGDVAHFEALRYEDQKKIRDAIALFAQGVVPAAGGSKAKGKKRSAGEALSLKDFG  119

Query  384  VETSQTSRATCKHCNEKIMKGEVRI------SSKAKGQGARSLAWHHAKCFME-KSPVTQ  542
            VE + + RA C+ C  KI+K EVRI      +      G + L WHHA+CF + +S +  
Sbjct  120  VEYAASGRAMCRGCEIKILKDEVRIKKVSYDTEVGMKYGGQPL-WHHAECFAKLRSELGY  178

Query  543  VDK---LLGWDSLPASDQAVVSSLV  608
             +K   L G+ S+   DQA +  L+
Sbjct  179  FEKAEVLPGYRSMKPEDQAKLKQLL  203



>ref|XP_002760624.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Callithrix jacchus]
Length=1013

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDIEVDGFSELRWDDQQKVKKTAEAGGMTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPDCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>ref|XP_003930339.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Saimiri boliviensis 
boliviensis]
Length=1013

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDIEVDGFSELRWDDQQKVKKTAEAGGMTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPDCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>ref|XP_006897812.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Elephantulus edwardii]
Length=1014

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 93/162 (57%), Gaps = 11/162 (7%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++AEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRAEYAKSGRASCKKCKENIPKDSLRMAIMVQSPIFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            +   + DV+G   LRW+DQ+K++K  E GG       G+       + ++  E ++++R+
Sbjct  64   LPHPEVDVDGFSELRWDDQQKLKKTAEAGGVADKSQAGNEAQAMRTLSDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME  524
            TCK C EKI KG++R+S K     K Q      W+H  CF+E
Sbjct  124  TCKGCLEKIEKGQMRLSKKMLDPEKPQMGVIDRWYHPSCFIE  165



>ref|XP_002073889.1| GK14355 [Drosophila willistoni]
 gb|EDW84875.1| GK14355 [Drosophila willistoni]
Length=994

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 107/191 (56%), Gaps = 20/191 (10%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+ AEYAKS R+SCK CK+ I K+TLRL  MVQ+  +DG +P W H  C  KK +   A 
Sbjct  6    PYMAEYAKSGRASCKGCKNAIAKDTLRLAVMVQSPVYDGKVPNWFHVNCFFKKQRPSSAG  65

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGC--------GSSDAPTPAVMEYGVETSQTSRATCK  419
             D++  E+LR++DQ +I K ++  G           S A + A+ ++G+E +++ RA C+
Sbjct  66   -DIKNFENLRFDDQNEITKLIDTVGVVVEAKSGKKRSKAESGALKDFGIEYAKSGRAACR  124

Query  420  HCNEKIMKGEVRISSKAKG------QGARSLAWHHAKCFME-KSPVTQVD---KLLGWDS  569
             C +KI K +VRI             G ++L WHH +CF + +S +   D    L G+ S
Sbjct  125  GCEQKITKDQVRIRKTVYDTEVGMKYGGQAL-WHHMECFAQMRSELGWFDTGENLPGYKS  183

Query  570  LPASDQAVVSS  602
            L A D+  V +
Sbjct  184  LKAEDKKEVQN  194



>ref|XP_004761981.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X5 [Mustela 
putorius furo]
 ref|XP_004805440.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Mustela 
putorius furo]
Length=1013

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 90/161 (56%), Gaps = 11/161 (7%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGGGGKTDKTLADFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFM  521
            TCK C EKI KG++R+S K     K Q      W+H  CF+
Sbjct  124  TCKGCMEKIEKGQIRLSKKMLDPEKPQLGMIDRWYHPDCFV  164



>ref|NP_037195.1| poly [ADP-ribose] polymerase 1 [Rattus norvegicus]
 sp|P27008.4|PARP1_RAT RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Rattus 
norvegicus]
 gb|AAC53544.1| poly(ADP-ribose) polymerase [Rattus norvegicus]
 gb|AAH85765.1| Poly (ADP-ribose) polymerase 1 [Rattus norvegicus]
 gb|EDL94827.1| poly (ADP-ribose) polymerase family, member 1 [Rattus norvegicus]
Length=1014

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 97/184 (53%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   WKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKATD  266
            ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    I+  D
Sbjct  9    YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRQPD  68

Query  267  -DVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT------PAVMEYGVETSQTSRATCKHC  425
             +V+G   LRW+DQ+K++K  E GG                + ++  E ++++R+TCK C
Sbjct  69   TEVDGFSELRWDDQQKVKKTAEAGGVAGKGQHGGGGKAEKTLGDFAAEYAKSNRSTCKGC  128

Query  426  NEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLP  575
             EKI KG++R+S K     K Q      W+H  CF++        P     +L G+  L 
Sbjct  129  MEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPTCFVKNRDELGFRPEYSASQLKGFSLLS  188

Query  576  ASDQ  587
            A D+
Sbjct  189  AEDK  192



>ref|XP_006871190.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Chrysochloris 
asiatica]
Length=1013

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 105/192 (55%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++AEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRAEYAKSGRASCKKCKENIPKDSLRMAIMVQSPLFDGRVPHWYHFSCFWKVGHC  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            +   D +V+G   LRW+DQ+K++K    GG       GS+      + ++ VE ++++R+
Sbjct  64   LPQPDVEVDGFSELRWDDQQKVKKTALAGGVAGKGQDGSASKIERTLSDFAVEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P  +  ++ G
Sbjct  124  TCKGCWEKIEKGQMRLSKKMLDPEKPQMGVIDHWYHPNCFIQNRERLGFRPEYKFSQIAG  183

Query  561  WDSLPASDQAVV  596
            +  L   D+ ++
Sbjct  184  FVLLSTEDKEIL  195



>ref|XP_004393605.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Odobenus rosmarus 
divergens]
Length=1014

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 99/192 (52%), Gaps = 17/192 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP------AVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG                + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAESGGVTGKGQDGGGGKTDKTLADFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG++R+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCLEKIEKGQIRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQAVV  596
            +  L   D+  +
Sbjct  184  FGLLATEDKETL  195



>ref|XP_312938.4| AGAP003230-PA [Anopheles gambiae str. PEST]
 gb|EAA08394.4| AGAP003230-PA [Anopheles gambiae str. PEST]
Length=995

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 106/199 (53%), Gaps = 21/199 (11%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            M +   P+ AEY+KS+R+ C+ CK  I K+ LRL  MVQ+   DG +  W H  C  K  
Sbjct  1    MDAEQLPFLAEYSKSNRAMCRLCKQAIAKDVLRLAAMVQSPMHDGKVAQWYHDDCFFK--  58

Query  246  KQIKATD-DVEGLESLRWEDQEKIRKYV-------EGGGCGSSDAPTPAVMEYGVETSQT  401
            KQ  AT+ DV  +E+LR+EDQ+KIR  +       +G G   +     ++ +YGVE + +
Sbjct  59   KQRPATEGDVANIEALRYEDQKKIRDAIGVVPVAGKGKGKKRTAVEAQSLKDYGVEYAPS  118

Query  402  SRATCKHCNEKIMKGEVRISSKAKG------QGARSLAWHHAKCFM----EKSPVTQVDK  551
             RA C+ C  KI+K E+RI   A         G + L WHHA+CF     E     + + 
Sbjct  119  GRAMCRGCEIKILKDEMRIKKVAYDTEVGMKYGGQPL-WHHAECFAKLRSELGYFEKAES  177

Query  552  LLGWDSLPASDQAVVSSLV  608
            L G+ S+   DQ ++  L+
Sbjct  178  LPGYRSMKPEDQKILKGLL  196



>ref|XP_004761980.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X4 [Mustela 
putorius furo]
 ref|XP_004805439.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Mustela 
putorius furo]
Length=1021

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 89/161 (55%), Gaps = 11/161 (7%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP------AVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG                + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGGGGKTDKTLADFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFM  521
            TCK C EKI KG++R+S K     K Q      W+H  CF+
Sbjct  124  TCKGCMEKIEKGQIRLSKKMLDPEKPQLGMIDRWYHPDCFV  164



>dbj|BAG10250.1| poly [ADP-ribose] polymerase-1 [synthetic construct]
Length=1014

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 98/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+  K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLFKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L   D+
Sbjct  184  FSLLATEDK  192



>ref|XP_007935170.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Orycteropus afer afer]
Length=1016

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 93/163 (57%), Gaps = 12/163 (7%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++AEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSEKLYRAEYAKSGRASCKKCKENIPKDSLRMAIMVQSPLFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC-------GSSDAPTPAVMEYGVETSQTSR  407
            +   D DV+G   LRW+DQ+K++K  E G         GS+      + ++  E ++++R
Sbjct  64   LPHPDVDVDGFSELRWDDQQKVKKTAEAGVVTTGKGQDGSASRVEKTLGDFAAEYAKSNR  123

Query  408  ATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME  524
            +TCK C EKI KG++R+S K     K Q      W+H  CF++
Sbjct  124  STCKGCMEKIEKGQMRLSKKMLDPEKPQMGVIDRWYHPNCFVQ  166



>ref|XP_008311174.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cynoglossus 
semilaevis]
Length=1021

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 105/187 (56%), Gaps = 19/187 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK CK  I K++LR+  MVQ+  +DG +P W+H  C  ++A  + +
Sbjct  8    KLYRAEYAKSGRASCKKCKDNIAKDSLRMAIMVQSPMYDGKVPHWHHFSCFWQRA-AVHS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGG---GCGSSDAPTPA-----VMEYGVETSQTSRATC  416
              D+ G   LRW DQ+K++K ++ G   G G  D    A     + ++ VE ++++R+TC
Sbjct  67   VADIAGFADLRWADQDKVKKAIDSGGAVGVGKGDQKGGAKGEKTLNDFSVEYAKSNRSTC  126

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWD  566
            K C +KI K ++RIS KA    K Q      W+H  CF+         P     +L G+ 
Sbjct  127  KGCLQKIEKDQIRISKKAVDPEKPQLGLIDRWYHTACFVSSREELVFKPEYSAAQLKGFV  186

Query  567  SLPASDQ  587
            +L A D+
Sbjct  187  TLRAEDK  193



>ref|XP_008311175.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Cynoglossus 
semilaevis]
Length=1015

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 105/187 (56%), Gaps = 19/187 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK CK  I K++LR+  MVQ+  +DG +P W+H  C  ++A  + +
Sbjct  8    KLYRAEYAKSGRASCKKCKDNIAKDSLRMAIMVQSPMYDGKVPHWHHFSCFWQRA-AVHS  66

Query  261  TDDVEGLESLRWEDQEKIRKYVEGG---GCGSSDAPTPA-----VMEYGVETSQTSRATC  416
              D+ G   LRW DQ+K++K ++ G   G G  D    A     + ++ VE ++++R+TC
Sbjct  67   VADIAGFADLRWADQDKVKKAIDSGGAVGVGKGDQKGGAKGEKTLNDFSVEYAKSNRSTC  126

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWD  566
            K C +KI K ++RIS KA    K Q      W+H  CF+         P     +L G+ 
Sbjct  127  KGCLQKIEKDQIRISKKAVDPEKPQLGLIDRWYHTACFVSSREELVFKPEYSAAQLKGFV  186

Query  567  SLPASDQ  587
            +L A D+
Sbjct  187  TLRAEDK  193



>ref|XP_001862547.1| poly [Culex quinquefasciatus]
 gb|EDS37185.1| poly [Culex quinquefasciatus]
Length=1000

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 30/208 (14%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            M + + P+ +EYAKS R+SCK CK  IDK+ LRLG MVQ+   DG    W H  C     
Sbjct  1    MDAHNLPFVSEYAKSGRASCKLCKDKIDKDELRLGAMVQSAFHDGKQAQWYHERCFF--G  58

Query  246  KQIKATD-DVEGLESLRWEDQEKIRKYVEGGGCGSSDA-PTP---------------AVM  374
            KQ   T+ DV G ESLR+EDQ++IR+ +   G G  +A PT                A+ 
Sbjct  59   KQRPTTEGDVAGFESLRFEDQKRIREKIASLGGGIVEATPTGKGKGKGKKRSAEQSNALK  118

Query  375  EYGVETSQTSRATCKHCNEKIMKGEVRI------SSKAKGQGARSLAWHHAKCFME-KSP  533
            ++GVE + + RA C+ C  KI+K EVRI      +      G ++L WHHA+CF + +S 
Sbjct  119  DFGVEYAASGRAVCRGCEIKILKDEVRIKKVDYTTEVGMKYGGQAL-WHHAECFAKLRSE  177

Query  534  VTQVDK---LLGWDSLPASDQAVVSSLV  608
            +   +K   L G+ +L   D   V  L+
Sbjct  178  LGYFEKGEALPGYRNLKKEDMETVKRLL  205



>ref|XP_002430760.1| polyA polymerase, putative [Pediculus humanus corporis]
 gb|EEB18022.1| polyA polymerase, putative [Pediculus humanus corporis]
Length=992

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 74/207 (36%), Positives = 110/207 (53%), Gaps = 15/207 (7%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            M   + P++AEYAKS R+SCK CK  I KE+LRL  MVQ+  FDG  P W H  C  KK 
Sbjct  1    MEPDNLPYRAEYAKSGRASCKGCKENIAKESLRLAVMVQSPFFDGKQPNWYHFSCFFKKF  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYV-EGGGCGSSDAPTPAVM----EYGVETSQTSRA  410
            +  K +  +   ES+RW+DQE I+  + +       + P+P+ +    +Y VE +++ RA
Sbjct  61   RP-KDSSSIAHFESIRWDDQEAIKNKIGKTTKSKKRNKPSPSNIPDLGDYKVEYAKSKRA  119

Query  411  TCKHCNEKIMKGEVRISSK-AKGQGARSLA----WHHAKCFM----EKSPVTQVDKLLGW  563
             CK C E I K E+RIS K  +G+ A        WHH  CF+    E    +  + L G+
Sbjct  120  KCKVCEETINKDEIRISKKDYEGEIALKYGPVDRWHHVDCFVKAREELEFFSSGEVLPGF  179

Query  564  DSLPASDQAVVSSLVKNSTVKVAKEEP  644
             +L   DQ ++ + +       +K+ P
Sbjct  180  KTLTEEDQNLLKTKIPELNNHSSKDGP  206



>gb|KFM63822.1| Poly [ADP-ribose] polymerase 1, partial [Stegodyphus mimosarum]
Length=975

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 75/198 (38%), Positives = 120/198 (61%), Gaps = 13/198 (7%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+  EY+KS+R+SCK CK+ IDK+ LR+G MVQ+  FDG +P+W+H  C  KK K  K T
Sbjct  6    PYIVEYSKSNRASCKICKNKIDKDCLRMGIMVQSPHFDGKVPLWHHSSCFFKKKKI-KTT  64

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSSDAP---TPAVMEYGVETSQTSRATCKHCNEK  434
             D+    ++RWEDQ+ I+ +VEGGG  ++ A    T  + ++ +E +++SR++C+ C+EK
Sbjct  65   ADIANFNNIRWEDQKTIKDHVEGGGTTNNKAASGGTKEISDFLIEYAKSSRSSCRECSEK  124

Query  435  IMKGEVRISS-KAKGQGARSLA----WHHAKCFMEKSPVTQ----VDKLLGWDSLPASDQ  587
            I KGE+RI+   ++   A+       WHHA CF+++    +     + L G+ +L   D+
Sbjct  125  IQKGEIRIAKIDSESPDAQRYGPIPRWHHADCFVKERQALEFTDDAEALPGFKTLSDEDK  184

Query  588  AVVSSLVKNSTVKVAKEE  641
             V+   +    VK   EE
Sbjct  185  EVIKGKLPRIGVKRTSEE  202



>ref|XP_001996195.1| GH22365 [Drosophila grimshawi]
 gb|EDV98556.1| GH22365 [Drosophila grimshawi]
Length=992

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 104/195 (53%), Gaps = 25/195 (13%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+ AEYAKS R+SCK CK+PI K++LRL  MVQ+   DG +P W H  C LKK +     
Sbjct  6    PYAAEYAKSGRASCKGCKTPIPKDSLRLATMVQSPFHDGKVPNWFHKDCFLKKQRP-ATV  64

Query  264  DDVEGLESLRWEDQEKIRKY-------VEGGGCGSSDAPTPAVMEYGVETSQTSRATCKH  422
             D++  E+LR++DQ ++ K        V G     S A   A+ ++G+E S++ RA C+ 
Sbjct  65   GDIKNFENLRFDDQTELTKLIGNAQVAVAGKAGKRSKAEQQAIKDFGIEYSKSGRAACRG  124

Query  423  CNEKIMKGEVRISS---------KAKGQGARSLAWHHAKCFME-KSPVTQVD---KLLGW  563
            C  KI K EVR+           K  GQ      WHH +CF + +S +   D    L G+
Sbjct  125  CELKINKDEVRVCKTLFDTEVGMKYGGQK----VWHHLECFAKMRSDLGWFDTGETLPGY  180

Query  564  DSLPASDQAVVSSLV  608
              L A D+A V  L+
Sbjct  181  KGLKADDKAEVLKLL  195



>ref|XP_006914334.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pteropus alecto]
 gb|ELK10638.1| Poly [ADP-ribose] polymerase 1 [Pteropus alecto]
Length=1011

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 90/162 (56%), Gaps = 11/162 (7%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGC------GSSDAPTPAVMEYGVETSQTSRA  410
            I   D +V+G   LRW+DQ+K++K  E GG       G        + ++  E ++++R+
Sbjct  64   IWQPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGGKTEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME  524
            TCK C EKI KG++R+S K     K Q      W+H  CF++
Sbjct  124  TCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPSCFVQ  165



>ref|XP_007481563.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Monodelphis 
domestica]
Length=1013

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 95/164 (58%), Gaps = 13/164 (8%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  KP++AEYAKS R+SCK C   I K++LRL  MVQ+  FDG +P W+H  C  K+   
Sbjct  4    SADKPYRAEYAKSGRASCKKCGESIAKDSLRLAIMVQSPMFDGKIPNWHHYACFWKRGLV  63

Query  252  I-KATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT--------PAVMEYGVETSQTS  404
            I +A  +V+G   LRW+DQ+KI+K +E GG       +          ++ +  E ++++
Sbjct  64   ISQAELEVDGFLELRWDDQQKIKKTIETGGLTGGKGGSQDGGGKGEKTLINFAAEYAKSN  123

Query  405  RATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFME  524
            R+ CK C +KI KG+VR+S K     K Q      W+H  CF++
Sbjct  124  RSACKGCQQKIEKGQVRLSKKMIDPEKPQLGMIDRWYHPDCFVK  167



>ref|XP_011254366.1| PREDICTED: poly [ADP-ribose] polymerase [Camponotus floridanus]
 gb|EFN69632.1| Poly [ADP-ribose] polymerase [Camponotus floridanus]
Length=983

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 93/161 (58%), Gaps = 17/161 (11%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P++AEYAKS RS C+ CK PI K++LR+  +VQ+   DG +P W H  C  +K +  K+T
Sbjct  6    PYRAEYAKSDRSKCQQCKQPISKQSLRIAAIVQSPVHDGTIPRWYHFECFFEKQRP-KST  64

Query  264  DDVEGLESLRWEDQEKIRKYVE-----------GGGCGSSDAPTPAVMEYGVETSQTSRA  410
             D+   + +R EDQE+I+K +E           G         + +  ++ VE ++++++
Sbjct  65   ADIACFDEIRLEDQEEIQKKIEEFVNAPPVSGKGRKRTKGGGASGSAGDFRVEYAKSNKS  124

Query  411  TCKHCNEKIMKGEVRISSK-AKGQGARSLA----WHHAKCF  518
            TCK C+EKI+KGE RIS K  +   AR       WHH +CF
Sbjct  125  TCKGCDEKIIKGETRISKKDYETAEARRFGGLDRWHHVECF  165



>ref|XP_003693603.1| PREDICTED: poly [ADP-ribose] polymerase-like [Apis florea]
Length=991

 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 105/190 (55%), Gaps = 23/190 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+  EYAKSSRSSCK CK+ I K++LRL  +VQ+   DG +P W H  C   K +  K T
Sbjct  6    PYSVEYAKSSRSSCKNCKNSIQKDSLRLAVIVQSPVHDGKIPNWYHPPCFFTKQRP-KTT  64

Query  264  DDVEGLESLRWEDQEKIRKYVE--------GGGCGSSDAPTPA-----VMEYGVETSQTS  404
             D+   +++RWEDQ++++K +E          G G     T A     + ++ V+ ++++
Sbjct  65   ADIANFDNIRWEDQKELQKKIEESINLPLPASGRGKKRGSTSAKNIGPLRDFVVQYAKSN  124

Query  405  RATCKHCNEKIMKGEVRISSK-AKGQGARSLA----WHHAKCFMEKSPVTQV----DKLL  557
            ++TCK C E+I++GE+RIS K  + + AR       WHH  CF++     Q     D L 
Sbjct  125  KSTCKACEERIVQGEIRISKKDFESEQARRYGGIDKWHHLDCFIKVRESLQFYESGDALP  184

Query  558  GWDSLPASDQ  587
            G + L   DQ
Sbjct  185  GKEDLSKEDQ  194



>ref|XP_624477.3| PREDICTED: poly [ADP-ribose] polymerase [Apis mellifera]
Length=991

 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 105/190 (55%), Gaps = 23/190 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+  EYAKSSRSSCK CK+ I K++LRL  +VQ+   DG +P W H  C   K +  K T
Sbjct  6    PYSVEYAKSSRSSCKNCKNSIQKDSLRLAVIVQSPVHDGKIPNWYHPPCFFTKQRP-KTT  64

Query  264  DDVEGLESLRWEDQEKIRKYVE--------GGGCGSSDAPTPA-----VMEYGVETSQTS  404
             D+   +++RWEDQ++++K +E          G G     T A     + ++ V+ ++++
Sbjct  65   ADIANFDNIRWEDQKELQKKIEESINLPLPASGRGKKRGSTSAKNIGPLRDFVVQYAKSN  124

Query  405  RATCKHCNEKIMKGEVRISSK-AKGQGARSLA----WHHAKCFMEKSPVTQV----DKLL  557
            ++TCK C E+I++GE+RIS K  + + AR       WHH  CF++     Q     D L 
Sbjct  125  KSTCKACEERIVQGEIRISKKDFESEQARRYGGIDRWHHLDCFIKVRESLQFYESGDTLP  184

Query  558  GWDSLPASDQ  587
            G + L   DQ
Sbjct  185  GKEELSKEDQ  194



>ref|NP_001081571.1| poly [ADP-ribose] polymerase 1 [Xenopus laevis]
 gb|AAI10779.1| PARP protein [Xenopus laevis]
Length=1011

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 18/186 (10%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKA  260
            K ++AEYAKS R+SCK C   I KE+LRL  MVQ+  FDG +P W+H  C  K+A+ + +
Sbjct  7    KLYRAEYAKSGRASCKKCGDNIAKESLRLAIMVQSPMFDGKVPHWHHYSCFWKRAR-VLS  65

Query  261  TDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTP-------AVMEYGVETSQTSRATCK  419
              D+ G   LRWEDQE I+K +E GG  +              + ++  E ++++R+ CK
Sbjct  66   QGDIYGYTELRWEDQEMIKKAIETGGAAAGAGGDSKGGKGEMTLNDFAAEYAKSNRSACK  125

Query  420  HCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEKS------PVTQVDKLLGWDS  569
             C +KI KG++RIS K+    + Q      W+H  CF+         P     +L G+  
Sbjct  126  GCEQKIEKGQIRISKKSVDVERPQLGMIDRWYHPDCFVSSREELGFLPSYSASQLKGFTI  185

Query  570  LPASDQ  587
            L A D+
Sbjct  186  LSAEDK  191



>ref|XP_006612556.1| PREDICTED: poly [ADP-ribose] polymerase-like [Apis dorsata]
Length=991

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 105/190 (55%), Gaps = 23/190 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+  EYAKSSRSSCK CK+ I K++LRL  ++Q+   DG +P W H  C   K +  K T
Sbjct  6    PYSVEYAKSSRSSCKNCKNSIQKDSLRLAVIIQSPVHDGKIPNWYHPPCFFTKQRP-KTT  64

Query  264  DDVEGLESLRWEDQEKIRKYVE--------GGGCGSSDAPTPA-----VMEYGVETSQTS  404
             D+   +++RWEDQ++++K +E          G G     T A     + ++ V+ ++++
Sbjct  65   ADIANFDNIRWEDQKELQKKIEESINLPLPASGRGKKRGSTSAKNIGPLRDFVVQYAKSN  124

Query  405  RATCKHCNEKIMKGEVRISSK-AKGQGARSLA----WHHAKCFMEKSPVTQV----DKLL  557
            ++TCK C E+I++GE+RIS K  + + AR       WHH  CF++     Q     D L 
Sbjct  125  KSTCKACEERIVQGEIRISKKDFESEQARRYGGIDRWHHLDCFIKVRESLQFYENGDTLP  184

Query  558  GWDSLPASDQ  587
            G + L   DQ
Sbjct  185  GKEDLSKEDQ  194



>ref|XP_010863533.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Esox lucius]
Length=1011

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 93/159 (58%), Gaps = 14/159 (9%)
 Frame = +3

Query  81   KPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCI-LKKAKQIK  257
            K +KAEYAKS R+SCK CK  I K++LR+  MVQ+  FDG +P W+H  C  L+ A Q  
Sbjct  8    KLYKAEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWLRAAAQ--  65

Query  258  ATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT-------PAVMEYGVETSQTSRATC  416
            +  D+ G   LRWEDQEK++K +E GG                 + ++GVE ++++R+TC
Sbjct  66   SPGDIAGFSDLRWEDQEKVKKAIETGGAAGGKGDAKGGAKGEKTLNDFGVEYAKSNRSTC  125

Query  417  KHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFM  521
            K C +KI K ++R+S K     K Q      W+H  CF+
Sbjct  126  KGCEQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTACFV  164



>ref|XP_003396806.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase-like 
[Bombus terrestris]
Length=990

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 109/201 (54%), Gaps = 31/201 (15%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+  EYAKSSR+SC+ CK  I+K++LRL  +VQ+   DG +P W H  C   K +  K T
Sbjct  6    PYSVEYAKSSRASCQNCKKNIEKDSLRLAVIVQSPVHDGKVPKWYHPPCFFMKQRP-KTT  64

Query  264  DDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPA-----------------VMEYGVET  392
             D+   +++RWEDQ+++++ +E     +S  P PA                 + ++ V+ 
Sbjct  65   ADIANFDNIRWEDQKELQRRIEE----ASTLPLPASRKGRKRSGGGTAAAGPLHDFLVQY  120

Query  393  SQTSRATCKHCNEKIMKGEVRISSK-AKGQGARSLA----WHHAKCFMEKSPVTQV----  545
            ++++++TCK C EKI++GE+R+S K  + +  R       WHH +CF +     Q     
Sbjct  121  AKSNKSTCKACEEKIVQGEIRVSKKDFESEHGRRYGGIDRWHHLECFAKVRESLQFYESG  180

Query  546  DKLLGWDSLPASDQAVVSSLV  608
            D L G D L   DQ  + S++
Sbjct  181  DALPGKDELSKDDQKKLKSVL  201



>ref|XP_001661932.1| AAEL011815-PA [Aedes aegypti]
 gb|EAT36080.1| AAEL011815-PA [Aedes aegypti]
Length=999

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/236 (36%), Positives = 115/236 (49%), Gaps = 38/236 (16%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            M + + P+ AEYAKS R+SCK CK+ IDK+ LRLG MVQ+   DG    W H  C  +K 
Sbjct  1    MDAQNLPYVAEYAKSGRASCKMCKNKIDKDELRLGAMVQSAFHDGKQAQWYHEKCFFQKL  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYV---------------EGGGCGSSDAPTPAVMEY  380
            +      D+   E LR+EDQEK+RK +               +G G   +      + ++
Sbjct  61   RPT-TEGDIAHFEGLRYEDQEKLRKKIATVGNGVVVPSSTSGKGKGKKRTADQNMVLKDF  119

Query  381  GVETSQTSRATCKHCNEKIMKGEVRISS---------KAKGQGARSLAWHHAKCFME-KS  530
             VE + + RATC+ C  KI+K EVRI           K  GQ      WHHA+CF + +S
Sbjct  120  AVEYAASGRATCRGCEIKILKDEVRIKKMDYTTEVGMKYGGQA----MWHHAECFAKLRS  175

Query  531  PVTQVDK---LLGWDSLPASDQAVVSSL---VKNSTV--KVAKEEPLXESTSTAGA  674
             +   +K   L G++ L   D+A V  L   +K   V  K  K EP  E  S   A
Sbjct  176  ELGYFEKGESLPGFNQLKKEDKAKVKELLPAIKQEEVPTKKVKSEPKDEVDSAKEA  231



>ref|XP_005959159.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Pantholops hodgsonii]
Length=993

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 81/158 (51%), Gaps = 17/158 (11%)
 Frame = +3

Query  174  MVQATQFDGVMPMWNHGGCILKKAKQIKATD-DVEGLESLRWEDQEKIRKYVEGGGC---  341
            M+ +  FDG +P W+H  C  K    I   D +VEG   LRW+DQ+KI+K  E GG    
Sbjct  18   MLLSPMFDGKIPHWHHLSCFWKVGHSIWHPDVEVEGFSELRWDDQQKIKKMAETGGATGK  77

Query  342  ---GSSDAPTPAVMEYGVETSQTSRATCKHCNEKIMKGEVRISSKA----KGQGARSLAW  500
               G        ++++G   ++++R+TCK C EKI KG+VR+S K     K Q      W
Sbjct  78   GQDGVGSKTEKTLIDFGAGYAKSNRSTCKSCMEKIEKGQVRLSKKVVYPDKPQLGMVDCW  137

Query  501  HHAKCFMEK------SPVTQVDKLLGWDSLPASDQAVV  596
            +H  CF++K       P     +L+G+  L A DQ  +
Sbjct  138  YHPNCFVQKREELGFRPEFSASQLMGFSLLTAEDQETL  175



>ref|NP_001191521.1| poly-(ADP-ribose) polymerase I [Aplysia californica]
 gb|ACU83597.1| poly-(ADP-ribose) polymerase I [Aplysia californica]
Length=985

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 93/160 (58%), Gaps = 9/160 (6%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            M+    P++AEYAKS RS CK CK  I + +LRL  MVQ+  FDG +P W H  C  K+A
Sbjct  1    MSHHDLPFQAEYAKSGRSGCKACKGNIAQGSLRLAVMVQSPHFDGKVPNWFHYACFWKRA  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHC  425
            K   A DD+  + SLRWEDQEKI+  +  GG G  D    +  ++  E +++ ++ C+ C
Sbjct  61   KCHNA-DDIHNIHSLRWEDQEKIKAQIGKGG-GGDDGGAASTEDFNTEYAKSGKSRCRGC  118

Query  426  NEKIMKGEVRISSK------AKGQGARSLAWHHAKCFMEK  527
             E I K  +RIS K      AK  G + L WHH  CF++K
Sbjct  119  EENIAKDSLRISKKEYESQRAKMYGPQDL-WHHVDCFVDK  157



>ref|XP_007167258.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Balaenoptera acutorostrata scammoni]
Length=1021

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 17/189 (9%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT------PAVMEYGVETSQTSRA  410
            I+  D +V+G   LRW+DQ+K++K  E GG                + ++  E ++++R+
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQGGVGSKTEKTLGDFAAEYAKSNRS  123

Query  411  TCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLG  560
            TCK C EKI KG+VR+S K     K Q      W+H  CF++        P     +L G
Sbjct  124  TCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVQNREELGFRPEYSASQLKG  183

Query  561  WDSLPASDQ  587
            +  L A D+
Sbjct  184  FSLLTAEDK  192



>sp|Q11208.1|PARP_SARPE RecName: Full=Poly [ADP-ribose] polymerase; Short=PARP; AltName: 
Full=NAD(+) ADP-ribosyltransferase; Short=ADPRT; AltName: 
Full=Poly[ADP-ribose] synthase [Sarcophaga peregrina]
 dbj|BAA03943.1| poly(ADP-ribose) polymerase [Sarcophaga peregrina]
Length=996

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 116/209 (56%), Gaps = 26/209 (12%)
 Frame = +3

Query  84   PWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQIKAT  263
            P+K EY+KSSR+SCK CK+ I+   LR+  MVQ+   DG  P W H  C  +K +   A 
Sbjct  6    PFKVEYSKSSRASCKGCKNKIEAGILRIAAMVQSAFHDGKQPNWFHEQCFFQKQRPTSAG  65

Query  264  DDVEGLESLRWEDQEKIRKYVE--------GG---GCGSSDAPTPAVMEYGVETSQTSRA  410
            D +E  E++R+EDQE+I+K ++        GG   G   S     A+ ++G+E +++ RA
Sbjct  66   D-IENFENIRFEDQERIKKAIDNCTTVISAGGSKKGAKRSKGENNAIKDFGIEYAKSGRA  124

Query  411  TCKHCNEKIMKGEVRI------SSKAKGQGARSLAWHHAKCFME-KSPVTQVD---KLLG  560
            +C+ C +KI+K ++RI      +      G + L WHH +CF + +  +  +D    L G
Sbjct  125  SCRGCEQKILKDQIRIRKTVFDTEVGMKYGGQPL-WHHVECFAQLRGELGWLDTGENLPG  183

Query  561  WDSLPASDQAVVSS---LVKNSTVKVAKE  638
            + +L + D+A V     ++K+  V  AK+
Sbjct  184  FQTLKSDDKADVKKALPVIKDEGVSSAKK  212



>ref|XP_001090628.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Macaca mulatta]
Length=993

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 96/183 (52%), Gaps = 26/183 (14%)
 Frame = +3

Query  72   SPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKAKQ  251
            S  K ++ EYAKS R+SCK C   I K++LR+  MVQ+  FDG +P W H  C  K    
Sbjct  4    SSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHS  63

Query  252  IKATD-DVEGLESLRWEDQEKIRKYVEGGGCGSSDAPTPAVMEYGVETSQTSRATCKHCN  428
            I+  D +V+G   LRW+DQ+K++K                + ++  E ++++R+TCK C 
Sbjct  64   IRHPDVEVDGFSELRWDDQQKVKK---------------TLGDFAAEYAKSNRSTCKGCM  108

Query  429  EKIMKGEVRISSKA----KGQGARSLAWHHAKCFMEK------SPVTQVDKLLGWDSLPA  578
            EKI KG+VR+S K     K Q      W+H  CF++        P     +L G+  L A
Sbjct  109  EKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQLKGFSLLAA  168

Query  579  SDQ  587
             D+
Sbjct  169  EDK  171



>gb|KFB53220.1| AGAP003230-PA-like protein [Anopheles sinensis]
Length=1004

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 109/205 (53%), Gaps = 26/205 (13%)
 Frame = +3

Query  66   MASPHKPWKAEYAkssrsscktcksPIDKETLRLGKMVQATQFDGVMPMWNHGGCILKKA  245
            M +   P+ AEY+KS+R+SC+ CK  IDK+ LRL  MVQ+   D  +P W H  C  KK 
Sbjct  1    MDAQQLPFLAEYSKSNRASCRLCKQKIDKDVLRLAAMVQSPMHDSKIPQWYHEDCFFKKQ  60

Query  246  KQIKATDDVEGLESLRWEDQEKIRKYV----EGGGCGSSDAPTPA----------VMEYG  383
            +  K+  DV   E LR+EDQ+KIR  +    EG    +S+               + +YG
Sbjct  61   RP-KSEGDVAHFEVLRYEDQKKIRDAIALSSEGIVAAASELKGKGKKRKAGEALFLKDYG  119

Query  384  VETSQTSRATCKHCNEKIMKGEVRI------SSKAKGQGARSLAWHHAKCFME-KSPVTQ  542
            VE + + RA C+ C  KI+K EVRI      +      G ++L W+HA+CF + +S +  
Sbjct  120  VEYAPSGRAMCRGCEIKILKDEVRIKKVSYDTEVGMKYGGQAL-WYHAECFAKLRSELGY  178

Query  543  VDK---LLGWDSLPASDQAVVSSLV  608
             +K   L G+ S+   DQA +  L+
Sbjct  179  FEKAEVLPGFGSIKPDDQAKLKQLL  203



>ref|XP_009076073.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Acanthisitta chloris]
Length=958

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 84/153 (55%), Gaps = 19/153 (12%)
 Frame = +3

Query  192  FDGVMPMWNHGGCILKKAKQIKATDDVEGLESLRWEDQEKIRKYVEGGGCGSSDAPT---  362
            FDG +P W+H  C  K+A+ +  TD ++G   LRWEDQEKI+K +E GG G         
Sbjct  2    FDGKVPHWHHYSCFWKRARIVSHTD-IDGFPELRWEDQEKIKKAIETGGPGGGKGGEQEG  60

Query  363  -----PAVMEYGVETSQTSRATCKHCNEKIMKGEVRISSKA----KGQGARSLAWHHAKC  515
                  ++ ++  E ++++R+TCK C +KI KG++RIS K     K Q      W+H  C
Sbjct  61   GGKAEKSLNDFAAEYAKSNRSTCKGCEQKIEKGQIRISKKMVHPEKPQLGMIDNWYHPDC  120

Query  516  FMEKS------PVTQVDKLLGWDSLPASDQAVV  596
            F+ +       PV Q  +LLG+  L A D+ ++
Sbjct  121  FVSRRAELGFLPVYQATQLLGFSILKAEDKEIL  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600