BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039D04

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593905.1|  PREDICTED: eukaryotic initiation factor 4A-9...    347   7e-118   Nicotiana tomentosiformis
ref|XP_009757031.1|  PREDICTED: eukaryotic initiation factor 4A-9       350   2e-116   Nicotiana sylvestris
ref|XP_002324737.1|  translation initiation factor eIF-4A family ...    350   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010927213.1|  PREDICTED: eukaryotic initiation factor 4A-2...    350   4e-116   Elaeis guineensis
ref|XP_010929386.1|  PREDICTED: eukaryotic initiation factor 4A-2       349   4e-116   Elaeis guineensis
ref|XP_011019413.1|  PREDICTED: eukaryotic initiation factor 4A-9...    349   5e-116   Populus euphratica
ref|XP_010925445.1|  PREDICTED: eukaryotic initiation factor 4A-8...    349   7e-116   Elaeis guineensis
ref|XP_011038130.1|  PREDICTED: eukaryotic initiation factor 4A-15      348   1e-115   Populus euphratica
ref|XP_008798133.1|  PREDICTED: eukaryotic initiation factor 4A-14      348   1e-115   Phoenix dactylifera
gb|ABK93239.1|  unknown                                                 348   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_002308545.1|  translation initiation factor eIF-4A family ...    348   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_011100200.1|  PREDICTED: eukaryotic initiation factor 4A-14      347   3e-115   Sesamum indicum [beniseed]
ref|XP_011081667.1|  PREDICTED: eukaryotic initiation factor 4A-2       347   3e-115   Sesamum indicum [beniseed]
sp|Q40471.1|IF4A9_TOBAC  RecName: Full=Eukaryotic initiation fact...    347   3e-115   Nicotiana tabacum [American tobacco]
ref|XP_003533770.1|  PREDICTED: eukaryotic initiation factor 4A-1...    347   4e-115   
ref|XP_010929385.1|  PREDICTED: eukaryotic initiation factor 4A-15      347   4e-115   Elaeis guineensis
ref|XP_006597014.1|  PREDICTED: uncharacterized protein LOC100786...    348   5e-115   
ref|XP_010915249.1|  PREDICTED: eukaryotic initiation factor 4A-8...    347   6e-115   Elaeis guineensis
gb|KHN28839.1|  Eukaryotic initiation factor 4A-15                      347   6e-115   Glycine soja [wild soybean]
gb|AFC90091.1|  eukaryotic initiation factor 4A-14                      347   6e-115   Nicotiana benthamiana
ref|XP_010242273.1|  PREDICTED: eukaryotic initiation factor 4A-11      347   6e-115   Nelumbo nucifera [Indian lotus]
ref|XP_004245077.1|  PREDICTED: eukaryotic initiation factor 4A-2       346   1e-114   Solanum lycopersicum
sp|Q40466.1|IF413_TOBAC  RecName: Full=Eukaryotic initiation fact...    344   1e-114   Nicotiana tabacum [American tobacco]
ref|NP_001242064.1|  uncharacterized protein LOC100786735               345   2e-114   Glycine max [soybeans]
ref|XP_008801403.1|  PREDICTED: eukaryotic initiation factor 4A-15      345   2e-114   Phoenix dactylifera
ref|XP_008782542.1|  PREDICTED: eukaryotic initiation factor 4A-1...    345   2e-114   Phoenix dactylifera
gb|ACU22915.1|  unknown                                                 338   3e-114   Glycine max [soybeans]
ref|XP_009597977.1|  PREDICTED: eukaryotic initiation factor 4A-15      345   3e-114   Nicotiana tomentosiformis
ref|XP_008220506.1|  PREDICTED: eukaryotic initiation factor 4A-1...    345   4e-114   Prunus mume [ume]
ref|XP_002521376.1|  dead box ATP-dependent RNA helicase, putative      344   4e-114   Ricinus communis
ref|XP_009764703.1|  PREDICTED: eukaryotic initiation factor 4A-1...    344   4e-114   Nicotiana sylvestris
ref|XP_006342504.1|  PREDICTED: eukaryotic initiation factor 4A-2...    344   5e-114   Solanum tuberosum [potatoes]
gb|EYU29343.1|  hypothetical protein MIMGU_mgv1a007274mg                344   6e-114   Erythranthe guttata [common monkey flower]
ref|XP_009784285.1|  PREDICTED: eukaryotic initiation factor 4A-14      344   6e-114   Nicotiana sylvestris
ref|XP_009780782.1|  PREDICTED: eukaryotic initiation factor 4A-1...    344   7e-114   Nicotiana sylvestris
ref|XP_009604758.1|  PREDICTED: eukaryotic initiation factor 4A-1...    344   7e-114   Nicotiana tomentosiformis
emb|CBI27885.3|  unnamed protein product                                344   8e-114   Vitis vinifera
sp|P41382.1|IF410_TOBAC  RecName: Full=Eukaryotic initiation fact...    344   8e-114   Nicotiana tabacum [American tobacco]
sp|Q40470.1|IF4A7_TOBAC  RecName: Full=Eukaryotic initiation fact...    344   8e-114   Nicotiana tabacum [American tobacco]
ref|XP_009604756.1|  PREDICTED: eukaryotic initiation factor 4A-7       343   8e-114   Nicotiana tomentosiformis
sp|Q40467.1|IF414_TOBAC  RecName: Full=Eukaryotic initiation fact...    343   9e-114   Nicotiana tabacum [American tobacco]
ref|XP_004303662.1|  PREDICTED: eukaryotic initiation factor 4A-8       343   1e-113   Fragaria vesca subsp. vesca
sp|P41379.1|IF4A2_NICPL  RecName: Full=Eukaryotic initiation fact...    343   1e-113   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_003522265.1|  PREDICTED: eukaryotic initiation factor 4A-11      343   1e-113   Glycine max [soybeans]
ref|XP_004291063.1|  PREDICTED: eukaryotic initiation factor 4A-2       343   1e-113   Fragaria vesca subsp. vesca
ref|XP_010094955.1|  Eukaryotic initiation factor 4A-13                 337   1e-113   Morus notabilis
emb|CAN70196.1|  hypothetical protein VITISV_040309                     343   2e-113   Vitis vinifera
ref|XP_004253093.1|  PREDICTED: eukaryotic initiation factor 4A-2       343   2e-113   Solanum lycopersicum
gb|KDP33852.1|  hypothetical protein JCGZ_07423                         343   2e-113   Jatropha curcas
emb|CDO97887.1|  unnamed protein product                                343   2e-113   Coffea canephora [robusta coffee]
sp|Q40465.1|IF411_TOBAC  RecName: Full=Eukaryotic initiation fact...    343   2e-113   Nicotiana tabacum [American tobacco]
ref|XP_008798130.1|  PREDICTED: eukaryotic initiation factor 4A-8...    343   2e-113   Phoenix dactylifera
ref|XP_009602748.1|  PREDICTED: eukaryotic initiation factor 4A-11      343   2e-113   Nicotiana tomentosiformis
ref|XP_007222702.1|  hypothetical protein PRUPE_ppa006409mg             343   2e-113   Prunus persica
gb|AAR23806.1|  initiation factor eIF4A-15                              342   2e-113   Helianthus annuus
emb|CAN61608.1|  hypothetical protein VITISV_040122                     342   3e-113   Vitis vinifera
gb|ACU18673.1|  unknown                                                 335   3e-113   Glycine max [soybeans]
gb|KDP40743.1|  hypothetical protein JCGZ_24742                         342   3e-113   Jatropha curcas
ref|XP_006426587.1|  hypothetical protein CICLE_v10025724mg             342   4e-113   
ref|XP_008793233.1|  PREDICTED: eukaryotic initiation factor 4A-1...    342   4e-113   Phoenix dactylifera
ref|XP_004513437.1|  PREDICTED: eukaryotic initiation factor 4A-1...    342   4e-113   
emb|CDP08290.1|  unnamed protein product                                342   5e-113   Coffea canephora [robusta coffee]
gb|KHN32709.1|  Eukaryotic initiation factor 4A-10                      342   5e-113   Glycine soja [wild soybean]
ref|XP_009399791.1|  PREDICTED: eukaryotic initiation factor 4A-8       342   6e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004146811.1|  PREDICTED: eukaryotic initiation factor 4A-8...    341   7e-113   Cucumis sativus [cucumbers]
ref|XP_008377701.1|  PREDICTED: eukaryotic initiation factor 4A-1...    341   7e-113   
gb|EYU21355.1|  hypothetical protein MIMGU_mgv1a0072631mg               341   9e-113   Erythranthe guttata [common monkey flower]
gb|KHG04102.1|  Eukaryotic initiation factor 4A-14                      337   9e-113   Gossypium arboreum [tree cotton]
gb|KJB56905.1|  hypothetical protein B456_009G142800                    338   9e-113   Gossypium raimondii
ref|XP_003543580.1|  PREDICTED: eukaryotic initiation factor 4A-1...    341   9e-113   Glycine max [soybeans]
ref|XP_003595233.1|  Eukaryotic initiation factor 4A                    341   1e-112   Medicago truncatula
ref|XP_008447621.1|  PREDICTED: eukaryotic initiation factor 4A-8       341   1e-112   Cucumis melo [Oriental melon]
gb|KHG23060.1|  Eukaryotic initiation factor 4A-9                       334   1e-112   Gossypium arboreum [tree cotton]
gb|KHN06630.1|  Eukaryotic initiation factor 4A-15                      341   1e-112   Glycine soja [wild soybean]
ref|XP_007138709.1|  hypothetical protein PHAVU_009G230600g             340   1e-112   Phaseolus vulgaris [French bean]
gb|AAN74635.1|  DEAD box RNA helicase                                   340   1e-112   Pisum sativum [garden pea]
sp|Q40468.1|IF415_TOBAC  RecName: Full=Eukaryotic initiation fact...    340   1e-112   Nicotiana tabacum [American tobacco]
ref|XP_002278119.1|  PREDICTED: eukaryotic initiation factor 4A-11      340   1e-112   Vitis vinifera
gb|EYU29345.1|  hypothetical protein MIMGU_mgv1a007246mg                340   2e-112   Erythranthe guttata [common monkey flower]
ref|XP_009385793.1|  PREDICTED: eukaryotic initiation factor 4A-1...    340   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008462340.1|  PREDICTED: eukaryotic initiation factor 4A-11      340   2e-112   Cucumis melo [Oriental melon]
ref|XP_009389913.1|  PREDICTED: eukaryotic initiation factor 4A-11      340   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004141688.1|  PREDICTED: eukaryotic initiation factor 4A-1...    340   2e-112   Cucumis sativus [cucumbers]
gb|KHN30068.1|  Eukaryotic initiation factor 4A-10                      340   3e-112   Glycine soja [wild soybean]
ref|XP_007215455.1|  hypothetical protein PRUPE_ppa006399mg             340   3e-112   Prunus persica
ref|XP_009415521.1|  PREDICTED: eukaryotic initiation factor 4A-15      340   3e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56903.1|  hypothetical protein B456_009G142800                    340   3e-112   Gossypium raimondii
ref|XP_008337727.1|  PREDICTED: eukaryotic initiation factor 4A-11      339   4e-112   Malus domestica [apple tree]
ref|XP_009403035.1|  PREDICTED: eukaryotic initiation factor 4A-1...    339   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB70132.1|  hypothetical protein B456_011G063400                    339   5e-112   Gossypium raimondii
ref|XP_007024535.1|  Eukaryotic translation initiation factor 4A1...    339   5e-112   Theobroma cacao [chocolate]
gb|KHN39326.1|  Eukaryotic initiation factor 4A-10                      339   5e-112   Glycine soja [wild soybean]
ref|XP_003531602.1|  PREDICTED: eukaryotic initiation factor 4A-10      339   6e-112   Glycine max [soybeans]
ref|XP_006583001.1|  PREDICTED: eukaryotic initiation factor 4A-10      339   6e-112   Glycine max [soybeans]
ref|XP_010927212.1|  PREDICTED: eukaryotic initiation factor 4A-1...    339   6e-112   Elaeis guineensis
gb|ACU21478.1|  unknown                                                 339   6e-112   Glycine max [soybeans]
ref|XP_011079970.1|  PREDICTED: eukaryotic initiation factor 4A-8       338   8e-112   Sesamum indicum [beniseed]
ref|XP_006338111.1|  PREDICTED: eukaryotic initiation factor 4A-1...    338   9e-112   Solanum tuberosum [potatoes]
gb|KHN17683.1|  Eukaryotic initiation factor 4A-15                      338   1e-111   Glycine soja [wild soybean]
ref|XP_007136846.1|  hypothetical protein PHAVU_009G079100g             338   1e-111   Phaseolus vulgaris [French bean]
ref|XP_008392378.1|  PREDICTED: eukaryotic initiation factor 4A-8       338   1e-111   Malus domestica [apple tree]
ref|XP_007150491.1|  hypothetical protein PHAVU_005G157100g             338   1e-111   Phaseolus vulgaris [French bean]
ref|XP_008379513.1|  PREDICTED: eukaryotic initiation factor 4A-8       338   1e-111   Malus domestica [apple tree]
emb|CBI35913.3|  unnamed protein product                                331   2e-111   Vitis vinifera
ref|XP_010669372.1|  PREDICTED: eukaryotic initiation factor 4A-9       338   2e-111   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB54655.1|  hypothetical protein B456_009G043400                    337   2e-111   Gossypium raimondii
ref|XP_010049453.1|  PREDICTED: eukaryotic initiation factor 4A-15      337   2e-111   
ref|XP_007202168.1|  hypothetical protein PRUPE_ppa006450mg             337   2e-111   Prunus persica
ref|XP_007012323.1|  Eukaryotic translation initiation factor 4A1       337   2e-111   Theobroma cacao [chocolate]
ref|XP_007135520.1|  hypothetical protein PHAVU_010G136300g             337   2e-111   Phaseolus vulgaris [French bean]
gb|EPS65096.1|  hypothetical protein M569_09681                         337   4e-111   Genlisea aurea
ref|XP_009372398.1|  PREDICTED: eukaryotic initiation factor 4A-8       337   4e-111   Pyrus x bretschneideri [bai li]
gb|ACJ84921.1|  unknown                                                 337   4e-111   Medicago truncatula
ref|XP_006342502.1|  PREDICTED: eukaryotic initiation factor 4A-2...    337   4e-111   Solanum tuberosum [potatoes]
ref|XP_004253094.1|  PREDICTED: eukaryotic initiation factor 4A-2...    337   4e-111   Solanum lycopersicum
gb|AFK40852.1|  unknown                                                 336   6e-111   Lotus japonicus
ref|XP_011010150.1|  PREDICTED: eukaryotic initiation factor 4A-8       336   7e-111   Populus euphratica
ref|XP_002304104.1|  translation initiation factor 4A family protein    336   7e-111   
ref|XP_006357714.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic i...    336   8e-111   
gb|KJB34989.1|  hypothetical protein B456_006G095400                    336   8e-111   Gossypium raimondii
ref|XP_003526019.1|  PREDICTED: eukaryotic initiation factor 4A-11      336   8e-111   Glycine max [soybeans]
dbj|BAJ89461.1|  predicted protein                                      336   8e-111   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563508.1|  PREDICTED: eukaryotic initiation factor 4A         336   9e-111   Brachypodium distachyon [annual false brome]
gb|AIZ68204.1|  eukaryotic initiation factor 4A-14                      336   9e-111   Ornithogalum longebracteatum [sea-onion]
dbj|BAA02152.1|  eukaryotic initiation factor 4A                        336   1e-110   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85348.1|  predicted protein                                      336   1e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001058481.1|  Os06g0701100                                       336   1e-110   
ref|XP_009381599.1|  PREDICTED: eukaryotic initiation factor 4A-9...    336   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009361722.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    349   1e-110   
dbj|BAJ96964.1|  predicted protein                                      336   1e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003597562.1|  Eukaryotic initiation factor 4A                    335   1e-110   Medicago truncatula
ref|XP_006656443.1|  PREDICTED: eukaryotic initiation factor 4A-1...    335   1e-110   Oryza brachyantha
ref|XP_010033764.1|  PREDICTED: eukaryotic initiation factor 4A-2...    335   1e-110   Eucalyptus grandis [rose gum]
ref|XP_006338110.1|  PREDICTED: eukaryotic initiation factor 4A-1...    335   2e-110   
ref|XP_010322836.1|  PREDICTED: eukaryotic initiation factor 4A-8...    335   2e-110   Solanum lycopersicum
gb|ACU24597.1|  unknown                                                 328   2e-110   Glycine max [soybeans]
gb|EAZ02256.1|  hypothetical protein OsI_24355                          335   2e-110   Oryza sativa Indica Group [Indian rice]
ref|XP_003627168.1|  Eukaryotic initiation factor 4A                    335   2e-110   Medicago truncatula
ref|XP_002277703.1|  PREDICTED: eukaryotic initiation factor 4A-8       335   2e-110   Vitis vinifera
ref|XP_004510408.1|  PREDICTED: eukaryotic initiation factor 4A-1...    335   3e-110   Cicer arietinum [garbanzo]
ref|XP_011072546.1|  PREDICTED: eukaryotic initiation factor 4A-8...    335   3e-110   Sesamum indicum [beniseed]
ref|XP_009410226.1|  PREDICTED: eukaryotic initiation factor 4A-9...    335   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009798256.1|  PREDICTED: eukaryotic initiation factor 4A-8       334   5e-110   Nicotiana sylvestris
sp|P41381.1|IF4A8_TOBAC  RecName: Full=Eukaryotic initiation fact...    334   6e-110   Nicotiana tabacum [American tobacco]
emb|CDY72259.1|  BnaCnng76770D                                          327   6e-110   Brassica napus [oilseed rape]
ref|NP_001105396.1|  translational initiation factor eIF-4A             334   7e-110   
ref|XP_010262239.1|  PREDICTED: uncharacterized protein LOC104600806    348   7e-110   
ref|XP_010322839.1|  PREDICTED: eukaryotic initiation factor 4A-8...    333   7e-110   Solanum lycopersicum
ref|XP_002438954.1|  hypothetical protein SORBIDRAFT_10g028940          333   8e-110   Sorghum bicolor [broomcorn]
gb|AFW75865.1|  putative DEAD-box ATP-dependent RNA helicase fami...    333   8e-110   
ref|XP_006474427.1|  PREDICTED: eukaryotic initiation factor 4A-9...    333   8e-110   Citrus sinensis [apfelsine]
gb|AAY33860.1|  eukaryotic initiation factor 4A                         333   9e-110   Cenchrus americanus [bulrush millet]
ref|XP_007012324.1|  Eukaryotic translation initiation factor 4A1       333   9e-110   Theobroma cacao [chocolate]
ref|XP_004966111.1|  PREDICTED: eukaryotic initiation factor 4A-3...    333   1e-109   Setaria italica
gb|KHG25459.1|  Eukaryotic initiation factor 4A-8                       328   1e-109   Gossypium arboreum [tree cotton]
gb|KJB65513.1|  hypothetical protein B456_010G098500                    333   1e-109   Gossypium raimondii
ref|XP_010656491.1|  PREDICTED: uncharacterized protein LOC100244028    345   1e-109   Vitis vinifera
sp|P41378.1|IF4A_WHEAT  RecName: Full=Eukaryotic initiation facto...    333   1e-109   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009334733.1|  PREDICTED: eukaryotic initiation factor 4A-1...    333   1e-109   
ref|XP_006453067.1|  hypothetical protein CICLE_v10008468mg             333   1e-109   Citrus clementina [clementine]
gb|ACN34609.1|  unknown                                                 333   2e-109   Zea mays [maize]
ref|XP_006853908.1|  hypothetical protein AMTR_s00036p00181640          333   2e-109   Amborella trichopoda
ref|XP_009624936.1|  PREDICTED: eukaryotic initiation factor 4A-8...    332   3e-109   Nicotiana tomentosiformis
gb|EMS68416.1|  Eukaryotic initiation factor 4A-1                       332   3e-109   Triticum urartu
ref|XP_007154632.1|  hypothetical protein PHAVU_003G134800g             332   3e-109   Phaseolus vulgaris [French bean]
ref|XP_006601410.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    345   3e-109   
ref|XP_010688701.1|  PREDICTED: eukaryotic initiation factor 4A-9...    332   4e-109   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY02469.1|  BnaA08g00760D                                          332   5e-109   
ref|XP_006453066.1|  hypothetical protein CICLE_v10008460mg             331   5e-109   Citrus clementina [clementine]
ref|XP_004951905.1|  PREDICTED: eukaryotic initiation factor 4A-like    331   6e-109   Setaria italica
ref|XP_007012776.1|  Eukaryotic translation initiation factor 4A1...    331   6e-109   
ref|XP_009106914.1|  PREDICTED: eukaryotic initiation factor 4A-1...    331   7e-109   Brassica rapa
emb|CDX82505.1|  BnaA03g33160D                                          331   9e-109   
ref|XP_010087709.1|  Eukaryotic initiation factor 4A-8                  331   9e-109   
ref|XP_010062659.1|  PREDICTED: eukaryotic initiation factor 4A-1...    330   1e-108   Eucalyptus grandis [rose gum]
gb|KEH32494.1|  DEAD-box ATP-dependent RNA helicase                     331   1e-108   Medicago truncatula
ref|XP_010502017.1|  PREDICTED: eukaryotic initiation factor 4A-2...    325   1e-108   Camelina sativa [gold-of-pleasure]
ref|NP_001104874.1|  translation initiation factor                      330   1e-108   Zea mays [maize]
ref|XP_006297793.1|  hypothetical protein CARUB_v10013828mg             330   1e-108   Capsella rubella
ref|XP_010501441.1|  PREDICTED: eukaryotic initiation factor 4A-1       330   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_006595337.1|  PREDICTED: eukaryotic initiation factor 4A-14      342   1e-108   
ref|XP_009135344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    330   2e-108   Brassica rapa
ref|XP_006307670.1|  hypothetical protein CARUB_v10009297mg             330   2e-108   Capsella rubella
gb|KEH32495.1|  DEAD-box ATP-dependent RNA helicase                     330   3e-108   Medicago truncatula
ref|XP_010552222.1|  PREDICTED: eukaryotic initiation factor 4A-1...    322   3e-108   Tarenaya hassleriana [spider flower]
ref|XP_006646878.1|  PREDICTED: eukaryotic initiation factor 4A-3...    329   3e-108   Oryza brachyantha
ref|XP_006357392.1|  PREDICTED: eukaryotic initiation factor 4A-8...    329   4e-108   
ref|XP_002884997.1|  predicted protein                                  329   4e-108   Arabidopsis lyrata subsp. lyrata
emb|CDY10607.1|  BnaC03g70070D                                          329   4e-108   Brassica napus [oilseed rape]
emb|CDX75739.1|  BnaC03g38220D                                          330   5e-108   
ref|XP_003574572.1|  PREDICTED: eukaryotic initiation factor 4A-1...    329   5e-108   Brachypodium distachyon [annual false brome]
ref|XP_009334734.1|  PREDICTED: eukaryotic initiation factor 4A-1...    329   5e-108   
ref|NP_001045878.1|  Os02g0146600                                       329   5e-108   
ref|XP_010536184.1|  PREDICTED: eukaryotic initiation factor 4A-9...    328   6e-108   Tarenaya hassleriana [spider flower]
ref|XP_006369263.1|  hypothetical protein POPTR_0001s20480g             328   7e-108   
ref|XP_006407149.1|  hypothetical protein EUTSA_v10020824mg             328   7e-108   
ref|XP_002451536.1|  hypothetical protein SORBIDRAFT_04g003390          328   8e-108   Sorghum bicolor [broomcorn]
emb|CDY39079.1|  BnaA01g29770D                                          328   8e-108   Brassica napus [oilseed rape]
gb|EYU45869.1|  hypothetical protein MIMGU_mgv1a007331mg                328   1e-107   Erythranthe guttata [common monkey flower]
emb|CDY55205.1|  BnaCnng28430D                                          328   1e-107   Brassica napus [oilseed rape]
ref|XP_009107078.1|  PREDICTED: eukaryotic initiation factor 4A-1       328   1e-107   Brassica rapa
ref|XP_006392695.1|  hypothetical protein EUTSA_v10011528mg             328   1e-107   Eutrema salsugineum [saltwater cress]
emb|CDY08220.1|  BnaA05g13990D                                          328   1e-107   Brassica napus [oilseed rape]
ref|NP_001151064.1|  LOC100284697                                       328   1e-107   Zea mays [maize]
sp|Q41741.1|IF4A_MAIZE  RecName: Full=Eukaryotic initiation facto...    328   1e-107   Zea mays [maize]
emb|CDX97528.1|  BnaA05g25510D                                          328   1e-107   
gb|AAL91176.1|  eukaryotic translation initiation factor                327   2e-107   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56988.1|  AT3G13920                                              327   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63951.1|  Eukaryotic initiation factor 4A, putative               327   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566469.1|  translational initiation factor 4A-1                  327   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AFW69337.1|  putative DEAD-box ATP-dependent RNA helicase fami...    327   2e-107   
gb|EPS63850.1|  hypothetical protein M569_10933                         327   3e-107   Genlisea aurea
emb|CDP03140.1|  unnamed protein product                                327   3e-107   Coffea canephora [robusta coffee]
ref|XP_010480021.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   4e-107   Camelina sativa [gold-of-pleasure]
ref|XP_009334732.1|  PREDICTED: eukaryotic initiation factor 4A-6...    327   4e-107   
ref|XP_009334735.1|  PREDICTED: eukaryotic initiation factor 4A-6...    327   4e-107   
ref|XP_011046150.1|  PREDICTED: eukaryotic initiation factor 4A-8...    326   5e-107   Populus euphratica
ref|XP_002514133.1|  dead box ATP-dependent RNA helicase, putative      337   5e-107   
ref|XP_010462344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    326   6e-107   
ref|NP_001030693.1|  translational initiation factor 4A-1               326   7e-107   
ref|XP_010542416.1|  PREDICTED: eukaryotic initiation factor 4A-1       325   9e-107   Tarenaya hassleriana [spider flower]
ref|XP_009598422.1|  PREDICTED: eukaryotic initiation factor 4A-9...    318   1e-106   Nicotiana tomentosiformis
ref|XP_010534921.1|  PREDICTED: eukaryotic initiation factor 4A-1       325   1e-106   Tarenaya hassleriana [spider flower]
ref|XP_008242400.1|  PREDICTED: eukaryotic initiation factor 4A-2       337   1e-106   
ref|XP_009117360.1|  PREDICTED: eukaryotic initiation factor 4A-1...    325   2e-106   Brassica rapa
dbj|BAE98559.1|  eukaryotic protein synthesis initiation factor 4A      324   4e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146433.1|  PREDICTED: eukaryotic initiation factor 4A-1...    324   4e-106   Brassica rapa
ref|XP_004486853.1|  PREDICTED: eukaryotic initiation factor 4A-1...    324   5e-106   Cicer arietinum [garbanzo]
ref|XP_001786409.1|  predicted protein                                  316   6e-106   
ref|XP_010324046.1|  PREDICTED: eukaryotic initiation factor 4A-9...    323   8e-106   Solanum lycopersicum
ref|XP_002891805.1|  predicted protein                                  323   9e-106   Arabidopsis lyrata subsp. lyrata
ref|XP_009147530.1|  PREDICTED: eukaryotic initiation factor 4A-1       323   9e-106   Brassica rapa
emb|CDY24057.1|  BnaA06g00550D                                          323   1e-105   Brassica napus [oilseed rape]
ref|NP_175829.1|  eukaryotic initiation factor 4A-2                     322   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090077.1|  Eukaryotic initiation factor 4A-15                 333   9e-105   
emb|CDY33073.1|  BnaC06g07060D                                          320   1e-104   Brassica napus [oilseed rape]
ref|XP_001783934.1|  predicted protein                                  320   2e-104   
gb|ABR18348.1|  unknown                                                 320   2e-104   Picea sitchensis
ref|XP_001758216.1|  predicted protein                                  320   2e-104   
gb|AAN74636.1|  DEAD box RNA helicase                                   319   4e-104   Pisum sativum [garden pea]
ref|XP_001765568.1|  predicted protein                                  318   6e-104   
emb|CDY49861.1|  BnaA02g16100D                                          319   7e-104   Brassica napus [oilseed rape]
ref|XP_011470735.1|  PREDICTED: eukaryotic initiation factor 4A-9       329   1e-103   Fragaria vesca subsp. vesca
emb|CDY53867.1|  BnaC02g46260D                                          318   1e-103   Brassica napus [oilseed rape]
ref|XP_009127948.1|  PREDICTED: eukaryotic initiation factor 4A-3...    317   2e-103   Brassica rapa
ref|XP_001771324.1|  predicted protein                                  317   3e-103   
gb|AAL69381.1|AF462218_1  putative DEAD/DEAH box helicase               307   4e-103   Narcissus pseudonarcissus
ref|XP_009779503.1|  PREDICTED: eukaryotic initiation factor 4A-9...    314   3e-102   Nicotiana sylvestris
ref|XP_006390626.1|  hypothetical protein EUTSA_v10018626mg             314   3e-102   Eutrema salsugineum [saltwater cress]
gb|ABS19813.1|  eukaryotic initiation factor 4A                         311   4e-102   Lolium perenne [perennial ryegrass]
ref|XP_004508240.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    324   2e-101   
gb|ACA24135.1|  eukaryotic initiation factor 4A                         310   2e-101   Lolium temulentum
ref|XP_006302320.1|  hypothetical protein CARUB_v10020373mg             311   3e-101   Capsella rubella
ref|XP_009105938.1|  PREDICTED: eukaryotic initiation factor 4A-3       311   3e-101   Brassica rapa
ref|XP_009127949.1|  PREDICTED: eukaryotic initiation factor 4A-3...    311   4e-101   Brassica rapa
emb|CDX72939.1|  BnaC06g33870D                                          313   5e-101   
ref|NP_001189885.1|  translational initiation factor 4A-1               310   9e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334736.1|  PREDICTED: eukaryotic initiation factor 4A-6...    309   2e-100   
dbj|BAB21258.1|  eukaryotic initiation factor 4A                        309   3e-100   Oryza sativa [red rice]
emb|CDY68148.1|  BnaA07g38930D                                          318   4e-100   Brassica napus [oilseed rape]
ref|XP_010416036.1|  PREDICTED: eukaryotic initiation factor 4A-3       308   5e-100   Camelina sativa [gold-of-pleasure]
gb|ABS19814.1|  eukaryotic initiation factor 4A                         306   5e-100   Lolium perenne [perennial ryegrass]
ref|XP_002966250.1|  hypothetical protein SELMODRAFT_85554              305   8e-99    
ref|NP_001185220.1|  eukaryotic initiation factor 4A-2                  305   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002524306.1|  dead box ATP-dependent RNA helicase, putative      304   2e-98    
ref|NP_177417.1|  eukaryotic initiation factor 4A-3                     303   6e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CAA09211.1|  RNA helicase                                           304   7e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888890.1|  predicted protein                                  303   7e-98    Arabidopsis lyrata subsp. lyrata
gb|KEH39505.1|  DEAD-box ATP-dependent RNA helicase                     298   5e-96    Medicago truncatula
gb|ACN40356.1|  unknown                                                 297   9e-96    Picea sitchensis
ref|XP_009624937.1|  PREDICTED: eukaryotic initiation factor 4A-8...    296   1e-95    Nicotiana tomentosiformis
ref|XP_009132534.1|  PREDICTED: eukaryotic initiation factor 4A-1...    295   5e-95    Brassica rapa
ref|NP_001078148.1|  translational initiation factor 4A-1               294   1e-94    Arabidopsis thaliana [mouse-ear cress]
gb|ACN40838.1|  unknown                                                 295   1e-94    Picea sitchensis
gb|ACN40422.1|  unknown                                                 294   3e-94    Picea sitchensis
ref|XP_002982302.1|  hypothetical protein SELMODRAFT_228839             293   4e-94    
ref|XP_002966232.1|  hypothetical protein SELMODRAFT_143895             292   1e-93    Selaginella moellendorffii
gb|ACJ85073.1|  unknown                                                 285   2e-91    Medicago truncatula
ref|XP_005644820.1|  eukaryotic initiation factor 4A-like protein       283   6e-90    Coccomyxa subellipsoidea C-169
ref|XP_005845171.1|  eukaryotic initiation factor 4A (ATP-depende...    281   3e-89    
ref|XP_003058151.1|  predicted protein                                  280   5e-89    
ref|XP_002499673.1|  hypothetical protein MICPUN_106753                 280   5e-89    
gb|AFC88837.1|  initiation factor 4A-3-like protein                     276   1e-87    
emb|CDY32586.1|  BnaC03g15540D                                          275   3e-87    
gb|AID52925.1|  initiation factor eIF4A                                 268   4e-86    
emb|CDY11154.1|  BnaC06g24060D                                          265   5e-86    
emb|CEF98795.1|  Helicase, C-terminal                                   271   1e-85    
ref|XP_001691452.1|  eukaryotic initiation factor 4A-like protein       271   2e-85    
gb|KIZ04417.1|  Eukaryotic initiation factor 4A-3                       271   5e-85    
ref|XP_007513631.1|  predicted protein                                  270   7e-85    
ref|XP_002951303.1|  hypothetical protein VOLCADRAFT_120953             269   1e-84    
gb|KDD74664.1|  DEAD/DEAH box helicase                                  268   6e-84    
ref|XP_010501104.1|  PREDICTED: eukaryotic initiation factor 4A-1...    265   2e-83    
gb|KDO65151.1|  hypothetical protein CISIN_1g015129mg                   264   3e-83    
ref|XP_001418972.1|  predicted protein                                  265   4e-83    
ref|XP_010552227.1|  PREDICTED: eukaryotic initiation factor 4A-1       263   4e-83    
emb|CDP15708.1|  unnamed protein product                                261   6e-83    
gb|AFJ42571.1|  elongation initiation factor 4A                         261   1e-82    
emb|CAC43286.1|  translation initiation factor eIF-4A1                  262   1e-82    
ref|XP_011398174.1|  Eukaryotic initiation factor 4A-10                 263   2e-82    
gb|AAK83983.1|AF393811_1  eukaryotic initiation factor 4A -like p...    238   3e-76    
ref|XP_006279086.1|  hypothetical protein CARUB_v10012714mg             245   3e-75    
ref|XP_010514906.1|  PREDICTED: eukaryotic initiation factor 4A-2...    240   1e-73    
ref|XP_009764706.1|  PREDICTED: eukaryotic initiation factor 4A-6...    239   2e-73    
gb|AFY99066.1|  translation initiation factor                           229   3e-73    
gb|KJB65515.1|  hypothetical protein B456_010G098500                    238   4e-73    
gb|AAF19805.1|  EIF4A protein                                           237   6e-73    
gb|AFY99065.1|  translation initiation factor                           228   1e-72    
gb|AFY99067.1|  translation initiation factor                           228   1e-72    
ref|XP_010533343.1|  PREDICTED: eukaryotic initiation factor 4A-1...    236   2e-72    
ref|XP_004489750.1|  PREDICTED: eukaryotic initiation factor 4A-8...    225   2e-70    
ref|XP_006300238.1|  hypothetical protein CARUB_v10016478mg             231   1e-69    
gb|ACJ84368.1|  unknown                                                 214   5e-67    
ref|NP_001091916.1|  eukaryotic initiation factor 4a                    223   7e-67    
gb|AFP57571.1|  eukaryotic initiation factor 4A                         218   1e-66    
ref|XP_003747632.1|  PREDICTED: eukaryotic initiation factor 4A-I...    222   1e-66    
ref|NP_001177648.1|  eukaryotic initiation factor 4a                    221   8e-66    
emb|CBI20639.3|  unnamed protein product                                210   2e-65    
dbj|BAN20868.1|  eukaryotic initiation factor 4a                        219   3e-65    
ref|XP_006219988.1|  PREDICTED: eukaryotic initiation factor 4A-like    214   4e-65    
gb|EFX83683.1|  hypothetical protein DAPPUDRAFT_230663                  219   4e-65    
gb|KIH56011.1|  DEAD/DEAH box helicase                                  214   7e-65    
dbj|BAM17712.1|  eukaryotic initiation factor 4a                        218   8e-65    
ref|XP_006825894.1|  PREDICTED: eukaryotic initiation factor 4A-I...    218   9e-65    
gb|AII97883.1|  BLTX517                                                 215   1e-64    
gb|KDR15558.1|  Eukaryotic initiation factor 4A-II                      218   1e-64    
gb|KHN88002.1|  Eukaryotic initiation factor 4A                         217   1e-64    
gb|AFY99068.1|  translation initiation factor                           207   1e-64    
gb|KFM75183.1|  Eukaryotic initiation factor 4A-I                       217   1e-64    
emb|CDJ93494.1|  DNA RNA helicase domain containing protein             213   2e-64    
gb|EFA03968.1|  hypothetical protein TcasGA2_TC014113                   219   2e-64    
ref|XP_010234049.1|  PREDICTED: ATP-dependent RNA helicase drs1-like    226   2e-64    
ref|XP_002407236.1|  translation initiation factor 4F, helicase s...    217   2e-64    
ref|XP_002516092.1|  dead box ATP-dependent RNA helicase, putative      214   2e-64    
ref|XP_002163229.1|  PREDICTED: eukaryotic initiation factor 4A-I...    216   3e-64    
emb|CCJ09440.1|  eukaryotic initiation factor 4A                        216   3e-64    
gb|ABY66383.1|  eukaryotic initiation factor 4A                         216   4e-64    
ref|XP_009020682.1|  hypothetical protein HELRODRAFT_112831             217   4e-64    
gb|EHJ75348.1|  eukaryotic initiation factor 4A                         215   4e-64    
ref|XP_007764392.1|  DEAD-domain-containing protein                     215   5e-64    
gb|KFM62051.1|  Eukaryotic initiation factor 4A-II                      216   6e-64    
gb|EKG22315.1|  RNA helicase ATP-dependent DEAD-box conserved site      215   6e-64    
gb|EYB84565.1|  hypothetical protein Y032_0314g2232                     214   8e-64    
gb|AGK45314.2|  eukaryotic initiation factor 4A                         215   8e-64    
ref|XP_002424727.1|  eukaryotic initiation factor 4A-II, putative       216   9e-64    
ref|XP_007217768.1|  hypothetical protein PRUPE_ppa014802mg             214   1e-63    
gb|EYB84563.1|  hypothetical protein Y032_0314g2232                     214   1e-63    
gb|AAV84216.1|  elongation factor 4A                                    209   1e-63    
gb|ENN77191.1|  hypothetical protein YQE_06329                          214   1e-63    
ref|XP_011421101.1|  PREDICTED: eukaryotic initiation factor 4A-I...    211   1e-63    
gb|AHK26791.1|  eukaryotic translation initiation factor 4A             214   1e-63    
gb|KDR69281.1|  hypothetical protein GALMADRAFT_256112                  214   1e-63    
gb|KJA24162.1|  hypothetical protein HYPSUDRAFT_38930                   214   2e-63    
ref|XP_002065355.1|  GK14711                                            214   2e-63    
gb|EYC01872.1|  hypothetical protein Y032_0103g3516                     214   2e-63    
gb|EYB84564.1|  hypothetical protein Y032_0314g2232                     214   2e-63    
gb|ABF51379.1|  eukaryotic translation initiation factor 4A             214   2e-63    
dbj|BAH71323.1|  ACYPI002483                                            208   2e-63    
gb|KIJ15730.1|  hypothetical protein PAXINDRAFT_11322                   214   2e-63    
emb|CCQ18648.1|  Translation initiation factor 4F, helicase subunit     215   2e-63    
gb|AEE61546.1|  unknown                                                 214   3e-63    
ref|NP_001037376.1|  eukaryotic translation initiation factor 4A        214   3e-63    
ref|XP_002051383.1|  GJ15436                                            214   3e-63    
ref|XP_001968873.1|  GG25110                                            213   3e-63    
ref|XP_011052523.1|  PREDICTED: eukaryotic initiation factor 4A-I       214   3e-63    
emb|CCF72996.1|  unnamed protein product                                214   3e-63    
ref|XP_001962722.1|  GF15595                                            213   3e-63    
ref|XP_011151421.1|  PREDICTED: eukaryotic initiation factor 4A-I       214   3e-63    
ref|XP_002002717.1|  GI17537                                            213   3e-63    
ref|XP_011258665.1|  PREDICTED: eukaryotic initiation factor 4A-I       214   3e-63    
gb|ERL87143.1|  hypothetical protein D910_04543                         214   3e-63    
ref|XP_011176133.1|  PREDICTED: eukaryotic initiation factor 4A-I       214   4e-63    
ref|XP_001841147.1|  ATP-dependent RNA helicase eIF4A                   213   4e-63    
ref|XP_003492849.1|  PREDICTED: eukaryotic initiation factor 4A-l...    214   4e-63    
ref|XP_003705530.1|  PREDICTED: eukaryotic initiation factor 4A-I...    213   5e-63    
ref|XP_002038023.1|  GM18587                                            213   5e-63    
ref|XP_001988166.1|  GH11018                                            213   5e-63    
gb|ACV88438.1|  AT04852p                                                213   5e-63    
ref|XP_007263911.1|  DEAD-domain-containing protein                     213   5e-63    
gb|ADA53586.1|  RE22480p                                                213   6e-63    
ref|NP_476595.1|  eukaryotic initiation factor 4a, isoform C            213   6e-63    
ref|XP_002089150.1|  eIF-4a                                             213   7e-63    
ref|XP_001357204.2|  GA21521                                            213   7e-63    
ref|XP_741188.1|  RNA helicase-1                                        207   8e-63    
gb|EJT98479.1|  DEAD-domain-containing protein                          212   8e-63    
ref|XP_008547801.1|  PREDICTED: eukaryotic initiation factor 4A-I...    213   8e-63    
gb|KIJ59695.1|  hypothetical protein HYDPIDRAFT_118189                  212   1e-62    
gb|KIN99522.1|  hypothetical protein M404DRAFT_1004624                  209   1e-62    
ref|XP_623285.1|  PREDICTED: eukaryotic initiation factor 4A-like...    212   1e-62    
gb|KIK19856.1|  hypothetical protein PISMIDRAFT_682778                  211   1e-62    
ref|XP_007587937.1|  putative atp-dependent rna helicase eif4a pr...    211   1e-62    
gb|AII97731.1|  BLTX345                                                 206   1e-62    
emb|CEG64572.1|  Putative ATP-dependent RNA helicase eIF4A              211   1e-62    
ref|XP_011335460.1|  PREDICTED: eukaryotic initiation factor 4A-I       212   2e-62    
ref|XP_007322327.1|  hypothetical protein SERLADRAFT_476444             211   2e-62    
ref|XP_007849642.1|  eukaryotic translation initiation factor           211   2e-62    
ref|XP_003740341.1|  PREDICTED: eukaryotic initiation factor 4A-I...    211   2e-62    
gb|KIP08860.1|  hypothetical protein PHLGIDRAFT_103669                  211   2e-62    
ref|XP_002840305.1|  hypothetical protein                               213   2e-62    
ref|XP_007862988.1|  DEAD-domain-containing protein                     211   2e-62    
gb|KDQ33091.1|  hypothetical protein PLEOSDRAFT_1091325                 211   2e-62    
gb|KIL66550.1|  hypothetical protein M378DRAFT_160543                   211   2e-62    
ref|XP_003137738.1|  hypothetical protein LOAG_02152                    211   2e-62    
gb|KIM36462.1|  hypothetical protein M413DRAFT_449165                   211   2e-62    
ref|XP_008214369.1|  PREDICTED: eukaryotic initiation factor 4A-I       211   3e-62    
emb|CDP92497.1|  Protein Bm13696, isoform c                             211   3e-62    
ref|XP_007395441.1|  hypothetical protein PHACADRAFT_255471             211   3e-62    
ref|XP_007872333.1|  hypothetical protein PNEG_00452                    211   4e-62    
gb|ELU06081.1|  hypothetical protein CAPTEDRAFT_202865                  211   4e-62    
gb|EJW88714.1|  eukaryotic initiation factor 4A                         211   4e-62    
ref|XP_007385315.1|  DEAD-domain-containing protein                     210   4e-62    
ref|XP_005102822.1|  PREDICTED: eukaryotic initiation factor 4A-I...    211   4e-62    
ref|XP_001894230.1|  eukaryotic initiation factor 4A                    211   4e-62    
gb|EIE77597.1|  ATP-dependent RNA helicase eIF4A                        210   5e-62    
ref|XP_008560387.1|  PREDICTED: eukaryotic initiation factor 4A-I...    210   5e-62    
gb|KIY65566.1|  DEAD-domain-containing protein                          210   5e-62    
emb|CEF62867.1|  Eukaryotic initiation factor 4A-II                     210   6e-62    
ref|XP_001877515.1|  predicted protein                                  210   6e-62    
ref|XP_001348829.1|  helicase 45                                        210   6e-62    
gb|KIJ98728.1|  hypothetical protein K443DRAFT_680564                   210   6e-62    
ref|XP_001656675.1|  AAEL013359-PA                                      208   7e-62    
ref|XP_008813934.1|  eukaryotic initiation factor 4A                    210   7e-62    
emb|CDQ56285.1|  unnamed protein product                                210   7e-62    
ref|XP_004365945.1|  eukaryotic translation initiation factor 4A ...    210   8e-62    
ref|XP_002260177.1|  RNA helicase                                       209   8e-62    
ref|XP_011214566.1|  PREDICTED: eukaryotic initiation factor 4A i...    208   8e-62    
ref|XP_006457710.1|  hypothetical protein AGABI2DRAFT_190148            209   8e-62    
gb|ETW15723.1|  eukaryotic initiation factor 4A                         209   8e-62    
ref|XP_001615701.1|  RNA helicase-1                                     209   8e-62    
gb|ETW33322.1|  eukaryotic initiation factor 4A                         210   9e-62    
pdb|3BOR|A  Chain A, Crystal Structure Of The Deadc Domain Of Hum...    204   9e-62    
ref|XP_002175853.1|  translation initiation factor eIF4A                209   9e-62    
prf||1912301A  initiation factor eIF-4A                                 209   9e-62 
emb|CAA48790.1|  eukaryotic translation initiation factor 4A (eIF...    209   9e-62    
ref|XP_005771275.1|  hypothetical protein EMIHUDRAFT_413872             209   9e-62    
ref|XP_002186399.1|  predicted protein                                  209   1e-61    
gb|ETW39547.1|  eukaryotic initiation factor 4A                         210   1e-61    
gb|KIK51374.1|  hypothetical protein GYMLUDRAFT_50610                   209   1e-61    
ref|XP_007884153.1|  PREDICTED: eukaryotic initiation factor 4A-I...    209   1e-61    
emb|CBJ30606.1|  eukaryotic initiation factor 4A                        209   1e-61    
ref|XP_001952053.1|  PREDICTED: eukaryotic initiation factor 4A         209   1e-61    
ref|XP_005179420.1|  PREDICTED: eukaryotic initiation factor 4A i...    209   2e-61    
gb|KIY49064.1|  DEAD-domain-containing protein                          209   2e-61    
gb|EDL78075.1|  eukaryotic translation initiation factor 4A2, iso...    202   2e-61    
ref|XP_011499518.1|  PREDICTED: eukaryotic initiation factor 4A-I...    209   2e-61    
gb|KFH74007.1|  ATP-dependent RNA helicase eIF4A                        209   2e-61    
ref|XP_011499517.1|  PREDICTED: eukaryotic initiation factor 4A-I...    209   2e-61    
gb|KIK46486.1|  hypothetical protein CY34DRAFT_105003                   209   2e-61    
gb|EMS64960.1|  Eukaryotic initiation factor 4A-7                       210   2e-61    
ref|XP_004519345.1|  PREDICTED: eukaryotic initiation factor 4A-like    209   2e-61    
ref|XP_001656674.1|  AAEL013359-PC                                      209   2e-61    
ref|XP_007338791.1|  DEAD-domain-containing protein                     208   2e-61    
gb|KIW32961.1|  ATP-dependent RNA helicase eIF4A                        208   2e-61    
gb|KIJ44244.1|  hypothetical protein M422DRAFT_207888                   208   2e-61    
ref|XP_007746836.1|  ATP-dependent RNA helicase eIF4A                   208   2e-61    
gb|KIM22949.1|  hypothetical protein M408DRAFT_332625                   208   2e-61    
ref|XP_011106219.1|  hypothetical protein H072_227                      208   3e-61    
ref|XP_008477775.1|  PREDICTED: eukaryotic initiation factor 4A-I...    204   3e-61    
gb|ETE63526.1|  Eukaryotic initiation factor 4A-II                      206   3e-61    
ref|XP_001637288.1|  predicted protein                                  208   3e-61    
ref|XP_001843031.1|  DEAD box ATP-dependent RNA helicase                208   3e-61    
emb|CDJ95865.1|  DNA RNA helicase domain containing protein             202   3e-61    
emb|CCM00505.1|  predicted protein                                      208   3e-61    
gb|KDQ61301.1|  hypothetical protein JAAARDRAFT_173948                  207   4e-61    
ref|XP_005895572.1|  PREDICTED: eukaryotic initiation factor 4A-I...    204   4e-61    
ref|XP_009690141.1|  eukaryotic translation initiation factor 4a        207   5e-61    
gb|KIO29151.1|  hypothetical protein M407DRAFT_172794                   207   5e-61    
ref|XP_006262091.1|  PREDICTED: eukaryotic initiation factor 4A-II      207   5e-61    
gb|KEQ65229.1|  ATP-dependent RNA helicase eIF4A                        207   6e-61    
ref|XP_007071060.1|  PREDICTED: eukaryotic initiation factor 4A-I...    207   6e-61    
ref|XP_003652371.1|  hypothetical protein THITE_2154358                 207   6e-61    
ref|XP_005506650.1|  PREDICTED: eukaryotic initiation factor 4A-II      207   6e-61    
gb|KIM58555.1|  hypothetical protein SCLCIDRAFT_1218503                 207   6e-61    
emb|CCX04626.1|  Similar to ATP-dependent RNA helicase eIF4A; acc...    215   6e-61    
gb|KEQ77136.1|  ATP-dependent RNA helicase eIF4A                        207   6e-61    
ref|XP_004078949.1|  PREDICTED: eukaryotic initiation factor 4A-I...    207   6e-61    
ref|XP_007292698.1|  eukaryotic initiation factor 4A                    208   6e-61    
ref|XP_010395597.1|  PREDICTED: eukaryotic initiation factor 4A-II      207   7e-61    
ref|XP_006637457.1|  PREDICTED: eukaryotic initiation factor 4A-I...    207   7e-61    
ref|XP_009074201.1|  PREDICTED: eukaryotic initiation factor 4A-II      207   7e-61    
ref|XP_006637458.1|  PREDICTED: eukaryotic initiation factor 4A-I...    207   7e-61    
gb|KEZ44358.1|  hypothetical protein SAPIO_CDS3338                      207   7e-61    
ref|XP_003035589.1|  hypothetical protein SCHCODRAFT_65225              207   7e-61    
gb|EPQ64771.1|  Translation initiation factor eIF4A                     207   7e-61    
gb|EMD38112.1|  hypothetical protein CERSUDRAFT_113245                  207   7e-61    
ref|XP_007300805.1|  DEAD-domain-containing protein                     207   8e-61    
ref|XP_009543077.1|  hypothetical protein HETIRDRAFT_407963             207   8e-61    
ref|XP_676472.1|  RNA helicase-1                                        207   8e-61    
ref|XP_009018486.1|  hypothetical protein HELRODRAFT_185641             208   8e-61    
gb|ETB63014.1|  eukaryotic initiation factor 4A                         207   9e-61    
ref|XP_005024716.1|  PREDICTED: eukaryotic initiation factor 4A-I...    206   9e-61    
ref|XP_008622240.1|  eukaryotic initiation factor 4A                    207   1e-60    
gb|EFA77714.1|  DEAD/DEAH box helicase domain-containing protein        207   1e-60    
ref|XP_007779635.1|  ATP-dependent RNA helicase eIF4A                   207   1e-60    
ref|XP_645917.1|  DEAD/DEAH box helicase domain-containing protein      206   1e-60    
ref|XP_764692.1|  RNA helicase-1                                        207   1e-60    
ref|XP_952588.1|  eukaryotic translation initiation factor 4a           207   1e-60    
gb|EJT47897.1|  translation initiation factor                           206   1e-60    
ref|XP_005644822.1|  eukaryotic initiation factor 4A-11                 206   1e-60    
emb|CDJ41799.1|  eukaryotic translation initiation factor 4a, put...    207   1e-60    



>ref|XP_009593905.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
tomentosiformis]
Length=207

 Score =   347 bits (889),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+DSFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYDSFDAMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009757031.1| PREDICTED: eukaryotic initiation factor 4A-9 [Nicotiana sylvestris]
Length=413

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+DSFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYDSFDAMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002324737.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|ABK92554.1| unknown [Populus trichocarpa]
 gb|EEF03302.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D+KM ELLT +GQ+FFTSYDEV+D+FDAMGLKENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDSKMNELLTTDGQDFFTSYDEVYDTFDAMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010927213.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Elaeis guineensis]
Length=413

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010929386.1| PREDICTED: eukaryotic initiation factor 4A-2 [Elaeis guineensis]
Length=413

 Score =   349 bits (896),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_011019413.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
 ref|XP_011019414.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
Length=413

 Score =   349 bits (896),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA +APEGSQFDARQ+D+KM ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSKMNELLTTEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010925445.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   349 bits (895),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELLT +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNELLTQDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_011038130.1| PREDICTED: eukaryotic initiation factor 4A-15 [Populus euphratica]
Length=413

 Score =   348 bits (893),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D+KM ELLT + Q+FFTSYDEV+D+FDAMGLKENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDSKMNELLTTDAQDFFTSYDEVYDTFDAMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008798133.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
 ref|XP_008798134.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
Length=413

 Score =   348 bits (893),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGIAPEGSQFDARQYDSKMNELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|ABK93239.1| unknown [Populus trichocarpa]
Length=413

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA +APEGSQFDARQ+D++M ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSRMNELLTAEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002308545.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|EEE92068.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   348 bits (892),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA +APEGSQFDARQ+D++M ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSRMNELLTAEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_011100200.1| PREDICTED: eukaryotic initiation factor 4A-14 [Sesamum indicum]
Length=413

 Score =   347 bits (891),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQ+DARQYDAKM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDARQYDAKMDELLGTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNIVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_011081667.1| PREDICTED: eukaryotic initiation factor 4A-2 [Sesamum indicum]
Length=413

 Score =   347 bits (891),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQ+DAKM ELL  +G+EFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDAKMNELLGTDGEEFFTSYDEVYNSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>sp|Q40471.1|IF4A9_TOBAC RecName: Full=Eukaryotic initiation factor 4A-9; Short=eIF-4A-9; 
AltName: Full=ATP-dependent RNA helicase eIF4A-9 [Nicotiana 
tabacum]
 emb|CAA55736.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   347 bits (891),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+ SFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYHSFDAMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_003533770.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX1 
[Glycine max]
 ref|XP_003533771.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX2 
[Glycine max]
 ref|XP_006587022.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Glycine max]
 gb|KHN35869.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   347 bits (890),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGIAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010929385.1| PREDICTED: eukaryotic initiation factor 4A-15 [Elaeis guineensis]
Length=413

 Score =   347 bits (890),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNDLLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006597014.1| PREDICTED: uncharacterized protein LOC100786735 isoform X1 [Glycine 
max]
 ref|XP_006597015.1| PREDICTED: uncharacterized protein LOC100786735 isoform X2 [Glycine 
max]
 ref|XP_006597016.1| PREDICTED: uncharacterized protein LOC100786735 isoform X3 [Glycine 
max]
Length=457

 Score =   348 bits (894),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            VMAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  44   VMAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  103

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRE
Sbjct  104  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTRE  163

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  164  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  223



>ref|XP_010915249.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   347 bits (889),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM ELLT +GQEFFT+YDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDSKMNELLTQDGQEFFTTYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KHN28839.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   347 bits (889),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|AFC90091.1| eukaryotic initiation factor 4A-14 [Nicotiana benthamiana]
Length=413

 Score =   347 bits (889),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010242273.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nelumbo nucifera]
Length=413

 Score =   347 bits (889),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELLT +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMSELLTSDGQDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004245077.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
 ref|XP_006351592.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Solanum tuberosum]
Length=413

 Score =   346 bits (887),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>sp|Q40466.1|IF413_TOBAC RecName: Full=Eukaryotic initiation factor 4A-13; Short=eIF-4A-13; 
AltName: Full=ATP-dependent RNA helicase eIF4A-13, partial 
[Nicotiana tabacum]
 emb|CAA55741.1| unnamed protein product [Nicotiana tabacum]
Length=355

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|NP_001242064.1| uncharacterized protein LOC100786735 [Glycine max]
 gb|ACU18275.1| unknown [Glycine max]
Length=413

 Score =   345 bits (886),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL++NLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQDNLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008801403.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
 ref|XP_008801404.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
Length=413

 Score =   345 bits (885),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVTPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008782542.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008782543.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   345 bits (885),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGSQFDARQYD KM ELLT +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLVPEGSQFDARQYDTKMNELLTQDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|ACU22915.1| unknown [Glycine max]
Length=225

 Score =   338 bits (866),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  178



>ref|XP_009597977.1| PREDICTED: eukaryotic initiation factor 4A-15 [Nicotiana tomentosiformis]
Length=413

 Score =   345 bits (884),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQ+D+KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDSKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008220506.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Prunus mume]
Length=413

 Score =   345 bits (884),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  APEGSQFDARQYDAKM ELL  +GQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDARQYDAKMSELLGADGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALPDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002521376.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF41044.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=413

 Score =   344 bits (883),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYDAKM ELL+ EGQEFFT+YDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDAKMSELLSTEGQEFFTTYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009764703.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764704.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   344 bits (883),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQ+D KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDTKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006342504.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=413

 Score =   344 bits (883),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG+APEGSQFDARQ+DAKM ELL  E QEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|EYU29343.1| hypothetical protein MIMGU_mgv1a007274mg [Erythranthe guttata]
Length=413

 Score =   344 bits (882),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA AAPEGSQFDARQ+DAKM E+L  EG EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQFDAKMNEILGAEGDEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGT VREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTVVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009784285.1| PREDICTED: eukaryotic initiation factor 4A-14 [Nicotiana sylvestris]
Length=413

 Score =   344 bits (882),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009780782.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Nicotiana 
sylvestris]
Length=413

 Score =   344 bits (882),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009604758.1| PREDICTED: eukaryotic initiation factor 4A-10 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   344 bits (882),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>emb|CBI27885.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   344 bits (882),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>sp|P41382.1|IF410_TOBAC RecName: Full=Eukaryotic initiation factor 4A-10; Short=eIF-4A-10; 
AltName: Full=ATP-dependent RNA helicase eIF4A-10 [Nicotiana 
tabacum]
 emb|CAA55642.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55641.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   344 bits (882),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>sp|Q40470.1|IF4A7_TOBAC RecName: Full=Eukaryotic initiation factor 4A-7; Short=eIF-4A-7; 
AltName: Full=ATP-dependent RNA helicase eIF4A-7 [Nicotiana 
tabacum]
 emb|CAA55738.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   344 bits (882),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009604756.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604757.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604759.1| PREDICTED: eukaryotic initiation factor 4A-7 isoform X2 [Nicotiana 
tomentosiformis]
Length=413

 Score =   343 bits (881),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>sp|Q40467.1|IF414_TOBAC RecName: Full=Eukaryotic initiation factor 4A-14; Short=eIF-4A-14; 
AltName: Full=ATP-dependent RNA helicase eIF4A-14 [Nicotiana 
tabacum]
 emb|CAA55742.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   343 bits (881),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004303662.1| PREDICTED: eukaryotic initiation factor 4A-8 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFDA+QYD+KM E+L+ EGQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGAQFDAKQYDSKMNEILSSEGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>sp|P41379.1|IF4A2_NICPL RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2 [Nicotiana 
plumbaginifolia]
 emb|CAA43513.1| nicotiana eukaryotic translation initiation factor 4A [Nicotiana 
plumbaginifolia]
Length=413

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG+APEGSQFDARQ+DAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_003522265.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN29706.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004291063.1| PREDICTED: eukaryotic initiation factor 4A-2 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFD RQYDAKM ELL  +GQ+FFTSYDEVHDSFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDTRQYDAKMTELLGSDGQDFFTSYDEVHDSFDVMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMLDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQR+LSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRVLSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010094955.1| Eukaryotic initiation factor 4A-13 [Morus notabilis]
 gb|EXB57648.1| Eukaryotic initiation factor 4A-13 [Morus notabilis]
Length=248

 Score =   337 bits (864),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGSQFDARQYDAKM ELL  +G +FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVVPEGSQFDARQYDAKMNELLGSDGSDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>emb|CAN70196.1| hypothetical protein VITISV_040309 [Vitis vinifera]
Length=410

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004253093.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
Length=413

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG+APEGSQFDARQ+DAKM ELL  E Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KDP33852.1| hypothetical protein JCGZ_07423 [Jatropha curcas]
Length=413

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYD+KM ELL  +G++FFT+YDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMNELLATDGEDFFTTYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>emb|CDO97887.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD +M+ELL+ +GQ+FFTSYDEVHD+FDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDTRMKELLSADGQDFFTSYDEVHDTFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILLAGVHVVVGTPGRVFDMLRRQSLR  179



>sp|Q40465.1|IF411_TOBAC RecName: Full=Eukaryotic initiation factor 4A-11; Short=eIF-4A-11; 
AltName: Full=ATP-dependent RNA helicase eIF4A-11 [Nicotiana 
tabacum]
 emb|CAA55737.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E QEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008798130.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798131.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798132.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
Length=413

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGSQFDARQYDAK+ ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLPPEGSQFDARQYDAKLNELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHAC GGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACFGGTSVREDQRILSTGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009602748.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana tomentosiformis]
 ref|XP_009791873.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana sylvestris]
Length=413

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  E QEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_007222702.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
 gb|EMJ23901.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
Length=413

 Score =   343 bits (879),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  APEGSQFDARQYDAKM ELL  +GQEFFTSYDEVH+SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDARQYDAKMSELLGADGQEFFTSYDEVHESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALPDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|AAR23806.1| initiation factor eIF4A-15 [Helianthus annuus]
Length=413

 Score =   342 bits (878),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQFDSKMNDLLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYNVVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>emb|CAN61608.1| hypothetical protein VITISV_040122 [Vitis vinifera]
Length=413

 Score =   342 bits (878),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM ELL  +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLGTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|ACU18673.1| unknown [Glycine max]
Length=234

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>gb|KDP40743.1| hypothetical protein JCGZ_24742 [Jatropha curcas]
Length=413

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYDAKM ELL+ +GQ+FFT+YDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDAKMNELLSSDGQDFFTTYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYATVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006426587.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006426588.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006465995.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X1 
[Citrus sinensis]
 ref|XP_006465996.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X2 
[Citrus sinensis]
 gb|ESR39827.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|ESR39828.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|KDO65148.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65149.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65150.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=413

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008793233.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008793234.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGSQFDARQ+D+KM ELLT +GQEFFTSYDEV+D+FD+M L+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSQFDARQFDSKMNELLTQDGQEFFTSYDEVYDTFDSMNLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004513437.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Cicer arietinum]
 ref|XP_004513438.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Cicer arietinum]
Length=413

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAM L+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMHLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+  ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVTECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>emb|CDP08290.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   342 bits (877),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 172/180 (96%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEG-QEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDARQYDAKM ELL  +G QEFFTSYDEV+DSFD+MGL+ENLLRGIYAYG
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTDGGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  180



>gb|KHN32709.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   342 bits (876),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_009399791.1| PREDICTED: eukaryotic initiation factor 4A-8 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   342 bits (876),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL+ +GQ+FF SYDEV DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNELLSQDGQDFFASYDEVFDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004146811.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]
 ref|XP_004154791.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]
 gb|KGN59802.1| hypothetical protein Csa_3G848120 [Cucumis sativus]
Length=413

 Score =   341 bits (875),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008377701.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Malus domestica]
Length=413

 Score =   341 bits (875),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  APEGSQFD  QYDAKM ELL  +GQ+FFTSYDE+HDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSELLGADGQDFFTSYDEIHDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|EYU21355.1| hypothetical protein MIMGU_mgv1a0072631mg [Erythranthe guttata]
Length=413

 Score =   341 bits (874),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD RQ+D++M ELL VEG+EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTRQFDSRMNELLQVEGEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KHG04102.1| Eukaryotic initiation factor 4A-14 [Gossypium arboreum]
Length=313

 Score =   337 bits (865),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KJB56905.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
Length=336

 Score =   338 bits (867),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_003543580.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Glycine max]
 ref|XP_003546753.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X1 
[Glycine max]
 ref|XP_006597198.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Glycine max]
Length=413

 Score =   341 bits (874),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_003595233.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|ABN09109.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES65484.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008447621.1| PREDICTED: eukaryotic initiation factor 4A-8 [Cucumis melo]
 gb|ADN33729.1| helicase [Cucumis melo subsp. melo]
Length=413

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLSADGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KHG23060.1| Eukaryotic initiation factor 4A-9 [Gossypium arboreum]
Length=224

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 170/179 (95%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA AAPEGSQFDARQYDAKM EL  V GQ+FFTSYDEV+D+FD MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMDELEAV-GQDFFTSYDEVYDTFDVMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  178



>gb|KHN06630.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  178



>ref|XP_007138709.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
 gb|ESW10703.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
Length=413

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD R YD+KM ELLT + Q+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGRHYDSKMNELLTTDAQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+  ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVTECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|AAN74635.1| DEAD box RNA helicase [Pisum sativum]
 gb|AAR97917.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+Q+D KM ELLT EGQ+F+T Y+EV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDTKMNELLTTEGQDFYTFYEEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>sp|Q40468.1|IF415_TOBAC RecName: Full=Eukaryotic initiation factor 4A-15; Short=eIF-4A-15; 
AltName: Full=ATP-dependent RNA helicase eIF4A-15 [Nicotiana 
tabacum]
 emb|CAA55739.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQ+D KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDTKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKV ACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVTACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002278119.1| PREDICTED: eukaryotic initiation factor 4A-11 [Vitis vinifera]
 emb|CBI20640.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM ELL  +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLGTDGQDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|EYU29345.1| hypothetical protein MIMGU_mgv1a007246mg [Erythranthe guttata]
Length=413

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA   PEGS FDARQ+DAKM E+L  EG+EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MADKVPEGSNFDARQFDAKMDEILGAEGEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009385793.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM EL++ +GQ+FF SYDEV DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDAKMNELISQDGQDFFASYDEVFDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008462340.1| PREDICTED: eukaryotic initiation factor 4A-11 [Cucumis melo]
Length=413

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFD+RQYDAKM E+L+ EGQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDSRQYDAKMNEILSAEGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009389913.1| PREDICTED: eukaryotic initiation factor 4A-11 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGSQFDARQYDAKM ELL+ + Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMTPEGSQFDARQYDAKMNELLSQDVQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004141688.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]
 ref|XP_004155930.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]
 gb|KGN45514.1| hypothetical protein Csa_7G450710 [Cucumis sativus]
Length=413

 Score =   340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFD+RQYDAKM E+L+ EGQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDSRQYDAKMNEILSAEGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KHN30068.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLLENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_007215455.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
 ref|XP_008228255.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 ref|XP_008228256.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 gb|ADB07168.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|ADB07169.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|EMJ16654.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
Length=413

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYD KM ELL+ +GQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009415521.1| PREDICTED: eukaryotic initiation factor 4A-15 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D KM +LL+ +GQEFFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQFDTKMNDLLSADGQEFFTSYDEVYESFDDMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KJB56903.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
 gb|KJB56904.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
Length=413

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008337727.1| PREDICTED: eukaryotic initiation factor 4A-11 [Malus domestica]
Length=412

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  142  GAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEK  321
             AAPEGSQFD RQYD KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEK
Sbjct  2    AAAPEGSQFDTRQYDTKMSELLATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEK  61

Query  322  PSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQ  501
            PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQ
Sbjct  62   PSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTECQALVLAPTRELAQ  121

Query  502  QIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            QIEKVMRALGDYLGV+VHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  122  QIEKVMRALGDYLGVRVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_009403035.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELLT +GQEFFTSYDE+ +SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDAKMTELLTADGQEFFTSYDEICESFDDMGLHENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KJB70132.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
 gb|KJB70133.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
Length=413

 Score =   339 bits (870),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_007024535.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY27157.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   339 bits (870),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD KM ELL  +G EFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KHN39326.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   339 bits (869),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_003531602.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
 gb|KHN11260.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_006583001.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
Length=413

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_010927212.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Elaeis guineensis]
Length=413

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGSQFDARQYD KM ELLT +GQ+FFT+YDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGQVPEGSQFDARQYDTKMNELLTADGQDFFTTYDEVYDSFDAMGLHENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALV APTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVFAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHAC GGTSVREDQRILSSGVHVVVGTPGRVFDML+RQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACFGGTSVREDQRILSSGVHVVVGTPGRVFDMLQRQSLR  179



>gb|ACU21478.1| unknown [Glycine max]
Length=413

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_011079970.1| PREDICTED: eukaryotic initiation factor 4A-8 [Sesamum indicum]
Length=413

 Score =   338 bits (868),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD R YD KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTRHYDTKMNELLQSDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006338111.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Solanum tuberosum]
 ref|XP_006338112.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Solanum tuberosum]
Length=414

 Score =   338 bits (868),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 174/180 (97%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVE-GQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEGSQFD RQ+D+KM ELL+ + GQ+FFTSYDE++DSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGSQFDVRQFDSKMNELLSADDGQDFFTSYDEIYDSFDAMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  180



>gb|KHN17683.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDY GVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL+
Sbjct  121  AQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLQ  179



>ref|XP_007136846.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
 gb|ESW08840.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
Length=413

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD R YDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDGRHYDAKMDELLGADGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDY+GVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYIGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_008392378.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_007150491.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
 gb|ESW22485.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
Length=413

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD R YD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGRHYDSKMSELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_008379513.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>emb|CBI35913.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D+KM +LL+ +G++FFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDARQFDSKMNDLLSADGEDFFTSYDEVYDTFDSMGLVENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGV+VHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVRVHACVGGTSVREDQRILQTGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010669372.1| PREDICTED: eukaryotic initiation factor 4A-9 [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQ+DARQYD KM ELL+ EG +FFTSYDEV++SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQYDARQYDNKMSELLSEEGSDFFTSYDEVYESFDKMGLLENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYENLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KJB54655.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
 gb|KJB54656.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
Length=412

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 170/179 (95%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA AAPEGSQFDARQYDAKM EL  V GQ+FFTSYDEV+D+FD MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMDELEAV-GQDFFTSYDEVYDTFDVMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_010049453.1| PREDICTED: eukaryotic initiation factor 4A-15 [Eucalyptus grandis]
 gb|KCW82050.1| hypothetical protein EUGRSUZ_C03418 [Eucalyptus grandis]
Length=413

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGS FD+RQ+DAKM ELL+ +G++FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSAFDSRQFDAKMSELLSADGEDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_007202168.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
 gb|EMJ03367.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
Length=411

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  145  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  324
            AAPEGSQFD RQYD+KM ELL  +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGFEKP
Sbjct  2    AAPEGSQFDTRQYDSKMTELLATDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGFEKP  61

Query  325  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  504
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQ
Sbjct  62   SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTECQALVLAPTRELAQQ  121

Query  505  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            IEKVMRALGDYLGV+VHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  122  IEKVMRALGDYLGVRVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLR  177



>ref|XP_007012323.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29942.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=412

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA AAPEGSQFDARQYDAKM EL   +GQEFFT+YDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMNEL-EADGQEFFTTYDEVYDTFDSMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSTGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_007135520.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 ref|XP_007135521.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07514.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07515.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
Length=413

 Score =   337 bits (865),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>gb|EPS65096.1| hypothetical protein M569_09681 [Genlisea aurea]
Length=413

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA ++DAKM E+L  EG+EFFT+YDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANKFDAKMNEILGGEGEEFFTNYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGIVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_009372398.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
 ref|XP_009340681.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
Length=413

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>gb|ACJ84921.1| unknown [Medicago truncatula]
 gb|AFK40621.1| unknown [Medicago truncatula]
Length=413

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAMGL+ENLLR IYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMGLQENLLRDIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTR+L
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTRKL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006342502.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=410

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  148  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  327
            A EGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGFEKPS  61

Query  328  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  507
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTRELAQQI  121

Query  508  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            EKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  122  EKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  176



>ref|XP_004253094.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum lycopersicum]
Length=410

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  148  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  327
            A EGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGFEKPS  61

Query  328  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  507
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTRELAQQI  121

Query  508  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            EKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  122  EKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  176



>gb|AFK40852.1| unknown [Lotus japonicus]
Length=413

 Score =   336 bits (862),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYD+KM ELL  +GQEFFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMTELLATDGQEFFTSYDEVYDTFDSMGLHENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_011010150.1| PREDICTED: eukaryotic initiation factor 4A-8 [Populus euphratica]
Length=413

 Score =   336 bits (862),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD++QYDAKM +LL  +GQ+FFTSYDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDSKQYDAKMNDLLANDGQDFFTSYDEVYDTFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002304104.1| translation initiation factor 4A family protein [Populus trichocarpa]
 ref|XP_002304185.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
 gb|ABK94270.1| unknown [Populus trichocarpa]
 gb|EEE79083.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|EEE79164.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
Length=413

 Score =   336 bits (862),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD++QYDAKM +LL  +GQ+FFTSYDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDSKQYDAKMNDLLANDGQDFFTSYDEVYDTFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006357714.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic initiation factor 
4A-9-like [Solanum tuberosum]
Length=413

 Score =   336 bits (862),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAP+GSQFDARQ+D+KM ELL  EGQEFFTSYDE +D+FDAM LKE LLRGIYAYGF
Sbjct  1    MAGAAPDGSQFDARQFDSKMTELLNAEGQEFFTSYDEAYDTFDAMELKEKLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYELLDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVM+ALGDYL VKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMQALGDYLKVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>gb|KJB34989.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
 gb|KJB34990.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
Length=413

 Score =   336 bits (861),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D KM +LL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQFDQKMSDLLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGIVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_003526019.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN32198.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   336 bits (861),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG+APEGSQFDARQYDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVH CVGGT VREDQRILSSGVHVVVGTPGRVFDML RQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHVCVGGTIVREDQRILSSGVHVVVGTPGRVFDMLCRQSLR  179



>dbj|BAJ89461.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT12089.1| Eukaryotic initiation factor 4A [Aegilops tauschii]
Length=414

 Score =   336 bits (862),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_003563508.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
 ref|XP_010227424.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
Length=414

 Score =   336 bits (861),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>gb|AIZ68204.1| eukaryotic initiation factor 4A-14 [Ornithogalum saundersiae]
Length=413

 Score =   336 bits (861),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+QYD+KM +LL  +GQ+FFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMNDLLAGDGQDFFTSYDEVYESFDDMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVI+QAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIRQAQSGTGKTATFCSGILQQLDYGVVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>dbj|BAA02152.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAB21260.1| eukaryotic initiation factor 4A [Oryza sativa]
Length=413

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>dbj|BAJ85348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|NP_001058481.1| Os06g0701100 [Oryza sativa Japonica Group]
 sp|P35683.2|IF4A1_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Oryza sativa 
Japonica Group]
 dbj|BAD54014.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAD53769.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAF20395.1| Os06g0701100 [Oryza sativa Japonica Group]
 gb|EAZ38180.1| hypothetical protein OsJ_22532 [Oryza sativa Japonica Group]
 dbj|BAG94357.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99594.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_009381599.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA QYDAKM+ELL  +GQ+FFTSYD+V++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAHQYDAKMKELLNADGQDFFTSYDDVYESFDKMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQCQALVLGPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  178



>ref|XP_009361722.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=868

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/222 (81%), Positives = 193/222 (87%), Gaps = 3/222 (1%)
 Frame = +1

Query  16   LPQLQGLDPRSLGKP---*FLSRhtsfalslslsslhftsssVMAGAAPEGSQFDARQYD  186
            +PQL+GLDPRSLG P      ++ +  ALSLSL      SS  +  AAPEGSQFD RQYD
Sbjct  413  IPQLRGLDPRSLGNPNSQKTRTKISCDALSLSLRLQLSHSSLAVMAAAPEGSQFDTRQYD  472

Query  187  AKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRGIVPFCNG  366
             KM E+L  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEKPSAIQQRGIVPFC G
Sbjct  473  TKMSEILATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKG  532

Query  367  LDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRALGDYLGV  546
            LDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQIEKVMRALGDYLGV
Sbjct  533  LDVIQQAQSGTGKTATFCSGILQQLDYSLTECQALVLAPTRELAQQIEKVMRALGDYLGV  592

Query  547  KVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            +VHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  593  RVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLR  634



>dbj|BAJ96964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQAL+LAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALILAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_003597562.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AES67813.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD +Q+D KM ELL+ EGQEFFTSYDEVH++FDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTKQFDTKMNELLSTEGQEFFTSYDEVHETFDAMGLLENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQTGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006656443.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Oryza brachyantha]
 ref|XP_006656444.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_010033764.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Eucalyptus 
grandis]
 gb|KCW53567.1| hypothetical protein EUGRSUZ_J028421 [Eucalyptus grandis]
Length=412

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG  PEGSQFD RQ+D+K+ EL T E QEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSQFDPRQFDSKINEL-TTEAQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD V+CQ+LVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVQCQSLVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_006338110.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Solanum tuberosum]
Length=416

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 173/180 (96%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVE-GQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            + G+APEGSQFD RQ+D+KM ELL+ + GQ+FFTSYDE++DSFDAMGL+ENLLRGIYAYG
Sbjct  3    IVGSAPEGSQFDVRQFDSKMNELLSADDGQDFFTSYDEIYDSFDAMGLQENLLRGIYAYG  62

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTRE
Sbjct  63   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTRE  122

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  123  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  182



>ref|XP_010322836.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322837.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322838.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
Length=416

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            VMA  APEG+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  3    VMARLAPEGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  62

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTRE
Sbjct  63   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTRE  122

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  123  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  182



>gb|ACU24597.1| unknown [Glycine max]
Length=234

 Score =   328 bits (842),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQYDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVI+QAQSG GKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIRQAQSGAGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLR  657
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLR  174



>gb|EAZ02256.1| hypothetical protein OsI_24355 [Oryza sativa Indica Group]
Length=426

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_003627168.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AET01644.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA  YD+KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANHYDSKMNELLATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGD+LGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDFLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSLR  179



>ref|XP_002277703.1| PREDICTED: eukaryotic initiation factor 4A-8 [Vitis vinifera]
Length=413

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D+KM +LL+ +G++FFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDARQFDSKMNDLLSADGEDFFTSYDEVYDTFDSMGLVENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGV+VHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVRVHACVGGTSVREDQRILQTGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004510408.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=413

 Score =   335 bits (858),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA  YD KM ELL  +GQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANHYDTKMNELLASDGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            AQQIEKVMRALGD+LGVKVHACVGGTSVREDQRIL +GVH VVGTPGRVFDMLRRQSL
Sbjct  121  AQQIEKVMRALGDFLGVKVHACVGGTSVREDQRILQAGVHTVVGTPGRVFDMLRRQSL  178



>ref|XP_011072546.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Sesamum indicum]
Length=412

 Score =   335 bits (858),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG AP GSQFDAR+YDAKM E+L V+GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPAGSQFDAREYDAKM-EVLQVDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_009410226.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   335 bits (858),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA QYDAKM +LL  +GQ+FFT YDEVH+SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAHQYDAKMNDLLNADGQDFFTLYDEVHESFDEMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVKCQALVLGPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  178



>ref|XP_009798256.1| PREDICTED: eukaryotic initiation factor 4A-8 [Nicotiana sylvestris]
Length=413

 Score =   334 bits (856),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHV+VGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVIVGTPGRVFDMLRRQSLR  179



>sp|P41381.1|IF4A8_TOBAC RecName: Full=Eukaryotic initiation factor 4A-8; Short=eIF-4A-8; 
AltName: Full=ATP-dependent RNA helicase eIF4A-8 [Nicotiana 
tabacum]
 emb|CAA55639.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55640.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   334 bits (856),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHV+VGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVIVGTPGRVFDMLRRQSLR  179



>emb|CDY72259.1| BnaCnng76770D, partial [Brassica napus]
Length=222

 Score =   327 bits (838),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 171/181 (94%), Gaps = 3/181 (2%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAY  309
            VMAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAY
Sbjct  8    VMAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAY  65

Query  310  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  489
            GFEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTR
Sbjct  66   GFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTR  125

Query  490  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSL
Sbjct  126  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSL  185

Query  670  R  672
            R
Sbjct  186  R  186



>ref|NP_001105396.1| translational initiation factor eIF-4A [Zea mays]
 gb|AAB67607.1| translational initiation factor eIF-4A [Zea mays]
Length=414

 Score =   334 bits (856),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_010262239.1| PREDICTED: uncharacterized protein LOC104600806 [Nelumbo nucifera]
Length=929

 Score =   348 bits (893),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            VMAG APEGSQFDARQYDAKM ELLT +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYG
Sbjct  516  VMAGLAPEGSQFDARQYDAKMSELLTADGQDFFTSYDEVYESFDAMGLQENLLRGIYAYG  575

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  576  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  635

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  636  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLR  695



>ref|XP_010322839.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X2 [Solanum 
lycopersicum]
Length=413

 Score =   333 bits (855),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  APEG+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPEGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002438954.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
 gb|EER90321.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
Length=414

 Score =   333 bits (855),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>gb|AFW75865.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
1 [Zea mays]
 gb|AFW75866.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
2 [Zea mays]
Length=414

 Score =   333 bits (855),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_006474427.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Citrus sinensis]
Length=413

 Score =   333 bits (855),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGS FDAR +D+ M  LL+ EGQ+FF SYDEV+DSFD+MGLKENLLRGIYAYGF
Sbjct  1    MAGIAPEGSGFDARSFDSNMNNLLSEEGQDFFVSYDEVYDSFDSMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYESLQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDY+GVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYMGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>gb|AAY33860.1| eukaryotic initiation factor 4A [Cenchrus americanus]
Length=414

 Score =   333 bits (855),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_007012324.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29943.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=413

 Score =   333 bits (854),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG A +GSQ+DA QYD+KM ELL+ EG+EFFT+YDEV +SFD MGLKENLLRGIYAYGF
Sbjct  1    MAGLATDGSQYDAHQYDSKMNELLSDEGKEFFTTYDEVCESFDKMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004966111.1| PREDICTED: eukaryotic initiation factor 4A-3-like [Setaria italica]
Length=414

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELL-TVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL T E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>gb|KHG25459.1| Eukaryotic initiation factor 4A-8 [Gossypium arboreum]
Length=288

 Score =   328 bits (842),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            VMAG AP+ SQ+DARQYD+KM ELL  +G +FFT+YDEV++SFD MGL+ENLLRGIYAYG
Sbjct  36   VMAGVAPDVSQYDARQYDSKMNELLADDGNDFFTTYDEVYESFDKMGLQENLLRGIYAYG  95

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQ+GIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTRE
Sbjct  96   FEKPSAIQQKGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRE  155

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  156  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  215



>gb|KJB65513.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65514.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65516.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65517.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
Length=413

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG AP+GSQ+DARQYD+KM ELL  +G +FFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPDGSQYDARQYDSKMNELLADDGNDFFTSYDEVYESFDKMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQ+GIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQKGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010656491.1| PREDICTED: uncharacterized protein LOC100244028 [Vitis vinifera]
Length=827

 Score =   345 bits (885),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            VMAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYG
Sbjct  414  VMAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYG  473

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  474  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  533

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  534  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  593



>sp|P41378.1|IF4A_WHEAT RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Triticum aestivum]
Length=414

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFD++RRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDIVRRQSLR  180



>ref|XP_009334733.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Pyrus x bretschneideri]
Length=413

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  APEGSQFD  QYDAKM EL+  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSELVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKV RALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVTRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006453067.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006453068.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006474428.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Citrus sinensis]
 gb|ESR66307.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|ESR66308.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|KDO73513.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
 gb|KDO73514.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
Length=412

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG A EGSQFDARQ+DA+M +LL  +GQ+FFTSYDEV+D+FDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLA-EGSQFDARQFDARMNDLLGSDGQDFFTSYDEVYDTFDAMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  178



>gb|ACN34609.1| unknown [Zea mays]
 gb|AFW69338.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=414

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILGSGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_006853908.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
 gb|ERN15375.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
Length=412

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  148  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  327
            APEGSQFDARQYDAKM ELL  +G++FF SYDEV +SFD+MGL+ENLLRGIYAYGFEKPS
Sbjct  4    APEGSQFDARQYDAKMSELLQADGEDFFASYDEVFESFDSMGLQENLLRGIYAYGFEKPS  63

Query  328  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  507
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTRELAQQI
Sbjct  64   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLECQALVLAPTRELAQQI  123

Query  508  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  124  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_009624936.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAM L+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMSLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  179



>gb|EMS68416.1| Eukaryotic initiation factor 4A-1 [Triticum urartu]
 gb|EMT30822.1| Eukaryotic initiation factor 4A-1 [Aegilops tauschii]
Length=414

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+QYD+KM ELL   +  EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKQYDSKMTELLNQGDTGEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_007154632.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
 gb|ESW26626.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
Length=413

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGS FD R +D+KM +LL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSNFDTRHFDSKMSDLLSSDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL+
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLQ  179



>ref|XP_006601410.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Glycine 
max]
Length=853

 Score =   345 bits (884),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 190/217 (88%), Gaps = 4/217 (2%)
 Frame = +1

Query  22   QLQGLDPRSLGKP*FLSRhtsfalslslsslhftsssVMAGAAPEGSQFDARQYDAKMQE  201
            +L+G+DPRS G P      +SF       SL   S+ VMAG APEGSQFDARQYD+KM +
Sbjct  407  RLRGVDPRSSGNP----NSSSFTTEQRFFSLSIISTEVMAGLAPEGSQFDARQYDSKMSD  462

Query  202  LLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRGIVPFCNGLDVIQ  381
            LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEKPSAIQQRGIVPFC GLDVIQ
Sbjct  463  LLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQ  522

Query  382  QAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHAC  561
            QAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRELAQQIEKVMRALGDY GVKVHAC
Sbjct  523  QAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTRELAQQIEKVMRALGDYQGVKVHAC  582

Query  562  VGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            VGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL+
Sbjct  583  VGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLQ  619



>ref|XP_010688701.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQ+DARQYD KM ELL+ +G +F TSYDEV++SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQYDARQYDNKMSELLSEDGGDFITSYDEVYESFDKMGLLENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  179



>emb|CDY02469.1| BnaA08g00760D [Brassica napus]
Length=412

 Score =   332 bits (850),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQTGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_006453066.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|ESR66306.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|KDO73515.1| hypothetical protein CISIN_1g0150931mg [Citrus sinensis]
Length=413

 Score =   331 bits (849),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            M G APEGS FDAR +D+ M  LL+ EGQ+FF SYDEV+DSFD+MGLKENLLRGIYAYGF
Sbjct  1    MEGIAPEGSGFDARSFDSNMNNLLSEEGQDFFVSYDEVYDSFDSMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYESLQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDY+GVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYMGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_004951905.1| PREDICTED: eukaryotic initiation factor 4A-like [Setaria italica]
Length=410

 Score =   331 bits (849),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 3/179 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD +QYD KMQELLT   +EFFTSYDEV +SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGKQYDNKMQELLT---EEFFTSYDEVCESFDNMGLQENLLRGIYAYGF  57

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  118  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  176



>ref|XP_007012776.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 ref|XP_007012777.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30395.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30396.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   331 bits (849),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQ+D+KM + L  +GQ+   S+DEV+D+FDAMGL +NLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDSKMNDFLLADGQDVIASWDEVYDTFDAMGLLQNLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRR+SLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRKSLR  179



>ref|XP_009106914.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Brassica rapa]
 ref|XP_009106915.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Brassica rapa]
Length=412

 Score =   331 bits (849),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>emb|CDX82505.1| BnaA03g33160D [Brassica napus]
Length=428

 Score =   331 bits (849),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 172/181 (95%), Gaps = 3/181 (2%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAY  309
            VMAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAY
Sbjct  4    VMAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAY  61

Query  310  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  489
            GFEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTR
Sbjct  62   GFEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTR  121

Query  490  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSL
Sbjct  122  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSL  181

Query  670  R  672
            R
Sbjct  182  R  182



>ref|XP_010087709.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
 gb|EXB29697.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
Length=423

 Score =   331 bits (849),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG A EG+QFDAR+YDAKM ELL+ +GQ+FFTSYDEVH+SFD+MGL E LLRGIYAYGF
Sbjct  11   MAGLASEGTQFDARKYDAKMNELLSNDGQDFFTSYDEVHESFDSMGLLEKLLRGIYAYGF  70

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQ LDYD V+CQALVLAPTREL
Sbjct  71   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQLLDYDLVQCQALVLAPTREL  130

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSL
Sbjct  131  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSL  188



>ref|XP_010062659.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Eucalyptus 
grandis]
 gb|KCW69788.1| hypothetical protein EUGRSUZ_F03152 [Eucalyptus grandis]
Length=412

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD RQYD K+ EL + +G EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDPRQYDEKISEL-SADGGEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  178



>gb|KEH32494.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=430

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            VMAG APEGSQFDA ++D KM +L+  +G EF+TSYDEV+DSFDAMGL ENLLRGIYAYG
Sbjct  17   VMAGLAPEGSQFDAGKFDQKMNDLIAADGDEFWTSYDEVYDSFDAMGLAENLLRGIYAYG  76

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTRE
Sbjct  77   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTRE  136

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSL
Sbjct  137  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSTGVHVVVGTPGRVFDMLRRQSL  195



>ref|XP_010502017.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Camelina sativa]
Length=271

 Score =   325 bits (834),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 169/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDY+GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|NP_001104874.1| translation initiation factor [Zea mays]
 gb|AAB64289.1| translation initiation factor [Zea mays]
Length=414

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 168/180 (93%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIY YG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYRYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILGSGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_006297793.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
 gb|EOA30691.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
Length=412

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_010501441.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010465264.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010487172.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
Length=412

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_006595337.1| PREDICTED: eukaryotic initiation factor 4A-14 [Glycine max]
Length=794

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            VMAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  381  VMAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  440

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRE
Sbjct  441  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTRE  500

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL
Sbjct  501  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  559



>ref|XP_009135344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_006307670.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
 gb|EOA40568.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
Length=412

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 170/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>gb|KEH32495.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA ++D KM +L+  +G EF+TSYDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAGKFDQKMNDLIAADGDEFWTSYDEVYDSFDAMGLAENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSL
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSTGVHVVVGTPGRVFDMLRRQSL  178



>ref|XP_010552222.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Tarenaya hassleriana]
 ref|XP_010552223.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Tarenaya hassleriana]
Length=215

 Score =   322 bits (826),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAPEGSQFDARQ+D K+ ++L   G EFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDQKLNDVLE-GGDEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLGPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_006646878.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006646879.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   329 bits (844),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 168/180 (93%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD KMQELL   + +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDNKMQELLHQGDNEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_006357392.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Solanum tuberosum]
Length=413

 Score =   329 bits (843),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  A +G+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLATDGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002884997.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61256.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   329 bits (843),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>emb|CDY10607.1| BnaC03g70070D [Brassica napus]
Length=411

 Score =   329 bits (843),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 4/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFD RQ+D K+ E   V+GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNE---VQGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  57

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  58   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  117

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  118  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  177



>emb|CDX75739.1| BnaC03g38220D [Brassica napus]
Length=436

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_003574572.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brachypodium 
distachyon]
Length=414

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD KM ELL   E +EFFTSYDEVH+SFD M L+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDTKMTELLNQGETEEFFTSYDEVHESFDDMSLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRR SLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRSSLR  180



>ref|XP_009334734.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X3 
[Pyrus x bretschneideri]
Length=413

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  APEGSQFD  QYDAKM + +  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSDRVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKV RALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVTRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  179



>ref|NP_001045878.1| Os02g0146600 [Oryza sativa Japonica Group]
 sp|Q6Z2Z4.1|IF4A3_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-3; Short=eIF-4A-3; 
AltName: Full=ATP-dependent RNA helicase eIF4A-3; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 23; AltName: Full=eIF4A-2 
[Oryza sativa Japonica Group]
 dbj|BAD13081.1| putative translational initiation factor eIF-4A [Oryza sativa 
Japonica Group]
 dbj|BAF07792.1| Os02g0146600 [Oryza sativa Japonica Group]
 gb|EAY84464.1| hypothetical protein OsI_05839 [Oryza sativa Indica Group]
 dbj|BAG93556.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56296.1| hypothetical protein OsJ_05367 [Oryza sativa Japonica Group]
 gb|AGT42311.1| eucaryotic initiation factor [Oryza sativa Japonica Group]
Length=414

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEGSQFDA+ YD+KMQELL   + +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLHQGDNEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQ+LVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQSLVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_010536184.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Tarenaya hassleriana]
Length=412

 Score =   328 bits (842),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 171/179 (96%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG A EGS +DARQYD++M ELLT EG++FF++YDEV++SFD MGLKENLLRGIYAYGF
Sbjct  1    MAGVA-EGSLYDARQYDSRMSELLTEEGKDFFSTYDEVYESFDKMGLKENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD ++CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDLLQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL++GVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_006369263.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 ref|XP_006369264.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|ABK93256.1| unknown [Populus trichocarpa]
 gb|ERP65832.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 gb|ERP65833.1| translation initiation factor 4A family protein [Populus trichocarpa]
Length=413

 Score =   328 bits (842),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQ+DA+QYDAKM +LL  +GQ+FFT Y+EV ++FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDAKQYDAKMNDLLANDGQDFFTMYEEVFETFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_006407149.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
 gb|ESQ48602.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
Length=412

 Score =   328 bits (842),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_002451536.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
 gb|EES04512.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
Length=410

 Score =   328 bits (841),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 168/179 (94%), Gaps = 3/179 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYDEV +SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDEVCESFDNMGLQENLLRGIYAYGF  57

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  118  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  176



>emb|CDY39079.1| BnaA01g29770D [Brassica napus]
Length=412

 Score =   328 bits (841),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>gb|EYU45869.1| hypothetical protein MIMGU_mgv1a007331mg [Erythranthe guttata]
Length=410

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +1

Query  148  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  327
            A EGSQFD RQYD++M E+L  + QEFFTSYDEVH+SFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDTRQYDSRMSEILQPDQQEFFTSYDEVHESFDAMGLQENLLRGIYAYGFEKPS  61

Query  328  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  507
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTRELAQQI  121

Query  508  EKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            EKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  122  EKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLR  176



>emb|CDY55205.1| BnaCnng28430D [Brassica napus]
Length=423

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 170/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_009107078.1| PREDICTED: eukaryotic initiation factor 4A-1 [Brassica rapa]
Length=412

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 170/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_006392695.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
 gb|ESQ29981.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
Length=412

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAGAAPEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGAAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>emb|CDY08220.1| BnaA05g13990D [Brassica napus]
Length=412

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 170/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|NP_001151064.1| LOC100284697 [Zea mays]
 gb|ACF79496.1| unknown [Zea mays]
 gb|ACG41480.1| eukaryotic initiation factor 4A [Zea mays]
Length=410

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 169/179 (94%), Gaps = 3/179 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYD+V +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDDVCESFDSMGLQENLLRGIYAYGF  57

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  118  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  176



>sp|Q41741.1|IF4A_MAIZE RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Zea mays]
 gb|AAA82736.1| translation initiation factor eIF-4A [Zea mays]
Length=410

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 169/179 (94%), Gaps = 3/179 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYD+V +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDDVCESFDSMGLQENLLRGIYAYGF  57

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  118  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  176



>emb|CDX97528.1| BnaA05g25510D [Brassica napus]
Length=425

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 170/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>gb|AAL91176.1| eukaryotic translation initiation factor [Arabidopsis thaliana]
Length=412

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>dbj|BAH56988.1| AT3G13920 [Arabidopsis thaliana]
Length=398

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>gb|AAM63951.1| Eukaryotic initiation factor 4A, putative [Arabidopsis thaliana]
Length=412

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|NP_566469.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 sp|P41376.1|IF4A1_ARATH RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Arabidopsis thaliana]
 emb|CAA46188.1| eukaryotic translation initiation factor 4A-1 [Arabidopsis thaliana]
 dbj|BAB02322.1| eukaryotic translation initiation factor; RNA helicase [Arabidopsis 
thaliana]
 emb|CAC43288.1| translation initiation factor eIF-4A1 [Arabidopsis thaliana]
 gb|AAK93634.1| putative Eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAK96536.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM14243.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAM19972.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM98124.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31802.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AEE75438.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=412

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>gb|AFW69337.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=411

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 166/176 (94%), Gaps = 1/176 (1%)
 Frame = +1

Query  148  APEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  324
            APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYGFEKP
Sbjct  2    APEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYGFEKP  61

Query  325  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  504
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQ
Sbjct  62   SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRELAQQ  121

Query  505  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            IEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  122  IEKVMRALGDYLGVKVHACVGGTSVREDQRILGSGVHVVVGTPGRVFDMLRRQSLR  177



>gb|EPS63850.1| hypothetical protein M569_10933 [Genlisea aurea]
Length=413

 Score =   327 bits (838),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA ++D KM E+L  EG+EFFT+YDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANKFDTKMNEILGGEGEEFFTNYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIRGLDVIQQAQSGTGKTATFCSGILQQLDYSVVDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGT VREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTIVREDQRILSTGVHVVVGTPGRVFDMLRRQSLR  179



>emb|CDP03140.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   327 bits (838),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG A +GSQFDARQYD KM +LL+  GQ+FFTSYDEV DSFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGVATDGSQFDARQYDTKMSDLLSAGGQDFFTSYDEVWDSFDGMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+ QALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQSQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDML+R+SLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLQRRSLR  179



>ref|XP_010480021.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 169/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDY+GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_009334732.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X1 
[Pyrus x bretschneideri]
Length=414

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQEL-LTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MA  APEGSQFD  QYDAKM E  +  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSEFRVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKV RALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVTRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_009334735.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X4 
[Pyrus x bretschneideri]
Length=412

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MA  APEGSQFD  QYDAKM E+   EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSEV-GAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKV RALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVTRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_011046150.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
 ref|XP_011046151.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
Length=413

 Score =   326 bits (836),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQ+DA+QYDAKM +LL  +GQ+FFT Y+EV ++FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDAKQYDAKMNDLLANDGQDFFTMYEEVFETFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGT VREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTIVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002514133.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF48087.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=764

 Score =   337 bits (863),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA+ +D+KM ELLT +G++FFT+YDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  352  MAGLAPEGSQFDAKHFDSKMNELLTADGEDFFTTYDEVYESFDSMGLQENLLRGIYAYGF  411

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQA VLAPTREL
Sbjct  412  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALVECQAXVLAPTREL  471

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  472  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  530



>ref|XP_010462344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   326 bits (836),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 169/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDY+GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|NP_001030693.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 gb|AEE75439.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=415

 Score =   326 bits (835),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 171/180 (95%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_010542416.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   325 bits (834),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D K+ +L+   G EFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDQKLNDLIE-GGDEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_009598422.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
tomentosiformis]
Length=208

 Score =   318 bits (815),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            M  A  EGSQFDARQ+DAK+ ELL+ +GQEFFTS DEV+DSFD MGLKENLLRGIYAYGF
Sbjct  1    MPSAVTEGSQFDARQFDAKITELLSGDGQEFFTSCDEVYDSFDDMGLKENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVL QLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLNQLDYKLLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDY+ VK HACVGGTSVREDQ +LS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMRALGDYIDVKAHACVGGTSVREDQLVLSNGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_010534921.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDARQ+D K+ +LL   G EFFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDQKLNDLLD-GGDEFFTSYDEVCESFDAMGLQENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_008242400.1| PREDICTED: eukaryotic initiation factor 4A-2 [Prunus mume]
Length=806

 Score =   337 bits (863),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  145  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  324
            AAPEGSQFD RQYD+KM ELL  +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGFEKP
Sbjct  397  AAPEGSQFDTRQYDSKMTELLATDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGFEKP  456

Query  325  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  504
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQ
Sbjct  457  SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTECQALVLAPTRELAQQ  516

Query  505  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            IEKVMRALGDYLGV+VHACVGGTSVREDQRILS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  517  IEKVMRALGDYLGVRVHACVGGTSVREDQRILSNGVHVVVGTPGRVFDMLRRQSLR  572



>ref|XP_009117360.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVK HACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKGHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>dbj|BAE98559.1| eukaryotic protein synthesis initiation factor 4A [Arabidopsis 
thaliana]
Length=412

 Score =   324 bits (830),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 169/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKT TFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTTTFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL + VHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQASVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_009146433.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   324 bits (830),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRA G YLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDML+RQSLR
Sbjct  119  LAQQIEKVMRARGAYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLR  178



>ref|XP_004486853.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=412

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG AP+GSQFDA+QYD+KM ELLT +GQEF   YDEV+D+FDAM L+ENLLRGIYAYGF
Sbjct  1    MAGLAPDGSQFDAKQYDSKMNELLT-DGQEFGVEYDEVYDTFDAMKLEENLLRGIYAYGF  59

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  119

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL  GVH VVGTPGRVFDMLRRQSLR
Sbjct  120  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQGGVHTVVGTPGRVFDMLRRQSLR  178



>ref|XP_001786409.1| predicted protein [Physcomitrella patens]
 gb|EDQ48779.1| predicted protein, partial [Physcomitrella patens]
Length=203

 Score =   316 bits (810),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG+APEGSQFDARQYDAKM+ +L  EG++F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMETILGGEGEDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALR  179



>ref|XP_010324046.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Solanum lycopersicum]
Length=413

 Score =   323 bits (829),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAGAAP+GSQFDARQ+D+KM ELL  EGQEFFTSYDE +D+FDAM LKE+LL+GIYAYGF
Sbjct  1    MAGAAPDGSQFDARQFDSKMTELLNAEGQEFFTSYDEAYDTFDAMELKEDLLKGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQ+QSGTGKTATFCSGVLQQLDY+ + CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQSQSGTGKTATFCSGVLQQLDYELLGCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVM ALG  L VKVHACVGGTSVREDQRILS GVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  AQQIEKVMEALGQCLKVKVHACVGGTSVREDQRILSIGVHVVVGTPGRVFDMLRRQSLR  179



>ref|XP_002891805.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68064.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   323 bits (828),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 168/180 (93%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+A EG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAAEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDY GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_009147530.1| PREDICTED: eukaryotic initiation factor 4A-1 [Brassica rapa]
Length=412

 Score =   323 bits (828),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QF+ RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFNTRQFDQKLNEVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDITLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVH CVGGTSV EDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCVGGTSVVEDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>emb|CDY24057.1| BnaA06g00550D [Brassica napus]
Length=412

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFD RQ+D K+ ++L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNDVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDITLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVH CVGGTSV EDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCVGGTSVVEDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|NP_175829.1| eukaryotic initiation factor 4A-2 [Arabidopsis thaliana]
 sp|P41377.1|IF4A2_ARATH RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 19 [Arabidopsis 
thaliana]
 gb|AAD25605.1|AC005287_7 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAK62368.1|AF386923_1 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAL16231.1|AF428462_1 At1g54270/F20D21_52 [Arabidopsis thaliana]
 emb|CAA46189.1| eukaryotic translation initiation factor 4A-2 [Arabidopsis thaliana]
 gb|AAM65512.1| eukaryotic translation initiation factor 4A, putative [Arabidopsis 
thaliana]
 gb|AAP37863.1| At1g54270 [Arabidopsis thaliana]
 dbj|BAE98493.1| Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AEE33073.1| translation initiation factor 4A-2 [Arabidopsis thaliana]
Length=412

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 169/180 (94%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYALLQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDY GVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_010090077.1| Eukaryotic initiation factor 4A-15 [Morus notabilis]
 gb|EXB38874.1| Eukaryotic initiation factor 4A-15 [Morus notabilis]
Length=857

 Score =   333 bits (854),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 1/179 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG A EGSQFDARQ+DAKM ++L+ +GQ+FFT+YDEV+D+FDAMGL ENLLRGIYAYGF
Sbjct  446  MAGVA-EGSQFDARQFDAKMNDILSADGQDFFTTYDEVYDTFDAMGLHENLLRGIYAYGF  504

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQL+Y  VECQALVLAPTREL
Sbjct  505  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLEYGLVECQALVLAPTREL  564

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR
Sbjct  565  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  623



>emb|CDY33073.1| BnaC06g07060D [Brassica napus]
Length=412

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 168/180 (93%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG+APEG+QF+ RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRG+YAYG
Sbjct  1    MAGSAPEGTQFNTRQFDQKLNEVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGVYAYG  58

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQL+   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLEITLVQCQALVLAPTRE  118

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVH CVGGTSV EDQRIL +GVHVVVGTPGRVFDMLRRQSLR
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCVGGTSVVEDQRILQAGVHVVVGTPGRVFDMLRRQSLR  178



>ref|XP_001783934.1| predicted protein [Physcomitrella patens]
 gb|EDQ51244.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG+APEGSQFDARQYDAKM+ +L+ EG +F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMENILSGEGDDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALR  179



>gb|ABR18348.1| unknown [Picea sitchensis]
 gb|ACN39814.1| unknown [Picea sitchensis]
 gb|ACN40764.1| unknown [Picea sitchensis]
Length=413

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG   + + FDARQYDAKM+E+L+ EG E F SYDEVH+SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGVVADATLFDARQYDAKMKEILSTEGDELFASYDEVHESFDEMGLHENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLDCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYL VKVHACVGGTSVR+DQRIL SGVHVVVGTPGRVFDMLRR SLR
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVRDDQRILMSGVHVVVGTPGRVFDMLRRHSLR  179



>ref|XP_001758216.1| predicted protein [Physcomitrella patens]
 gb|EDQ77038.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG-  312
            MAG+APEGSQFDARQYDAKM+ +L+ EG++F ++++EVHD+FD MGL ENLLRGIYAYG 
Sbjct  1    MAGSAPEGSQFDARQYDAKMENILSAEGEDFISTWEEVHDTFDVMGLHENLLRGIYAYGS  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR
Sbjct  121  LAQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALR  180



>gb|AAN74636.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG APEGSQFDA ++DA+M +L+  +G EF+T  DEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAGKFDARMNDLMAGDGNEFYTISDEVCESFDAMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC G DVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGHDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  178



>ref|XP_001765568.1| predicted protein [Physcomitrella patens]
 gb|EDQ69618.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG+APEGSQFDARQYDAKM+ +L  EG++F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMETILGGEGEDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALR  179



>emb|CDY49861.1| BnaA02g16100D [Brassica napus]
Length=427

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = +1

Query  133  VMAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAY  309
            VMAG A EG+Q+D RQ+D+KM  +L  EG+E F+T+YDEV DSFDAM LK +LLRGIYAY
Sbjct  13   VMAGMASEGTQYDPRQFDSKMNAILGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAY  72

Query  310  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  489
            GFEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTR
Sbjct  73   GFEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTR  132

Query  490  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSL  669
            ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSL
Sbjct  133  ELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSL  192

Query  670  R  672
            R
Sbjct  193  R  193



>ref|XP_011470735.1| PREDICTED: eukaryotic initiation factor 4A-9 [Fragaria vesca 
subsp. vesca]
Length=801

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  145  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  324
            AAPEGSQFD  Q+D +M ELLT EGQ+FFTSYDEV+DSFD MGL+ENLLRGIYAYGFEKP
Sbjct  392  AAPEGSQFDTHQFDNRMNELLTAEGQDFFTSYDEVYDSFDNMGLQENLLRGIYAYGFEKP  451

Query  325  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  504
            SAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTRELAQQ
Sbjct  452  SAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSLLDCQALVLAPTRELAQQ  511

Query  505  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVH VVGTPGRVFDMLRRQSLR
Sbjct  512  IEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHAVVGTPGRVFDMLRRQSLR  567



>emb|CDY53867.1| BnaC02g46260D [Brassica napus]
Length=422

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG A EG+Q+D RQ+D+KM  +L  EG+E F+T+YDEV DSFDAM LK +LLRGIYAYG
Sbjct  1    MAGMASEGTQYDPRQFDSKMNAILGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_009127948.1| PREDICTED: eukaryotic initiation factor 4A-3 isoform X1 [Brassica 
rapa]
Length=414

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG A EG+Q+D RQ+D+KM  +L  EG+E F+T+YDEV DSFDAM LK +LLRGIYAYG
Sbjct  1    MAGMASEGTQYDPRQFDSKMNAILGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  180



>ref|XP_001771324.1| predicted protein [Physcomitrella patens]
 gb|EDQ63884.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG+APEGSQFDARQYDAKM+ +L  EG++F ++++EVH++FD M L ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMETVLAGEGEDFISTWEEVHETFDVMDLHENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            AQQIEKVMRALGDYL VKVHACVGGTSVREDQRIL +GVHVVVGTPGRV+DMLRR +LR
Sbjct  121  AQQIEKVMRALGDYLQVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVYDMLRRNALR  179



>gb|AAL69381.1|AF462218_1 putative DEAD/DEAH box helicase [Narcissus pseudonarcissus]
Length=164

 Score =   307 bits (787),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  315
            MAG A EGSQFDARQYD+KM +LL+ EGQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGMATEGSQFDARQYDSKMNDLLSAEGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  316  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  495
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  496  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVG  627
            AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILS+GVHVVVG
Sbjct  121  AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVG  164



>ref|XP_009779503.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
sylvestris]
Length=409

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  166  FDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRG  345
            FDARQ+DAK+ ELL+ +GQEFFT YDEV+DSFD MGLKENL+RGIYAYGFEKPSAIQQRG
Sbjct  7    FDARQFDAKITELLSGDGQEFFTPYDEVYDSFDNMGLKENLVRGIYAYGFEKPSAIQQRG  66

Query  346  IVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRA  525
            IVPFC GLDVIQQAQSGTGKTATFCSGVL QLDY+ +ECQALVLAPTRELAQQIEKVMRA
Sbjct  67   IVPFCKGLDVIQQAQSGTGKTATFCSGVLNQLDYELLECQALVLAPTRELAQQIEKVMRA  126

Query  526  LGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LGDYLGVK HACVGGTSVREDQ +LS+GVHVVVGTPGRVFDMLRRQSLR
Sbjct  127  LGDYLGVKAHACVGGTSVREDQLVLSNGVHVVVGTPGRVFDMLRRQSLR  175



>ref|XP_006390626.1| hypothetical protein EUTSA_v10018626mg [Eutrema salsugineum]
 gb|ESQ27912.1| hypothetical protein EUTSA_v10018626mg [Eutrema salsugineum]
Length=414

 Score =   314 bits (804),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  136  MAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAYG  312
            MAG A EG+Q+D RQ+D KM  LL  EG+E F+T+YDEV DSFDAM LK +LLRGIYAYG
Sbjct  1    MAGMASEGTQYDPRQFDTKMNALLGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAYG  60

Query  313  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  492
            FEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLD   V+CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDIAYVQCQALVLAPTRE  120

Query  493  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLR  180



>gb|ABS19813.1| eukaryotic initiation factor 4A [Lolium perenne]
Length=338

 Score =   311 bits (797),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = +1

Query  175  RQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRGIV  351
            + YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYGFEKPSAIQQRGIV
Sbjct  1    KNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYGFEKPSAIQQRGIV  60

Query  352  PFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRALG  531
            PFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQIEKVMRALG
Sbjct  61   PFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRELAQQIEKVMRALG  120

Query  532  DYLGVKVHACVGGTSVREDQRILSSGVHVVVGTPGRVFDMLRRQSLR  672
            DYLGVKVHACVGGTSVREDQRIL+SGVHVVVGTPGRVFDMLRRQSLR
Sbjct  121  DYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600