BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF039C16

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase               132   3e-33   Ipomoea batatas [batate]
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        123   8e-30   Nicotiana sylvestris
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        121   4e-29   
gb|KDP26621.1|  hypothetical protein JCGZ_17779                         119   2e-28   Jatropha curcas
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        118   6e-28   Elaeis guineensis
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    117   1e-27   Populus euphratica
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        117   1e-27   Phoenix dactylifera
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    117   1e-27   Citrus sinensis [apfelsine]
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             117   2e-27   Citrus clementina [clementine]
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    117   2e-27   Populus euphratica
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   116   2e-27   Citrus sinensis [apfelsine]
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    116   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg                116   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    116   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1                 115   6e-27   Theobroma cacao [chocolate]
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    114   9e-27   Elaeis guineensis
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    114   2e-26   Solanum tuberosum [potatoes]
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                   114   2e-26   Morus notabilis
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g             113   2e-26   
ref|XP_009797107.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   3e-26   Nicotiana sylvestris
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        113   3e-26   Nelumbo nucifera [Indian lotus]
gb|KDO82336.1|  hypothetical protein CISIN_1g006968mg                   111   3e-26   Citrus sinensis [apfelsine]
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    113   4e-26   Phoenix dactylifera
gb|KJB61041.1|  hypothetical protein B456_009G337000                    113   4e-26   Gossypium raimondii
gb|KJB61045.1|  hypothetical protein B456_009G337000                    113   4e-26   Gossypium raimondii
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    113   4e-26   Phoenix dactylifera
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        112   4e-26   
gb|KDO82335.1|  hypothetical protein CISIN_1g006968mg                   111   6e-26   Citrus sinensis [apfelsine]
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        112   6e-26   Solanum lycopersicum
emb|CDP13189.1|  unnamed protein product                                112   7e-26   Coffea canephora [robusta coffee]
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   7e-26   Solanum lycopersicum
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   9e-26   Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   9e-26   Malus domestica [apple tree]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   9e-26   Malus domestica [apple tree]
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   1e-25   Solanum lycopersicum
gb|KJB61042.1|  hypothetical protein B456_009G337000                    109   1e-25   Gossypium raimondii
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...    110   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        110   4e-25   Vitis vinifera
gb|KJB61043.1|  hypothetical protein B456_009G337000                    109   4e-25   Gossypium raimondii
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590          109   6e-25   Amborella trichopoda
emb|CAN75190.1|  hypothetical protein VITISV_035381                     109   7e-25   Vitis vinifera
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g             108   1e-24   
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    108   1e-24   Fragaria vesca subsp. vesca
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450          108   1e-24   
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    108   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    108   1e-24   Fragaria vesca subsp. vesca
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    108   1e-24   
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    108   1e-24   Prunus mume [ume]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    108   1e-24   Prunus mume [ume]
dbj|BAD68256.1|  putative brassinosteroid insensitive 1-associate...    106   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    108   2e-24   
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    108   2e-24   
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    108   2e-24   
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        107   4e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001169689.1|  LOC100383570 precursor                             107   4e-24   Zea mays [maize]
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...    107   4e-24   
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    106   6e-24   Nicotiana tomentosiformis
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    106   7e-24   Solanum tuberosum [potatoes]
ref|XP_002312685.1|  leucine-rich repeat family protein                 106   9e-24   
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g             106   1e-23   
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        106   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    105   2e-23   Setaria italica
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                        105   2e-23   Glycine soja [wild soybean]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    105   2e-23   Glycine max [soybeans]
gb|ACM89541.1|  leucine-rich repeat receptor-like kinase                103   3e-23   Glycine max [soybeans]
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    103   6e-23   Brachypodium distachyon [annual false brome]
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    103   6e-23   
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    103   6e-23   
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    103   7e-23   Brachypodium distachyon [annual false brome]
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg             103   7e-23   Eutrema salsugineum [saltwater cress]
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase                103   8e-23   Brassica rapa subsp. oleifera [biennial turnip rape]
dbj|BAK02609.1|  predicted protein                                      103   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                        103   9e-23   Glycine soja [wild soybean]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   9e-23   Glycine max [soybeans]
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   9e-23   Cucumis sativus [cucumbers]
gb|AAB71968.1|  Putative Serine/Threonine protein kinase                102   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59440.1|  hypothetical protein M569_15369                       95.5    2e-22   Genlisea aurea
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    102   3e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    102   3e-22   Cucumis melo [Oriental melon]
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase           102   3e-22   Medicago truncatula
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    101   4e-22   Nelumbo nucifera [Indian lotus]
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    101   4e-22   Cicer arietinum [garbanzo]
emb|CDY61461.1|  BnaC01g43240D                                          101   5e-22   Brassica napus [oilseed rape]
gb|EPS73511.1|  hypothetical protein M569_01245                         100   8e-22   Genlisea aurea
emb|CDY46185.1|  BnaA01g23070D                                          100   1e-21   Brassica napus [oilseed rape]
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    100   1e-21   Brassica rapa
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    100   1e-21   Brassica rapa
ref|XP_002886588.1|  nsp-interacting kinase 3                           100   2e-21   
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        100   2e-21   Eucalyptus grandis [rose gum]
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   99.4    3e-21   Eucalyptus grandis [rose gum]
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  99.4    3e-21   
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  99.4    3e-21   Eucalyptus grandis [rose gum]
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                   99.4    3e-21   Eucalyptus grandis [rose gum]
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                   99.4    3e-21   Eucalyptus grandis [rose gum]
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                   99.4    3e-21   Eucalyptus grandis [rose gum]
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                   99.4    3e-21   Eucalyptus grandis [rose gum]
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                   99.4    3e-21   Eucalyptus grandis [rose gum]
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  99.4    3e-21   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  99.4    3e-21   
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  99.0    3e-21   
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  99.0    4e-21   Eucalyptus grandis [rose gum]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g           98.6    5e-21   Phaseolus vulgaris [French bean]
ref|NP_176279.1|  NSP-interacting kinase 3                            98.6    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  97.4    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  97.4    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg           97.1    2e-20   
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  96.3    3e-20   
gb|KCW86694.1|  hypothetical protein EUGRSUZ_B03306                   95.1    4e-20   Eucalyptus grandis [rose gum]
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  94.0    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  94.0    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  94.0    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  94.0    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  89.7    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  89.7    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  88.6    2e-17   Nicotiana tomentosiformis
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.8    2e-17   
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.8    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      87.8    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  87.8    3e-17   Nicotiana sylvestris
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  87.4    3e-17   
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                      87.8    4e-17   Glycine soja [wild soybean]
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  87.8    4e-17   Glycine max [soybeans]
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      87.4    4e-17   Cucumis melo [Oriental melon]
gb|KJB43138.1|  hypothetical protein B456_007G186300                  87.4    4e-17   Gossypium raimondii
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  87.4    5e-17   Ricinus communis
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.0    6e-17   Elaeis guineensis
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.7    7e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002305735.1|  leucine-rich repeat transmembrane protein ki...  86.7    9e-17   
gb|KDP31451.1|  hypothetical protein JCGZ_11827                       86.3    9e-17   Jatropha curcas
ref|XP_007033440.1|  NSP-interacting kinase 1                         86.3    1e-16   
gb|EEE57731.1|  hypothetical protein OsJ_08242                        86.3    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73926.1|  hypothetical protein OsI_08784                        86.3    1e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.3    1e-16   Phoenix dactylifera
gb|KDP24340.1|  hypothetical protein JCGZ_25636                       85.9    1e-16   Jatropha curcas
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.9    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.5    2e-16   Populus euphratica
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.5    2e-16   Populus euphratica
ref|XP_010492459.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.5    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002876917.1|  nsp-interacting kinase 2                         85.5    2e-16   
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.5    2e-16   Phoenix dactylifera
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.5    2e-16   Phoenix dactylifera
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g           85.5    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g           85.5    2e-16   Populus trichocarpa [western balsam poplar]
dbj|BAG93736.1|  unnamed protein product                              83.2    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.1    2e-16   Phoenix dactylifera
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.1    2e-16   Cucumis sativus [cucumbers]
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  85.1    2e-16   Citrus sinensis [apfelsine]
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      85.1    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg           85.1    3e-16   Citrus clementina [clementine]
ref|XP_010558548.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.1    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.1    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      85.1    3e-16   Eucalyptus grandis [rose gum]
gb|KDO70178.1|  hypothetical protein CISIN_1g007025mg                 84.7    3e-16   Citrus sinensis [apfelsine]
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.7    4e-16   Solanum tuberosum [potatoes]
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.7    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006844161.1|  hypothetical protein AMTR_s00006p00261510        84.7    4e-16   Amborella trichopoda
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                      84.3    4e-16   Glycine soja [wild soybean]
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    4e-16   Glycine max [soybeans]
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.0    5e-16   
gb|AAM65586.1|  receptor protein kinase-like protein                  84.0    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400129.1|  hypothetical protein EUTSA_v10012948mg           84.0    6e-16   Eutrema salsugineum [saltwater cress]
ref|NP_197104.1|  NSP-interacting kinase 1                            84.0    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                 84.3    6e-16   
gb|AFW73242.1|  putative leucine-rich repeat receptor-like protei...  78.2    7e-16   
ref|XP_006395648.1|  hypothetical protein EUTSA_v10003811mg           84.0    7e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.6    8e-16   
ref|XP_003633015.1|  PREDICTED: probable LRR receptor-like serine...  84.0    8e-16   Vitis vinifera
ref|XP_006348615.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.6    8e-16   
ref|XP_009394555.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.6    9e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010453748.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      83.6    1e-15   Camelina sativa [gold-of-pleasure]
gb|KJB80538.1|  hypothetical protein B456_013G102600                  83.2    1e-15   Gossypium raimondii
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                83.2    1e-15   Gossypium arboreum [tree cotton]
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.6    1e-15   Elaeis guineensis
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g           83.2    1e-15   Phaseolus vulgaris [French bean]
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  83.2    1e-15   Nicotiana tomentosiformis
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      83.2    1e-15   Solanum lycopersicum
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  83.2    1e-15   Nicotiana tomentosiformis
ref|XP_002871697.1|  nsp-interacting kinase 1                         83.2    1e-15   Arabidopsis lyrata subsp. lyrata
gb|KDO58880.1|  hypothetical protein CISIN_1g036225mg                 83.2    1e-15   Citrus sinensis [apfelsine]
ref|XP_006482337.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.2    1e-15   Citrus sinensis [apfelsine]
ref|XP_006430876.1|  hypothetical protein CICLE_v10011302mg           83.2    1e-15   Citrus clementina [clementine]
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.2    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO70179.1|  hypothetical protein CISIN_1g007025mg                 81.6    1e-15   Citrus sinensis [apfelsine]
emb|CBI30706.3|  unnamed protein product                              82.8    1e-15   Vitis vinifera
ref|XP_009619541.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-15   Nicotiana tomentosiformis
ref|XP_009619542.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-15   Nicotiana tomentosiformis
ref|XP_010274435.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010274434.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006574993.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.8    2e-15   
ref|XP_010274437.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_004173630.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    2e-15   
ref|XP_010274433.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-15   Nelumbo nucifera [Indian lotus]
gb|KHN07744.1|  Protein NSP-INTERACTING KINASE 2                      82.8    2e-15   Glycine soja [wild soybean]
ref|XP_010274432.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011020829.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.8    2e-15   Populus euphratica
ref|XP_010274431.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.8    2e-15   Elaeis guineensis
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.4    2e-15   Nicotiana sylvestris
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.4    2e-15   Nicotiana sylvestris
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g           82.4    2e-15   Phaseolus vulgaris [French bean]
ref|NP_001146634.1|  uncharacterized LOC100280233 precursor           82.4    2e-15   Zea mays [maize]
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g           82.4    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.4    3e-15   Populus euphratica
ref|XP_002314905.1|  hypothetical protein POPTR_0010s14410g           82.4    3e-15   
ref|XP_011011496.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.4    3e-15   Populus euphratica
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      82.4    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_010999763.1|  PREDICTED: probable LRR receptor-like serine...  82.0    3e-15   Populus euphratica
ref|XP_006833053.1|  hypothetical protein AMTR_s00170p00030060        82.0    3e-15   
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.0    3e-15   Camelina sativa [gold-of-pleasure]
emb|CDP02372.1|  unnamed protein product                              82.0    4e-15   Coffea canephora [robusta coffee]
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    4e-15   Nelumbo nucifera [Indian lotus]
ref|XP_004485913.1|  PREDICTED: probable LRR receptor-like serine...  81.6    4e-15   Cicer arietinum [garbanzo]
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                 81.6    4e-15   
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g           81.6    4e-15   Phaseolus vulgaris [French bean]
gb|KEH25224.1|  NSP-interacting kinase-like protein                   81.3    4e-15   Medicago truncatula
emb|CDO96836.1|  unnamed protein product                              81.6    4e-15   Coffea canephora [robusta coffee]
ref|XP_008379484.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    4e-15   
gb|KEH25223.1|  NSP-interacting kinase-like protein                   81.6    5e-15   Medicago truncatula
ref|XP_006358116.1|  PREDICTED: probable LRR receptor-like serine...  81.6    5e-15   Solanum tuberosum [potatoes]
ref|XP_006287253.1|  hypothetical protein CARUB_v10000442mg           81.6    5e-15   Capsella rubella
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...  81.6    5e-15   Saccharum hybrid cultivar [sugarcane]
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    5e-15   Sesamum indicum [beniseed]
ref|XP_010274436.1|  PREDICTED: probable LRR receptor-like serine...  81.6    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011099081.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    5e-15   Sesamum indicum [beniseed]
ref|XP_006358118.1|  PREDICTED: probable LRR receptor-like serine...  81.3    5e-15   Solanum tuberosum [potatoes]
ref|XP_006358117.1|  PREDICTED: probable LRR receptor-like serine...  81.3    6e-15   Solanum tuberosum [potatoes]
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170        81.3    6e-15   Sorghum bicolor [broomcorn]
ref|XP_003517902.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  81.3    6e-15   Glycine max [soybeans]
ref|XP_010424117.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.9    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004953781.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.3    6e-15   Setaria italica
ref|XP_006643812.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  81.3    6e-15   
gb|EMT25229.1|  Putative LRR receptor-like serine/threonine-prote...  81.3    6e-15   
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2     80.9    6e-15   Glycine max [soybeans]
ref|XP_004134925.1|  PREDICTED: probable LRR receptor-like serine...  80.9    7e-15   Cucumis sativus [cucumbers]
gb|KHN07168.1|  Protein NSP-INTERACTING KINASE 1                      80.9    7e-15   Glycine soja [wild soybean]
ref|XP_009781120.1|  PREDICTED: probable LRR receptor-like serine...  80.9    8e-15   Nicotiana sylvestris
ref|XP_009781121.1|  PREDICTED: probable LRR receptor-like serine...  80.9    8e-15   Nicotiana sylvestris
ref|NP_001238448.1|  NSP-interacting kinase precursor                 80.9    8e-15   Glycine max [soybeans]
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.9    8e-15   Phoenix dactylifera
ref|XP_004238998.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      80.9    8e-15   Solanum lycopersicum
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1     80.9    9e-15   Glycine max [soybeans]
ref|XP_009378313.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.9    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.9    9e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|ABG73621.1|  leucine-rich repeat receptor-like kinase              80.5    1e-14   Populus tomentosa [Chinese white poplar]
ref|XP_010261776.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.5    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      80.5    1e-14   Vitis vinifera
gb|KEH21800.1|  NSP-interacting kinase-like protein                   80.5    1e-14   Medicago truncatula
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.5    1e-14   Oryza brachyantha
ref|XP_009630581.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      80.5    1e-14   Nicotiana tomentosiformis
ref|XP_004490300.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  80.1    1e-14   Cicer arietinum [garbanzo]
ref|XP_011039407.1|  PREDICTED: probable LRR receptor-like serine...  80.1    1e-14   Populus euphratica
ref|XP_008341829.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.1    2e-14   Malus domestica [apple tree]
ref|XP_007214944.1|  hypothetical protein PRUPE_ppa002897mg           79.7    2e-14   Prunus persica
gb|KEH21801.1|  NSP-interacting kinase-like protein                   79.7    2e-14   Medicago truncatula
ref|XP_007148028.1|  hypothetical protein PHAVU_006G174400g           79.7    2e-14   Phaseolus vulgaris [French bean]
ref|XP_008230341.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      79.7    2e-14   Prunus mume [ume]
ref|XP_009373732.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.7    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  79.7    2e-14   Cucumis melo [Oriental melon]
ref|XP_007148027.1|  hypothetical protein PHAVU_006G174400g           79.3    2e-14   Phaseolus vulgaris [French bean]
ref|XP_011039404.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-14   Populus euphratica
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-14   Cucumis melo [Oriental melon]
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.3    3e-14   Cicer arietinum [garbanzo]
gb|KJB60823.1|  hypothetical protein B456_009G327400                  79.3    3e-14   Gossypium raimondii
ref|XP_010246460.1|  PREDICTED: probable LRR receptor-like serine...  79.3    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_006594544.1|  PREDICTED: probable LRR receptor-like serine...  79.3    3e-14   Glycine max [soybeans]
ref|XP_009356495.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  79.3    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_010246459.1|  PREDICTED: probable LRR receptor-like serine...  79.0    3e-14   Nelumbo nucifera [Indian lotus]
emb|CDY48073.1|  BnaA06g33550D                                        79.0    3e-14   Brassica napus [oilseed rape]
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                   79.0    3e-14   Eucalyptus grandis [rose gum]
gb|KDP21117.1|  hypothetical protein JCGZ_21588                       79.0    4e-14   Jatropha curcas
ref|XP_004236956.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      79.0    4e-14   Solanum lycopersicum
ref|XP_009131513.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      79.0    4e-14   Brassica rapa
ref|XP_010246458.1|  PREDICTED: probable LRR receptor-like serine...  79.0    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002317403.1|  leucine-rich repeat transmembrane protein ki...  79.0    4e-14   Populus trichocarpa [western balsam poplar]
gb|KFK25832.1|  hypothetical protein AALP_AA8G167900                  79.0    4e-14   Arabis alpina [alpine rockcress]
emb|CDX70667.1|  BnaC03g07510D                                        79.0    4e-14   
emb|CDX78667.1|  BnaA03g05790D                                        79.0    4e-14   
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...  79.0    4e-14   Brassica rapa
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.0    4e-14   
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.0    4e-14   
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  78.6    4e-14   
emb|CDX83534.1|  BnaC07g22740D                                        78.6    4e-14   
ref|XP_004304172.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      78.6    5e-14   
emb|CDY26481.1|  BnaC09g41870D                                        78.6    6e-14   
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      78.6    6e-14   
emb|CDX69484.1|  BnaA10g18330D                                        78.6    6e-14   
gb|EMT30099.1|  Putative LRR receptor-like serine/threonine-prote...  78.2    6e-14   
ref|XP_002863454.1|  hypothetical protein ARALYDRAFT_330836           78.2    6e-14   
gb|EAZ22359.1|  hypothetical protein OsJ_06018                        77.8    7e-14   
ref|XP_010316837.1|  PREDICTED: probable LRR receptor-like serine...  78.2    8e-14   
gb|EYU44266.1|  hypothetical protein MIMGU_mgv1a002951mg              77.8    9e-14   
ref|XP_006467628.1|  PREDICTED: probable LRR receptor-like serine...  77.8    1e-13   
gb|KDO77893.1|  hypothetical protein CISIN_1g006907mg                 77.8    1e-13   
ref|XP_006467627.1|  PREDICTED: probable LRR receptor-like serine...  77.8    1e-13   
ref|XP_009101570.1|  PREDICTED: probable LRR receptor-like serine...  77.4    1e-13   
ref|XP_009101569.1|  PREDICTED: probable LRR receptor-like serine...  77.4    1e-13   
ref|XP_002522232.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  77.4    1e-13   
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.4    1e-13   
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.4    1e-13   
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.4    1e-13   
emb|CDY39449.1|  BnaAnng05800D                                        77.4    1e-13   
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.4    1e-13   
ref|XP_009402861.1|  PREDICTED: probable LRR receptor-like serine...  77.4    1e-13   
gb|EEC72800.1|  hypothetical protein OsI_06491                        77.4    1e-13   
ref|XP_003571896.1|  PREDICTED: probable LRR receptor-like serine...  77.4    1e-13   
ref|XP_007045670.1|  LRR receptor-like serine/threonine-protein k...  77.8    1e-13   
ref|NP_001046389.1|  Os02g0236100                                     77.0    1e-13   
emb|CDX77614.1|  BnaC07g18680D                                        77.0    2e-13   
ref|XP_010518814.1|  PREDICTED: probable LRR receptor-like serine...  77.0    2e-13   
gb|AFO67893.1|  leucine-rich repeat receptor-like kinase              77.0    2e-13   
ref|XP_004491764.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.0    2e-13   
ref|XP_010518811.1|  PREDICTED: probable LRR receptor-like serine...  76.6    2e-13   
ref|XP_008389350.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...  76.6    2e-13   
ref|XP_008792202.1|  PREDICTED: probable LRR receptor-like serine...  76.6    2e-13   
ref|XP_007025341.1|  Leucine-rich repeat protein kinase family pr...  76.6    3e-13   
ref|XP_007025340.1|  Leucine-rich repeat protein kinase family pr...  76.6    3e-13   
ref|XP_010518812.1|  PREDICTED: probable LRR receptor-like serine...  76.6    3e-13   
ref|XP_010518809.1|  PREDICTED: probable LRR receptor-like serine...  76.6    3e-13   
ref|XP_010518810.1|  PREDICTED: probable LRR receptor-like serine...  76.6    3e-13   
dbj|BAB09221.1|  receptor-like protein kinase                         76.3    3e-13   
ref|XP_006398263.1|  hypothetical protein EUTSA_v10000817mg           76.3    3e-13   
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  76.3    3e-13   
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg           76.3    3e-13   
ref|NP_199390.2|  putative LRR receptor-like serine/threonine-pro...  76.3    3e-13   
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...  76.3    3e-13   
gb|ACD56650.1|  putative leucine-rich repeat transmembrane protein    76.3    3e-13   
gb|KEH36623.1|  LRR receptor-like kinase                              76.3    3e-13   
ref|XP_003563960.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.3    3e-13   
ref|XP_006290715.1|  hypothetical protein CARUB_v10016813mg           76.3    4e-13   
gb|KEH17047.1|  NSP-interacting kinase-like protein                   75.9    4e-13   
ref|XP_010925612.1|  PREDICTED: probable LRR receptor-like serine...  75.9    4e-13   
ref|XP_004135130.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  75.9    5e-13   
ref|XP_011077619.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      75.9    5e-13   
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      75.9    5e-13   
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...  75.9    5e-13   
gb|ACN30679.1|  unknown                                               75.9    5e-13   
emb|CBI16897.3|  unnamed protein product                              75.5    5e-13   
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  75.9    5e-13   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...  75.9    5e-13   
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  75.5    5e-13   
emb|CDP00520.1|  unnamed protein product                              75.5    5e-13   
gb|AFK34142.1|  unknown                                               70.9    6e-13   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  75.1    7e-13   
ref|XP_006449530.1|  hypothetical protein CICLE_v10014603mg           75.1    7e-13   
gb|ACL52449.1|  unknown                                               75.1    8e-13   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570        75.1    9e-13   
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein    75.1    9e-13   
ref|XP_008647816.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  74.7    1e-12   
ref|NP_001152329.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  74.7    1e-12   
gb|KFK31520.1|  hypothetical protein AALP_AA6G123400                  74.7    1e-12   
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...  74.7    1e-12   
ref|XP_009402860.1|  PREDICTED: probable LRR receptor-like serine...  74.7    1e-12   
gb|KFK39862.1|  hypothetical protein AALP_AA3G298400                  74.3    2e-12   
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg           73.9    2e-12   
gb|KHN13790.1|  Protein NSP-INTERACTING KINASE 1                      73.9    2e-12   
ref|XP_003552626.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.9    2e-12   
ref|XP_011085976.1|  PREDICTED: probable LRR receptor-like serine...  73.9    2e-12   
ref|XP_008383876.1|  PREDICTED: probable LRR receptor-like serine...  72.8    2e-12   
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein    73.6    2e-12   
ref|XP_004951350.1|  PREDICTED: probable LRR receptor-like serine...  73.6    3e-12   
ref|XP_008792970.1|  PREDICTED: probable LRR receptor-like serine...  73.2    3e-12   
emb|CAH56437.1|  somatic embryogenesis receptor-like kinase 1         73.6    3e-12   
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...  73.2    3e-12   
gb|KHN28623.1|  Putative LRR receptor-like serine/threonine-prote...  73.2    3e-12   
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010        73.2    4e-12   
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein    72.8    4e-12   
gb|KJB69704.1|  hypothetical protein B456_011G038400                  72.8    4e-12   
gb|KJB69703.1|  hypothetical protein B456_011G038400                  72.8    4e-12   
gb|KJB69702.1|  hypothetical protein B456_011G038400                  72.8    5e-12   
ref|NP_189183.2|  NSP-interacting kinase 2                            72.8    5e-12   
ref|NP_974360.1|  NSP-interacting kinase 2                            72.8    5e-12   
ref|NP_001189971.1|  NSP-interacting kinase 2                         72.8    5e-12   
ref|XP_008446508.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  72.8    5e-12   
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      72.4    6e-12   
ref|XP_010925613.1|  PREDICTED: probable LRR receptor-like serine...  72.0    6e-12   
ref|XP_008446507.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  72.4    6e-12   
ref|XP_008371497.1|  PREDICTED: probable LRR receptor-like serine...  72.4    6e-12   
ref|XP_004295585.1|  PREDICTED: probable LRR receptor-like serine...  72.4    7e-12   
ref|XP_010686227.1|  PREDICTED: probable LRR receptor-like serine...  72.4    7e-12   
ref|XP_009351465.1|  PREDICTED: probable LRR receptor-like serine...  72.4    7e-12   
gb|ADD60694.1|  putative somatic embryogenesis receptor kinase 1      69.3    7e-12   
ref|XP_008371496.1|  PREDICTED: probable LRR receptor-like serine...  72.0    8e-12   
ref|XP_008371495.1|  PREDICTED: probable LRR receptor-like serine...  72.0    8e-12   
ref|XP_009352740.1|  PREDICTED: probable LRR receptor-like serine...  72.0    9e-12   
ref|XP_008339771.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  72.0    9e-12   
ref|XP_006404888.1|  hypothetical protein EUTSA_v10000081mg           71.6    1e-11   
emb|CAM31941.1|  hypothetical protein                                 71.6    1e-11   
ref|NP_001057375.2|  Os06g0274300                                     68.6    1e-11   
ref|XP_011070875.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  71.2    2e-11   
ref|XP_007045673.1|  NSP-interacting kinase 2, putative               71.2    2e-11   
ref|XP_002309372.1|  leucine-rich repeat family protein               71.2    2e-11   
emb|CDY39685.1|  BnaA04g14020D                                        71.2    2e-11   
ref|XP_009417455.1|  PREDICTED: probable LRR receptor-like serine...  71.2    2e-11   
ref|XP_006453537.1|  hypothetical protein CICLE_v10007718mg           70.9    2e-11   
ref|XP_010481533.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-11   
ref|XP_010481532.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-11   
ref|XP_010481531.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-11   
ref|XP_010494726.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-11   
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-11   
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-11   
gb|EYU28925.1|  hypothetical protein MIMGU_mgv1a003010mg              70.9    2e-11   
ref|XP_010494725.1|  PREDICTED: probable LRR receptor-like serine...  70.9    2e-11   
ref|XP_004297175.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      70.9    2e-11   
ref|XP_002325107.1|  leucine-rich repeat family protein               70.5    3e-11   
ref|XP_006279596.1|  hypothetical protein CARUB_v10026097mg           70.5    3e-11   
ref|XP_009129052.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      68.2    3e-11   
gb|ADD60682.1|  putative somatic embryogenesis protein kinase 1       70.1    3e-11   
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...  70.1    4e-11   
ref|XP_008443821.1|  PREDICTED: probable LRR receptor-like serine...  70.1    5e-11   
gb|ADD60706.1|  putative somatic embryogenesis protein kinase 1       69.7    5e-11   
ref|XP_004146714.1|  PREDICTED: probable LRR receptor-like serine...  69.7    5e-11   
gb|KHG18235.1|  hypothetical protein F383_07279                       69.7    5e-11   
ref|XP_006656876.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  69.7    5e-11   
ref|XP_010441669.1|  PREDICTED: probable LRR receptor-like serine...  69.3    6e-11   
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...  69.3    6e-11   
ref|XP_010441667.1|  PREDICTED: probable LRR receptor-like serine...  69.3    7e-11   
ref|XP_011085975.1|  PREDICTED: probable LRR receptor-like serine...  69.3    7e-11   
ref|XP_010268431.1|  PREDICTED: probable LRR receptor-like serine...  69.3    7e-11   
ref|XP_006845438.1|  hypothetical protein AMTR_s00019p00103320        69.3    8e-11   
ref|XP_010108365.1|  putative LRR receptor-like serine/threonine-...  69.3    8e-11   
emb|CDY65182.1|  BnaC04g56200D                                        68.9    1e-10   
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  68.9    1e-10   
emb|CAB79770.1|  receptor-like kinase homolog                         68.6    1e-10   
ref|XP_003610256.1|  Somatic embryogenesis receptor-like kinase       68.6    1e-10   
gb|ADD60669.1|  putative somatic embryogenesis protein kinase 1       68.6    1e-10   
ref|NP_194781.2|  senescence-associated receptor-like kinase          68.6    2e-10   
gb|EAZ36607.1|  hypothetical protein OsJ_20953                        68.2    2e-10   
ref|XP_006412696.1|  hypothetical protein EUTSA_v10024678mg           67.8    2e-10   
ref|XP_010277987.1|  PREDICTED: probable LRR receptor-like serine...  68.2    2e-10   
ref|NP_001057376.1|  Os06g0274500                                     68.2    2e-10   
ref|XP_002867342.1|  predicted protein                                68.2    2e-10   
emb|CAH56436.1|  somatic embryogenesis receptor-like kinase 2         68.2    2e-10   
ref|XP_008359493.1|  PREDICTED: probable LRR receptor-like serine...  68.2    2e-10   
gb|ADD60695.1|  putative somatic embryogenesis protein kinase 1       68.2    2e-10   
gb|EEC80384.1|  hypothetical protein OsI_22508                        67.8    2e-10   
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g           67.8    2e-10   
ref|XP_009345903.1|  PREDICTED: probable LRR receptor-like serine...  67.8    2e-10   
ref|XP_009360005.1|  PREDICTED: probable LRR receptor-like serine...  67.8    2e-10   
ref|XP_006412695.1|  hypothetical protein EUTSA_v10024678mg           67.8    2e-10   
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  65.1    2e-10   
emb|CDX99771.1|  BnaC02g35490D                                        65.9    2e-10   
ref|XP_010525766.1|  PREDICTED: probable LRR receptor-like serine...  67.8    3e-10   
ref|XP_008223590.1|  PREDICTED: probable LRR receptor-like serine...  67.8    3e-10   
gb|EMT23949.1|  Putative LRR receptor-like serine/threonine-prote...  67.4    3e-10   
dbj|BAJ89901.1|  predicted protein                                    67.4    3e-10   
ref|XP_002533978.1|  lrr receptor protein kinase, putative            67.0    3e-10   
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...  67.4    3e-10   
ref|XP_002880534.1|  leucine-rich repeat family protein               67.0    4e-10   
gb|KJB30563.1|  hypothetical protein B456_005G149000                  63.9    4e-10   
ref|XP_007013912.1|  Leucine-rich repeat protein kinase family pr...  67.0    5e-10   
emb|CDY46500.1|  BnaA02g27500D                                        64.7    6e-10   
ref|XP_009140509.1|  PREDICTED: probable LRR receptor-like serine...  66.6    7e-10   
gb|AFO67892.1|  leucine-rich repeat receptor-like kinase              66.2    7e-10   
ref|XP_011462643.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  66.2    7e-10   
ref|XP_004242632.1|  PREDICTED: probable LRR receptor-like serine...  66.2    8e-10   
gb|KDP38737.1|  hypothetical protein JCGZ_04090                       66.2    8e-10   
emb|CDP02874.1|  unnamed protein product                              66.2    9e-10   
dbj|BAJ91470.1|  predicted protein                                    66.2    9e-10   
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      65.9    1e-09   
ref|XP_006343723.1|  PREDICTED: probable LRR receptor-like serine...  65.9    1e-09   
ref|XP_002436858.1|  hypothetical protein SORBIDRAFT_10g010020        63.2    1e-09   
ref|XP_008781387.1|  PREDICTED: probable LRR receptor-like serine...  65.9    1e-09   
ref|XP_004965218.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  63.2    1e-09   
gb|KCW86417.1|  hypothetical protein EUGRSUZ_B03087                   65.5    1e-09   
ref|XP_010417134.1|  PREDICTED: probable LRR receptor-like serine...  65.5    1e-09   
ref|XP_003633168.1|  PREDICTED: probable LRR receptor-like serine...  65.5    2e-09   
ref|XP_004965217.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  63.2    2e-09   
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...  65.5    2e-09   
emb|CAN63294.1|  hypothetical protein VITISV_040285                   65.1    2e-09   
ref|XP_009796362.1|  PREDICTED: probable LRR receptor-like serine...  65.1    2e-09   
ref|XP_009611184.1|  PREDICTED: probable LRR receptor-like serine...  65.1    2e-09   
gb|EMT29112.1|  Putative LRR receptor-like serine/threonine-prote...  64.3    2e-09   
gb|ABD96908.1|  hypothetical protein                                  64.7    2e-09   
gb|KFK29623.1|  hypothetical protein AALP_AA7G158000                  64.7    3e-09   
ref|XP_004507770.1|  PREDICTED: probable LRR receptor-like serine...  64.7    3e-09   
gb|ADD60668.1|  putative somatic embryogenesis receptor kinase 1      61.6    3e-09   
gb|KJB53859.1|  hypothetical protein B456_009G008400                  64.3    3e-09   
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...  64.3    4e-09   
emb|CDY39211.1|  BnaA03g50230D                                        63.9    5e-09   
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg           63.9    6e-09   
ref|NP_001061919.1|  Os08g0442700                                     63.5    6e-09   
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...  63.5    6e-09   
gb|EAZ07144.1|  hypothetical protein OsI_29394                        63.5    6e-09   
gb|KFK39861.1|  hypothetical protein AALP_AA3G298300                  61.6    7e-09   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820        63.5    8e-09   
ref|XP_010472390.1|  PREDICTED: probable LRR receptor-like serine...  63.2    1e-08   
ref|XP_010429349.1|  PREDICTED: probable LRR receptor-like serine...  63.2    1e-08   
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                  63.2    1e-08   
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...  63.2    1e-08   
ref|XP_010914291.1|  PREDICTED: probable LRR receptor-like serine...  62.8    1e-08   
gb|KHG07759.1|  hypothetical protein F383_34545                       62.8    1e-08   
ref|XP_010047875.1|  PREDICTED: probable LRR receptor-like serine...  62.8    1e-08   
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...  62.8    1e-08   
gb|KJB76636.1|  hypothetical protein B456_012G097800                  62.8    1e-08   
gb|KJB76637.1|  hypothetical protein B456_012G097800                  62.8    1e-08   
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...  62.4    1e-08   
ref|XP_010687666.1|  PREDICTED: probable LRR receptor-like serine...  62.4    2e-08   
ref|XP_010687665.1|  PREDICTED: probable LRR receptor-like serine...  62.4    2e-08   
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...  62.4    2e-08   



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score =   132 bits (333),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSF-ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVN  312
            M R+W + ++VLG  +W+ I +S  ATLSP+GVNYEVVAL+AIKT LHDPYNVLENWDVN
Sbjct  1    MEREWFLPFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  60

Query  313  SVDPCSWRMXTCSPXGYVSA  372
            SVDPCSWRM TCSP GYVSA
Sbjct  61   SVDPCSWRMVTCSPDGYVSA  80



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score =   123 bits (308),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M  KWC+L+ V G ++   +ESS+A+LSPTG+NYEVVAL  IK +LHDPYNVLENWDV S
Sbjct  1    MEGKWCMLWYV-GLLVLTLMESSYASLSPTGINYEVVALTEIKKALHDPYNVLENWDVTS  59

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVSA
Sbjct  60   VDPCSWRMVTCSLDGYVSA  78



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score =   121 bits (303),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M  KWC+L+ V G ++   +ES +A+LSPTG+NYEVVAL  IK +LHDPYNVLENWDV S
Sbjct  1    MEGKWCMLWYV-GLLVLTLMESCYASLSPTGINYEVVALTEIKKALHDPYNVLENWDVTS  59

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVSA
Sbjct  60   VDPCSWRMVTCSIDGYVSA  78



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +G V+W  +E S ATLSPTG+NYEVVAL+ IKT+LHDPYNVLE+WD+NSVDPCSWRM TC
Sbjct  11   VGLVVWALMEISSATLSPTGINYEVVALVNIKTALHDPYNVLESWDINSVDPCSWRMVTC  70

Query  349  SPXGYVSA  372
            S  GYVSA
Sbjct  71   SSDGYVSA  78



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score =   118 bits (295),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  136  MARKWC-ILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVN  312
            MAR+     + +LG +LW + E + ATLSP+G+NYEVVALMAIK  L+DPYNVLENWD+N
Sbjct  1    MARRVLGFAFWMLGLLLWAWPEMAAATLSPSGINYEVVALMAIKMELNDPYNVLENWDIN  60

Query  313  SVDPCSWRMXTCSPXGYVSA  372
            SVDPCSWRM TCS  GYVSA
Sbjct  61   SVDPCSWRMVTCSADGYVSA  80



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F++   +E S ATLSPTG+N+EVVALMAIKT+L DPYNVLENWD+NSVDPCSWRM TCSP
Sbjct  14   FLVLALMEISSATLSPTGINFEVVALMAIKTALLDPYNVLENWDINSVDPCSWRMVTCSP  73

Query  355  XGYVSA  372
             GYVSA
Sbjct  74   DGYVSA  79



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  160  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRM  339
            + +LG +LW + E   ATLSP+G+NYEVVALMAIK  L+DPYNVLENWD+NSVDPCSWRM
Sbjct  10   FWMLGLLLWAWPELPAATLSPSGINYEVVALMAIKMELNDPYNVLENWDINSVDPCSWRM  69

Query  340  XTCSPXGYVSA  372
             TCS  GYVSA
Sbjct  70   VTCSADGYVSA  80



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLENWD+ SVDPCSWRM TC
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDITSVDPCSWRMITC  70

Query  349  SPXGYVSA  372
            SP GYVSA
Sbjct  71   SPDGYVSA  78



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score =   117 bits (292),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLENWD+ SVDPCSWRM TC
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDITSVDPCSWRMITC  70

Query  349  SPXGYVSA  372
            SP GYVSA
Sbjct  71   SPDGYVSA  78



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score =   117 bits (292),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F++   +E S ATLSPTG+N+EVVALMAIKT+L DPYNVLENWD+NSVDPCSWRM TCSP
Sbjct  14   FLVLALMEISSATLSPTGINFEVVALMAIKTALLDPYNVLENWDINSVDPCSWRMVTCSP  73

Query  355  XGYVSA  372
             GYVSA
Sbjct  74   DGYVSA  79



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLENWD+ SVDPCSWRM TC
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDITSVDPCSWRMITC  70

Query  349  SPXGYVSA  372
            SP GYVSA
Sbjct  71   SPDGYVSA  78



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M RK  +L+  L  V   F+ SS ATLSP+G+NYEVVALMAIK  LHDPYNVLENWD+NS
Sbjct  1    MGRK-ALLFWTLCLVPIDFLCSSSATLSPSGINYEVVALMAIKMELHDPYNVLENWDINS  59

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVSA
Sbjct  60   VDPCSWRMVTCSADGYVSA  78



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +1

Query  154  ILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSW  333
            + ++V+  VL   ++ S++TLSP+GVNYEVVAL+AIK+ LHDPYNVLENWD NSVDPCSW
Sbjct  7    LFWQVVLLVL-AMVKGSYSTLSPSGVNYEVVALIAIKSDLHDPYNVLENWDANSVDPCSW  65

Query  334  RMXTCSPXGYVSA  372
            RM TCSP GYVSA
Sbjct  66   RMVTCSPDGYVSA  78



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M RK  +L+  L  V   F+ SS ATLSP+G+NYEVVALMAIK  LHDPYNVLENWD+NS
Sbjct  1    MGRK-ALLFWTLCLVPIDFLCSSSATLSPSGINYEVVALMAIKMELHDPYNVLENWDINS  59

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVSA
Sbjct  60   VDPCSWRMVTCSADGYVSA  78



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   115 bits (288),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M R+  +L+  LG ++   +  S ATLSPTG+N+EVVALMAIK +LHDPYNVLENWD+NS
Sbjct  1    MDRRSLMLFR-LGLLVLALMGISSATLSPTGINFEVVALMAIKYNLHDPYNVLENWDMNS  59

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVSA
Sbjct  60   VDPCSWRMVTCSTDGYVSA  78



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  160  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRM  339
            + +LG +LW    +S ATLSP+G+NYEVVALMAIK  L+DPYNVLENWD+NSVDPCSWRM
Sbjct  10   FWMLGLLLWAGPLASAATLSPSGINYEVVALMAIKMELNDPYNVLENWDINSVDPCSWRM  69

Query  340  XTCSPXGYVSA  372
             TCS  GYVSA
Sbjct  70   VTCSVDGYVSA  80



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M RKWC+      +V+   +ES +A+LSPTG+NYEVVAL+ IK +LHDPYNVLENWDV S
Sbjct  1    MDRKWCMFL----YVVLTLMESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVTS  56

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVS+
Sbjct  57   VDPCSWRMVTCSNDGYVSS  75



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score =   114 bits (284),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  MARKWCILYEVLG--FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDV  309
            M +    L+ ++G   V    +++S ATLSPTG+NYEVVAL+AIKT+L+DP+NVLENWDV
Sbjct  9    MGKSGSFLWNLVGALLVFLALLQASSATLSPTGINYEVVALVAIKTALNDPHNVLENWDV  68

Query  310  NSVDPCSWRMXTCSPXGYVSA  372
            NSVDPCSWRM TC+  GYVSA
Sbjct  69   NSVDPCSWRMVTCTSDGYVSA  89



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F++   +E S ATLSP G+NYEVVAL+AIKT+L DPYNVL+NWD+NSVDPCSWRM TC+P
Sbjct  14   FLVLALMEISTATLSPAGINYEVVALVAIKTALRDPYNVLDNWDINSVDPCSWRMVTCTP  73

Query  355  XGYVSA  372
             GYVSA
Sbjct  74   DGYVSA  79



>ref|XP_009797107.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana sylvestris]
Length=520

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M R   +L+ V   ++   +E+SFATLSPTG+NYEVVAL  IK +LHDPYNVL+NWDVNS
Sbjct  8    MGRMLHLLWNVGLLLICTLMENSFATLSPTGINYEVVALTEIKKALHDPYNVLDNWDVNS  67

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVSA
Sbjct  68   VDPCSWRMVTCSFDGYVSA  86



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = +1

Query  169  LGFVLWV--FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            +G VL V  ++E S ATLSP+GVNYEVVALMAIK  L+DPYNVLENWD+NSVDPCSWRM 
Sbjct  10   VGLVLLVLAWMEGSAATLSPSGVNYEVVALMAIKNDLNDPYNVLENWDINSVDPCSWRMV  69

Query  343  TCSPXGYVSA  372
            TCS  GYVSA
Sbjct  70   TCSADGYVSA  79



>gb|KDO82336.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=391

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLENWD+ SVDPCSWRM TC
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDITSVDPCSWRMITC  70

Query  349  SPXGYVSA  372
            SP GYVSA
Sbjct  71   SPDGYVSA  78



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  160  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRM  339
            + +LG +LW     S ATLSP+G+NYEVVALMAI+  L+DPYNVLENWD+NSVDPCSWRM
Sbjct  24   FWMLGLLLWAGPLVSAATLSPSGINYEVVALMAIRMELNDPYNVLENWDINSVDPCSWRM  83

Query  340  XTCSPXGYVSA  372
             TCS  GYVSA
Sbjct  84   VTCSADGYVSA  94



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            LG ++      S ATLSPTG+NYEVVALMAIK++LHDPYNVLENWD NSVDPCSWRM TC
Sbjct  11   LGLLILALNGVSSATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSNSVDPCSWRMVTC  70

Query  349  SPXGYVSA  372
            +  GYVSA
Sbjct  71   TADGYVSA  78



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            LG ++      S ATLSPTG+NYEVVALMAIK++LHDPYNVLENWD NSVDPCSWRM TC
Sbjct  11   LGLLILALNGVSSATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSNSVDPCSWRMVTC  70

Query  349  SPXGYVSA  372
            +  GYVSA
Sbjct  71   TADGYVSA  78



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  160  YEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRM  339
            + +LG +LW     S ATLSP+G+NYEVVALMAI+  L+DPYNVLENWD+NSVDPCSWRM
Sbjct  24   FWMLGLLLWAGPLVSAATLSPSGINYEVVALMAIRMELNDPYNVLENWDINSVDPCSWRM  83

Query  340  XTCSPXGYVSA  372
             TCS  GYVSA
Sbjct  84   VTCSADGYVSA  94



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  157  LYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWR  336
            L+  +G ++   +E S++TLSP+GVNYEVVAL+AIK  L DPYNVLENWD NSVDPCSWR
Sbjct  7    LFWKVGLLVLAMVECSYSTLSPSGVNYEVVALIAIKNDLRDPYNVLENWDANSVDPCSWR  66

Query  337  MXTCSPXGYVSA  372
            M TCS  GYVSA
Sbjct  67   MVTCSQDGYVSA  78



>gb|KDO82335.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=540

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +GF++   I+  +ATLSP G+NYEVVAL+A+K +LHDPYNVLENWD+ SVDPCSWRM TC
Sbjct  11   VGFLVLALIDICYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDITSVDPCSWRMITC  70

Query  349  SPXGYVSA  372
            SP GYVSA
Sbjct  71   SPDGYVSA  78



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score =   112 bits (280),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 52/79 (66%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M R   + + V+  +    IESS ATLSP GVNYEVVAL  IK +LHDPYNVL+NWDV S
Sbjct  1    MERMLHLFWNVVLLLFCTLIESSSATLSPAGVNYEVVALTEIKKALHDPYNVLDNWDVTS  60

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVSA
Sbjct  61   VDPCSWRMVTCSLEGYVSA  79



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   112 bits (280),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M  KW +L +V+  ++++ + SS A+LSPTG+NYEVVALMAIK  L DPYNVLENWD N+
Sbjct  1    MEMKWSVLGKVV-LLVFILVHSSSASLSPTGINYEVVALMAIKNDLKDPYNVLENWDTNA  59

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSW   TCSP G VSA
Sbjct  60   VDPCSWTRVTCSPDGSVSA  78



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 5/79 (6%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M RKWC+   V+       +ES +A+LSPTG+NYEVVAL+ IK +LHDPYNVLENWDV S
Sbjct  1    MERKWCMFLYVV-----ALMESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVTS  55

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVS+
Sbjct  56   VDPCSWRMVTCSNDGYVSS  74



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score =   112 bits (279),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +1

Query  127  REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWD  306
            ++ M R    L++ LG ++   +E++ ATLSPTGVNYEV AL AIK+ L DP+NVLENWD
Sbjct  5    KDNMGRSTFTLWK-LGLLVLALVEAASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWD  63

Query  307  VNSVDPCSWRMXTCSPXGYVSA  372
             NSVDPCSWRM TC+P GYVSA
Sbjct  64   SNSVDPCSWRMVTCTPDGYVSA  85



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score =   112 bits (279),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +1

Query  127  REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWD  306
            ++ M R    L++ LG ++   +E++ ATLSPTGVNYEV AL AIK+ L DP+NVLENWD
Sbjct  5    KDNMGRSTFTLWK-LGLLVLALVEAASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWD  63

Query  307  VNSVDPCSWRMXTCSPXGYVSA  372
             NSVDPCSWRM TC+P GYVSA
Sbjct  64   SNSVDPCSWRMVTCTPDGYVSA  85



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score =   112 bits (279),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +1

Query  127  REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWD  306
            ++ M R    L++ LG ++   +E++ ATLSPTGVNYEV AL AIK+ L DP+NVLENWD
Sbjct  5    KDNMGRSTFTLWK-LGLLVLALVEAASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWD  63

Query  307  VNSVDPCSWRMXTCSPXGYVSA  372
             NSVDPCSWRM TC+P GYVSA
Sbjct  64   SNSVDPCSWRMVTCTPDGYVSA  85



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 5/79 (6%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M RKWC+   V+       +ES +A+LSPTG+NYEVVAL+ IK +LHDPYNVLENWDV S
Sbjct  1    MERKWCMFLYVV-----ALMESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVTS  55

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TCS  GYVS+
Sbjct  56   VDPCSWRMVTCSNDGYVSS  74



>gb|KJB61042.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
 gb|KJB61044.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=391

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M  K  +L+  LG ++      S ATLSPTG+NYEVVALMAIK++LHDPYNVLENWD NS
Sbjct  1    MEIKNLMLFR-LGLLILALNGVSSATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSNS  59

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TC+  GYVSA
Sbjct  60   VDPCSWRMVTCTADGYVSA  78



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score =   110 bits (275),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  187  VFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            + + SS ATLSP G+NYEVVALMAIKT L DPYNVL+NWD+NSVDPCSWRM TCS  GYV
Sbjct  17   ILLPSSTATLSPAGINYEVVALMAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYV  76

Query  367  SA  372
            SA
Sbjct  77   SA  78



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   110 bits (274),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            +E S ATLSP+G+NYEVVALM IK +L+DPYNVLENWD+NSVDPCSWRM TCS  GYVSA
Sbjct  19   MEGSSATLSPSGINYEVVALMTIKNNLNDPYNVLENWDINSVDPCSWRMVTCSSDGYVSA  78



>gb|KJB61043.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=536

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M  K  +L+  LG ++      S ATLSPTG+NYEVVALMAIK++LHDPYNVLENWD NS
Sbjct  1    MEIKNLMLFR-LGLLILALNGVSSATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSNS  59

Query  316  VDPCSWRMXTCSPXGYVSA  372
            VDPCSWRM TC+  GYVSA
Sbjct  60   VDPCSWRMVTCTADGYVSA  78



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score =   109 bits (273),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 8/78 (10%)
 Frame = +1

Query  163  EVLGFVLWVFI--------ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSV  318
            EV  F+ W  +        +SSFATLSP+G+NYEVVALMAIK  L DP+NVLENWD+NSV
Sbjct  2    EVRAFLYWQLLSLVLALLGDSSFATLSPSGINYEVVALMAIKNDLVDPHNVLENWDMNSV  61

Query  319  DPCSWRMXTCSPXGYVSA  372
            DPCSWRM TCS  GYVS+
Sbjct  62   DPCSWRMVTCSADGYVSS  79



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score =   109 bits (272),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            +E S ATLSP+G+NYEVVALM IK +L+DPYNVLENWD+NSVDPCSWRM TCS  GYVSA
Sbjct  1    MEGSSATLSPSGINYEVVALMTIKNNLNDPYNVLENWDINSVDPCSWRMVTCSSDGYVSA  60



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYE-VVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F++   +E S ATLSP G+NYE VVAL+AIKT+L DPYNVL+NWD+NSVDPCSWRM TC+
Sbjct  14   FLVLALMEISTATLSPAGINYEAVVALVAIKTALRDPYNVLDNWDINSVDPCSWRMVTCT  73

Query  352  PXGYVSA  372
            P GYVSA
Sbjct  74   PDGYVSA  80



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +G ++ V  ++S ATLSPTGVNYEV AL+AIK+ L DP+NVLENWD NSVDPCSWRM TC
Sbjct  14   VGLLVLVLADASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDPCSWRMVTC  73

Query  349  SPXGYVSA  372
            +P GYVSA
Sbjct  74   TPDGYVSA  81



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  178  VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPX  357
            +L V +  S ATLSP G+NYEVVALMAIKT L DPYNVL+NWD+NSVDPCSWRM TCS  
Sbjct  20   LLAVILPPSNATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSVDPCSWRMVTCSSD  79

Query  358  GYVSA  372
            GYVSA
Sbjct  80   GYVSA  84



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = +1

Query  145  KWCILY--EVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSV  318
            +W +++    L  VL  F+  S ATLSP+G+NYEVVAL+AIK  L+DPYNVLENWD+NSV
Sbjct  34   EWKVVFFCRTLCLVLLHFLYLSAATLSPSGINYEVVALVAIKMELNDPYNVLENWDINSV  93

Query  319  DPCSWRMXTCSPXGYVSA  372
            DPCSWRM TC+  GYVSA
Sbjct  94   DPCSWRMVTCTSDGYVSA  111



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +G ++ V  ++S ATLSPTGVNYEV AL+AIK+ L DP+NVLENWD NSVDPCSWRM TC
Sbjct  14   VGLLVLVLADASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDPCSWRMVTC  73

Query  349  SPXGYVSA  372
            +P GYVSA
Sbjct  74   TPDGYVSA  81



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = +1

Query  145  KWCILY--EVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSV  318
            +W +++    L  VL  F+  S ATLSP+G+NYEVVAL+AIK  L+DPYNVLENWD+NSV
Sbjct  34   EWKVVFFCRTLCLVLLHFLYLSAATLSPSGINYEVVALVAIKMELNDPYNVLENWDINSV  93

Query  319  DPCSWRMXTCSPXGYVSA  372
            DPCSWRM TC+  GYVSA
Sbjct  94   DPCSWRMVTCTSDGYVSA  111



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +1

Query  130  EIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDV  309
            E M     +L++V G +L   IE+S ATLSPTGVNYEV AL+AIK+ L DP+NVLENWD 
Sbjct  29   EYMGTTSFMLWKV-GLLLLASIEASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDS  87

Query  310  NSVDPCSWRMXTCSPXGYVSA  372
            NSVDPCSWRM TC+  GYVSA
Sbjct  88   NSVDPCSWRMVTCTADGYVSA  108



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +1

Query  130  EIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDV  309
            E M     +L++V G +L   IE+S ATLSPTGVNYEV AL+AIK+ L DP+NVLENWD 
Sbjct  29   EYMGTTSFMLWKV-GLLLLASIEASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDS  87

Query  310  NSVDPCSWRMXTCSPXGYVSA  372
            NSVDPCSWRM TC+  GYVSA
Sbjct  88   NSVDPCSWRMVTCTADGYVSA  108



>dbj|BAD68256.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
Length=418

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  187  VFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            + + SS ATLSP G+NYEVVALMAIKT L DPYNVL+NWD+NSVDPCSWRM TCS  GYV
Sbjct  17   ILLPSSTATLSPAGINYEVVALMAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYV  76

Query  367  SA  372
            SA
Sbjct  77   SA  78



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +1

Query  118  RI*REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  297
            +I ++ M R   +L + LG ++    E+S ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  2    KIEKDYMGRSNFMLCK-LGLLVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLE  60

Query  298  NWDVNSVDPCSWRMXTCSPXGYVSA  372
            NWD NSVDPCSWRM TC+P GYVSA
Sbjct  61   NWDSNSVDPCSWRMVTCTPDGYVSA  85



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +1

Query  118  RI*REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  297
            +I ++ M R   +L + LG ++    E+S ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  2    KIEKDYMGRSNFMLCK-LGLLVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLE  60

Query  298  NWDVNSVDPCSWRMXTCSPXGYVSA  372
            NWD NSVDPCSWRM TC+P GYVSA
Sbjct  61   NWDSNSVDPCSWRMVTCTPDGYVSA  85



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +1

Query  118  RI*REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLE  297
            +I ++ M R   +L + LG ++    E+S ATLSPTGVNYEV AL AIK+ L DP+NVLE
Sbjct  2    KIEKDYMGRSNFMLCK-LGLLVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLE  60

Query  298  NWDVNSVDPCSWRMXTCSPXGYVSA  372
            NWD NSVDPCSWRM TC+P GYVSA
Sbjct  61   NWDSNSVDPCSWRMVTCTPDGYVSA  85



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +G + ++ + ++ ATLSPTGVNYEVVALMAIK  L DPY+ LENWD+NSVDPCSWRM TC
Sbjct  8    VGLLFFILVGAASATLSPTGVNYEVVALMAIKNELKDPYDALENWDINSVDPCSWRMITC  67

Query  349  SPXGYVSA  372
            S  GYVSA
Sbjct  68   SSDGYVSA  75



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score =   107 bits (267),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            S ATLSP G+NYEVVALMAIKT L DPYNVL+NWD+NSVDPCSWRM TCS  GYVSA
Sbjct  28   SNATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSVDPCSWRMVTCSSDGYVSA  84



>ref|XP_008654537.1| PREDICTED: uncharacterized LOC100272802 isoform X1 [Zea mays]
 gb|AFW80157.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +1

Query  148  WCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPC  327
            WC+    L   L   + SS ATLSP G+NYEVVALMAIKT L DPYNVL+NWD+NSVDPC
Sbjct  6    WCLPVAAL---LAAILPSSDATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSVDPC  62

Query  328  SWRMXTCSPXGYVSA  372
            SWRM TCS  GYVSA
Sbjct  63   SWRMVTCSSDGYVSA  77



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  187  VFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            + +ESS ATLSPTG+NYEVVAL  IK +LHDPYNVL+NWDVNSVDPCSWRM TCS  GYV
Sbjct  16   LMMESSSATLSPTGINYEVVALTEIKKALHDPYNVLDNWDVNSVDPCSWRMVTCSFDGYV  75

Query  367  SA  372
            SA
Sbjct  76   SA  77



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +1

Query  169  LGFVLW-VFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            +G +L+   +ESS ATLSP GVNYEVVAL  IK +LHDPYNVL+NWDVNSVDPCSWRM T
Sbjct  8    VGLLLFCTLMESSSATLSPAGVNYEVVALTEIKKALHDPYNVLDNWDVNSVDPCSWRMVT  67

Query  346  CSPXGYVSA  372
            CS  GYVSA
Sbjct  68   CSLDGYVSA  76



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score =   106 bits (264),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F++   +E S ATLSPTG+N+E  AL+AIKT+L DPYNVLENWD+NSVDPCSWRM TCSP
Sbjct  14   FLVLALMEISSATLSPTGINFE--ALVAIKTALLDPYNVLENWDINSVDPCSWRMVTCSP  71

Query  355  XGYVSA  372
             GYVSA
Sbjct  72   DGYVSA  77



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score =   106 bits (264),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F++   +E S ATLSPTG+N+E  AL+AIKT+L DPYNVLENWD+NSVDPCSWRM TCSP
Sbjct  14   FLVLALMEISSATLSPTGINFE--ALVAIKTALLDPYNVLENWDINSVDPCSWRMVTCSP  71

Query  355  XGYVSA  372
             GYVSA
Sbjct  72   DGYVSA  77



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score =   106 bits (264),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 9/78 (12%)
 Frame = +1

Query  163  EVLGFVLWVF--------IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSV  318
            E + FVLW          ++ S ATLSP+G+NYEVVALMAIK+ L+DPYNVLENWDVNSV
Sbjct  2    EGVRFVLWRLGFLVLVLLLDVSAATLSPSGINYEVVALMAIKSELNDPYNVLENWDVNSV  61

Query  319  DPCSWRMXTCSPXGYVSA  372
            DPCSWRM TCS  GYVS+
Sbjct  62   DPCSWRMVTCS-YGYVSS  78



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  166  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            V+  +L V +  S ATLSP G+NYEVVALMAIKT L DP+NVL+NWD+NSVDPCSWRM T
Sbjct  15   VVAGLLAVILPPSTATLSPAGINYEVVALMAIKTELEDPHNVLDNWDINSVDPCSWRMVT  74

Query  346  CSPXGYVSA  372
            CS  GYVSA
Sbjct  75   CSSDGYVSA  83



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score =   105 bits (261),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLENWD+NSVDPCSWRM TCSP G VSA
Sbjct  20   MEISSAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSA  79



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score =   105 bits (261),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLENWD+NSVDPCSWRM TCSP G VSA
Sbjct  20   MEISSAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSA  79



>gb|ACM89541.1| leucine-rich repeat receptor-like kinase [Glycine max]
Length=515

 Score =   103 bits (258),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLENWD+NSVDPCSWRM TCSP G VSA
Sbjct  1    MEISSAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSA  60



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   103 bits (258),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            S ATLSP G+NYEVVALMAIKT L D YNVL+NWD+NSVDPCSWRM TCS  GYVSA
Sbjct  24   SAATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSA  80



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score =   103 bits (258),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            S ATLSP G+NYEVVALMAIKT L D YNVL+NWD+NSVDPCSWRM TCS  GYVSA
Sbjct  24   SAATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSA  80



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score =   103 bits (258),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            S ATLSP G+NYEVVALMAIKT L D YNVL+NWD+NSVDPCSWRM TCS  GYVSA
Sbjct  24   SAATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSA  80



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score =   103 bits (258),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            S ATLSP G+NYEVVALMAIKT L D YNVL+NWD+NSVDPCSWRM TCS  GYVSA
Sbjct  24   SAATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSA  80



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 2/69 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF++ V F++ S ATLSPTGVNYEV AL+AIK  L+DPYNVLENWDVNSVDPCSWRM T
Sbjct  11   LGFLVLVWFLDVSSATLSPTGVNYEVTALVAIKNELNDPYNVLENWDVNSVDPCSWRMVT  70

Query  346  CSPXGYVSA  372
            C+  GYVSA
Sbjct  71   CT-DGYVSA  78



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score =   103 bits (257),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 2/68 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCSWRM T
Sbjct  11   LGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCSWRMVT  70

Query  346  CSPXGYVS  369
            C+  GYVS
Sbjct  71   CTD-GYVS  77



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  178  VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPX  357
            VL + +  + ATLSPTG+NYEVVALMAIKT L D YNVL+NWD+NSVDPCSWRM TCS  
Sbjct  17   VLCLLLPPAAATLSPTGINYEVVALMAIKTDLQDHYNVLDNWDINSVDPCSWRMVTCSSD  76

Query  358  GYVSA  372
            GYVSA
Sbjct  77   GYVSA  81



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score =   103 bits (257),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLENWD+NSVDPCSWRM TCSP G VS
Sbjct  19   MEISSAALSPSGINYEVVALMAIKNGLIDPHNVLENWDINSVDPCSWRMITCSPDGSVS  77



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score =   103 bits (257),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            +E S A LSP+G+NYEVVALMAIK  L DP+NVLENWD+NSVDPCSWRM TCSP G VS
Sbjct  19   MEISSAALSPSGINYEVVALMAIKNGLIDPHNVLENWDINSVDPCSWRMITCSPDGSVS  77



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score =   103 bits (257),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            ATLSP+GVN+EVVALMAIK  L DP+NVLENWD NSVDPCSWRM TCSP GYVS
Sbjct  23   ATLSPSGVNFEVVALMAIKYDLLDPHNVLENWDSNSVDPCSWRMVTCSPDGYVS  76



>gb|AAB71968.1| Putative Serine/Threonine protein kinase [Arabidopsis thaliana]
Length=588

 Score =   102 bits (255),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF+++V F + S ATLSPTGVNYEV AL+A+K  L+DPY VLENWDVNSVDPCSWRM +
Sbjct  11   LGFLVFVWFFDISSATLSPTGVNYEVTALVAVKNELNDPYKVLENWDVNSVDPCSWRMVS  70

Query  346  CSPXGYVSA  372
            C+  GYVS+
Sbjct  71   CTD-GYVSS  78



>gb|EPS59440.1| hypothetical protein M569_15369 [Genlisea aurea]
Length=82

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  139  ARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSV  318
            +RK  +L      +L +F    ++ LSP+GVNYEVVAL+ +K  LHDPYN LE+WD NSV
Sbjct  4    SRKNSLLLRTGLVILALFTGCCYSYLSPSGVNYEVVALIMVKRELHDPYNALESWDANSV  63

Query  319  DPCSWRMXTCSPXGYVSA  372
            DPCSWRM TC+  GYVS+
Sbjct  64   DPCSWRMITCTTDGYVSS  81



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   102 bits (253),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +G ++  +IE S ATLSP+G+NYEV AL+ IKT L DP+NVL+NWD  SVDPC WRM TC
Sbjct  10   VGLLVLSWIEESSATLSPSGINYEVEALVNIKTGLRDPHNVLDNWDSTSVDPCGWRMITC  69

Query  349  SPXGYVSA  372
            SP GYVS+
Sbjct  70   SPDGYVSS  77



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score =   102 bits (253),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  211  TLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            TLSP+GVN+EVVALMAIK  L DP+NVLENWD NSVDPCSWRM TCSP GYVS
Sbjct  24   TLSPSGVNFEVVALMAIKYDLLDPHNVLENWDSNSVDPCSWRMVTCSPDGYVS  76



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score =   102 bits (253),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            ++ S A LSP+G+NYEVVALMAIK  L+DP+NVLENWD+N VDPCSWRM TC+P G VSA
Sbjct  19   MKVSSAALSPSGINYEVVALMAIKNDLNDPHNVLENWDINYVDPCSWRMITCTPDGSVSA  78



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   101 bits (252),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +G ++  +IE S ATLSP+G+NYEV AL+ IKT L DP+NVL+NWD  SVDPC WRM TC
Sbjct  10   VGLLVLSWIEESSATLSPSGINYEVEALVNIKTGLRDPHNVLDNWDSTSVDPCGWRMITC  69

Query  349  SPXGYVSA  372
            SP GYVS+
Sbjct  70   SPDGYVSS  77



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score =   101 bits (252),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            S A LSP+G+NYEVVALMAIK  L+DP+NVLE+WD+NSVDPCSWRM TC+P G VSA
Sbjct  22   SSAALSPSGINYEVVALMAIKNELNDPHNVLESWDINSVDPCSWRMITCNPDGSVSA  78



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 2/69 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCSWRM T
Sbjct  11   LGFLVLVWFPDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCSWRMVT  70

Query  346  CSPXGYVSA  372
            C+  GYVSA
Sbjct  71   CT-DGYVSA  78



>gb|EPS73511.1| hypothetical protein M569_01245, partial [Genlisea aurea]
Length=636

 Score =   100 bits (250),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            +TLSP+GVNYEVVAL++IK SL+DPYN LE+WDVNSVDPCSWR  TCSP G+VSA
Sbjct  1    STLSPSGVNYEVVALISIKGSLNDPYNALESWDVNSVDPCSWRTVTCSPDGFVSA  55



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 2/68 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCSWRM T
Sbjct  11   LGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCSWRMVT  70

Query  346  CSPXGYVS  369
            C+  GYVS
Sbjct  71   CT-DGYVS  77



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 2/68 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCSWRM T
Sbjct  11   LGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCSWRMVT  70

Query  346  CSPXGYVS  369
            C+  GYVS
Sbjct  71   CT-DGYVS  77



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 2/68 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF++ V F + + ATLSPTGVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCSWRM T
Sbjct  11   LGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCSWRMVT  70

Query  346  CSPXGYVS  369
            C+  GYVS
Sbjct  71   CT-DGYVS  77



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 2/69 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF++ V  ++ S ATLSPTGVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRM T
Sbjct  6    LGFLVLVWLLDVSTATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVT  65

Query  346  CSPXGYVSA  372
            C+  GYVS 
Sbjct  66   CT-DGYVSG  73



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F++  ++ S  A+LSP GVNYEV+ALMAIKT+LHDPYNVLE WDV SVDPCSWRM TC+ 
Sbjct  8    FLVLAWLGSCSASLSPAGVNYEVMALMAIKTALHDPYNVLEGWDVTSVDPCSWRMVTCTG  67

Query  355  XGYVSA  372
             G+VS+
Sbjct  68   DGFVSS  73



>gb|KCW86689.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=598

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>ref|XP_010044598.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X5 [Eucalyptus 
grandis]
Length=624

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>ref|XP_010044594.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Eucalyptus 
grandis]
Length=627

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>gb|KCW86690.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>gb|KCW86687.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
 gb|KCW86688.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>gb|KCW86693.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>gb|KCW86692.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>gb|KCW86691.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=625

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>ref|XP_010044596.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Eucalyptus 
grandis]
Length=626

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>ref|XP_010044595.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Eucalyptus 
grandis]
Length=626

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>ref|XP_010044597.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X4 [Eucalyptus 
grandis]
Length=625

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>ref|XP_010044599.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X6 [Eucalyptus 
grandis]
Length=578

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  193  IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            +E S A LSP+G+NYEVVALMAIK +L DP+NVLENWD +SVDPCSWRM TCS  G VSA
Sbjct  19   MEISSAALSPSGINYEVVALMAIKGALTDPHNVLENWDSSSVDPCSWRMITCSSDGSVSA  78



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF+++V F + S ATLSPTGVNYEV AL+A+K  L+DPY VLENWDVNSVDPCSWRM +
Sbjct  11   LGFLVFVWFFDISSATLSPTGVNYEVTALVAVKNELNDPYKVLENWDVNSVDPCSWRMVS  70

Query  346  CSPXGYVSA  372
            C+  GYVS+
Sbjct  71   CT-DGYVSS  78



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 4/69 (6%)
 Frame = +1

Query  169  LGFVL--WVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            LGF++  W+F + S ATLSPTGVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRM 
Sbjct  13   LGFLVLVWLF-DVSTATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMV  71

Query  343  TCSPXGYVS  369
            +C+  GYVS
Sbjct  72   SCT-DGYVS  79



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 4/69 (6%)
 Frame = +1

Query  169  LGFVL--WVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            LGF++  W+F + S ATLSPTGVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRM 
Sbjct  13   LGFLVLVWLF-DVSTATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMV  71

Query  343  TCSPXGYVS  369
            +C+  GYVS
Sbjct  72   SCT-DGYVS  79



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 2/69 (3%)
 Frame = +1

Query  169  LGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            LGF++ V F++ S ATLSPTGVNYEV AL+A+K  L+DP NVL NWDVNSVDPCSWRM T
Sbjct  11   LGFLVLVWFLDVSSATLSPTGVNYEVTALVAVKNELNDPDNVLANWDVNSVDPCSWRMVT  70

Query  346  CSPXGYVSA  372
            C+  GYVSA
Sbjct  71   CT-DGYVSA  78



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 5/68 (7%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            +G ++   +E S ATLSPT     VVAL  IK++LHDPYNVLE+WD NSVDPCSWRM TC
Sbjct  8    VGLLVLTLVEISSATLSPT-----VVALANIKSALHDPYNVLESWDANSVDPCSWRMVTC  62

Query  349  SPXGYVSA  372
            SP GYV+A
Sbjct  63   SPDGYVTA  70



>gb|KCW86694.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=479

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             ++  ++ SS ATLSP+G+NYEVVALM IK +L DPYNVLE+WD  SVDPC WRM TC+P
Sbjct  13   LLVLAWLGSSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTP  72

Query  355  XGYVSA  372
             G VSA
Sbjct  73   DGSVSA  78



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            S ATLSPTGVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRM +C+  GYVS
Sbjct  25   STATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVS  79



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            S ATLSPTGVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRM +C+  GYVS
Sbjct  25   STATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVS  79



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            S ATLSPTGVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRM +C+  GYVS
Sbjct  25   SSATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVS  79



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +1

Query  202  SFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            S ATLSPTGVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRM +C+  GYVS
Sbjct  25   SSATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVS  79



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  ARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSV  318
            A++ C  YE+   V      S+   LSP GVNYEV ALM +K SL DP++VLENWD +SV
Sbjct  23   AKRSC-EYELFALVFLFSWVSAAGVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSV  81

Query  319  DPCSWRMXTCSPXGYV  366
            DPCSW M TCSP   V
Sbjct  82   DPCSWTMVTCSPENLV  97



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  ARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSV  318
            A++ C  YE+   V      S+   LSP GVNYEV ALM +K SL DP++VLENWD +SV
Sbjct  23   AKRSC-EYELFALVFLFSWVSAAGVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSV  81

Query  319  DPCSWRMXTCSPXGYV  366
            DPCSW M TCSP   V
Sbjct  82   DPCSWTMVTCSPENLV  97



>ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis]
Length=624

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +1

Query  166  VLGF-VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            V GF VL  F+  S A L+P GVNYEV ALM IK SLHDP+NVL NWD +SVDPCSW M 
Sbjct  9    VFGFLVLLSFLVYSNAMLTPAGVNYEVQALMEIKNSLHDPHNVL-NWDESSVDPCSWNMI  67

Query  343  TCSPXGYVSA  372
            TCS   +V+ 
Sbjct  68   TCSSDKFVTG  77



>ref|XP_009418103.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=573

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = +1

Query  166  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            VL F  WV   ++ A LSP GVN+EV ALM IK SL DP+ VLENWD +SVDPCSW M T
Sbjct  13   VLFFWPWV---TATAMLSPKGVNFEVQALMGIKASLEDPHGVLENWDQDSVDPCSWTMVT  69

Query  346  CSPXGYV  366
            CSP   V
Sbjct  70   CSPENLV  76



>ref|XP_009418102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=623

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = +1

Query  166  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            VL F  WV   ++ A LSP GVN+EV ALM IK SL DP+ VLENWD +SVDPCSW M T
Sbjct  13   VLFFWPWV---TATAMLSPKGVNFEVQALMGIKASLEDPHGVLENWDQDSVDPCSWTMVT  69

Query  346  CSPXGYV  366
            CSP   V
Sbjct  70   CSPENLV  76



>ref|XP_010502426.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Camelina sativa]
Length=645

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +1

Query  127  REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWD  306
            RE+  +K C L+  L F    F+  S A L+  GVNYEV+AL+ IK+SL DP+ VL NWD
Sbjct  17   REV--KKSCALFS-LTFFFICFLSFSSAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWD  73

Query  307  VNSVDPCSWRMXTCSPXGYV  366
              +VDPCSW M TCSP G+V
Sbjct  74   DTAVDPCSWNMITCSPDGFV  93



>ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris]
Length=624

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +1

Query  166  VLGF-VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            VL F +L+ F+  S A L+P GVNYEV ALM IK SLHDP+NVL NWD +SVDPCSW M 
Sbjct  9    VLAFLILFSFLFYSNAMLTPAGVNYEVQALMEIKNSLHDPHNVL-NWDESSVDPCSWNMI  67

Query  343  TCSPXGYVSA  372
            TCS   +V+ 
Sbjct  68   TCSTDKFVTG  77



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +1

Query  163  EVLGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRM  339
            +VL FVL+  F   S A LSP GVN+EV+ALM IK SL DP+ +L+NWD ++VDPCSW M
Sbjct  8    DVLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNM  67

Query  340  XTCSPXGYV  366
             TCSP   V
Sbjct  68   VTCSPENLV  76



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +1

Query  163  EVLGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRM  339
            +VL FVL+  F   S A LSP GVN+EV+ALM IK SL DP+ +L+NWD ++VDPCSW M
Sbjct  8    DVLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNM  67

Query  340  XTCSPXGYV  366
             TCSP   V
Sbjct  68   VTCSPENLV  76



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +1

Query  163  EVLGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRM  339
            +VL FVL+  F   S A LSP GVN+EV+ALM IK SL DP+ +L+NWD ++VDPCSW M
Sbjct  8    DVLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNM  67

Query  340  XTCSPXGYV  366
             TCSP   V
Sbjct  68   VTCSPENLV  76



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            L +++ S  A LSP GVNYEV ALM IK SL DP+ VLENWD ++VDPCSW M TCSP  
Sbjct  17   LLIWVSSINALLSPKGVNYEVQALMGIKASLQDPHGVLENWDGDAVDPCSWTMVTCSPES  76

Query  361  YV  366
             V
Sbjct  77   LV  78



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW ++  +   LSP GVNYEV ALMAIK +LHDP+ VL+NWD ++VDPCSW M TCSP  
Sbjct  16   LWFWVPIN-GLLSPKGVNYEVQALMAIKDALHDPHGVLDNWDADAVDPCSWAMVTCSPES  74

Query  361  YV  366
             V
Sbjct  75   LV  76



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +1

Query  178  VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPX  357
            +LW F  ++   LSP GVN+EV ALM IK SLHDP+ VL+NWD ++VDPCSW M TCSP 
Sbjct  15   LLW-FCSTANGLLSPKGVNFEVQALMGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  73

Query  358  GYV  366
              V
Sbjct  74   SLV  76



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F+ W    S+ A LSP GVN+EV ALM IK  L DP+NVLENWD +SVDPCSW M TCSP
Sbjct  16   FLSWA---SATAILSPKGVNFEVQALMGIKAFLKDPHNVLENWDKDSVDPCSWTMVTCSP  72

Query  355  XGYVSA  372
               V+ 
Sbjct  73   QNLVTG  78



>ref|XP_009417562.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=638

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW +  ++ A LSP GVNYEV ALM +K SL DP++VLENWD +SVDPCSW M TCSP  
Sbjct  27   LWTWSPAA-AVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSVDPCSWTMVTCSPEN  85

Query  361  YV  366
             V
Sbjct  86   LV  87



>ref|XP_002305735.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE86246.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=616

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +1

Query  154  ILYEVLGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCS  330
            IL+ +   V WV F +++ + LSP GVNYEV ALMA+K  + D   V+  WD+NSVDPC+
Sbjct  4    ILFHIFLAVFWVHFAQATGSLLSPKGVNYEVAALMAVKKEMRDESGVMNGWDLNSVDPCT  63

Query  331  WRMXTCSPXGYV  366
            W M  CSP G+V
Sbjct  64   WNMVGCSPEGFV  75



>gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +1

Query  199  SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            +++  LSP GVNYEVVALM+IK  LHDP+NVL NWD  +VDPCSW M TCSP G V+ 
Sbjct  21   TAYGLLSPKGVNYEVVALMSIKGLLHDPHNVL-NWDETAVDPCSWTMITCSPDGLVTG  77



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW F   +   LSP GVNYEV +LMAIK +LHDP+ VL+NWD ++VDPCSW M TCSP  
Sbjct  21   LW-FWAPTNGLLSPKGVNYEVQSLMAIKAALHDPHGVLDNWDADAVDPCSWAMVTCSPES  79

Query  361  YV  366
             V
Sbjct  80   LV  81



>gb|EEE57731.1| hypothetical protein OsJ_08242 [Oryza sativa Japonica Group]
Length=627

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            A LSP GVNYEV ALM IKTSL DP+ VL+NWD +SVDPCSW M TCSP   V+ 
Sbjct  27   ALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTG  81



>gb|EEC73926.1| hypothetical protein OsI_08784 [Oryza sativa Indica Group]
Length=627

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            A LSP GVNYEV ALM IKTSL DP+ VL+NWD +SVDPCSW M TCSP   V+ 
Sbjct  27   ALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTG  81



>ref|XP_008811184.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=635

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  172  GFVLWVFI---ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            G  L VF+    S+   LSP GVN+EV ALM IK SL DP++VLENWD +SVDPCSW M 
Sbjct  20   GLFLMVFLWTLASAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDRDSVDPCSWAMV  79

Query  343  TCSPXGYV  366
            TCSP   V
Sbjct  80   TCSPENLV  87



>gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  199  SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            +++  LSP GVN+EV ALM IK SLHDP+ VL+NWD ++VDPCSW M TCSP   V
Sbjct  21   TAYGLLSPKGVNFEVQALMGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPESLV  76



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
             ++F  +  A LSP GVN+EV ALM IK SL DP++VLENWD +SVDPCSW M TCSP  
Sbjct  15   FFLFWAAGTALLSPKGVNFEVQALMGIKASLMDPHSVLENWDQDSVDPCSWTMVTCSPEN  74

Query  361  YV  366
             V
Sbjct  75   LV  76



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW F  ++   LSP GVNYEV AL+ IK SLHDP+ VL+NWD ++VDPCSW M TCSP  
Sbjct  19   LW-FSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPES  77

Query  361  YV  366
             V
Sbjct  78   LV  79



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW F  ++   LSP GVNYEV AL+ IK SLHDP+ VL+NWD ++VDPCSW M TCSP  
Sbjct  19   LW-FSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPES  77

Query  361  YV  366
             V
Sbjct  78   LV  79



>ref|XP_010492459.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Camelina sativa]
Length=640

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            L   + S    LSP GVN+EV ALM IK SLHDP+ VL+NWD ++VDPCSW M TCSP  
Sbjct  23   LLCLLSSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSPEN  82

Query  361  YV  366
            +V
Sbjct  83   FV  84



>ref|XP_002876917.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53176.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            F+ SS A L+  GVN+EV+AL+ IK+SL DP+ VL+NWD  +VDPCSW M TCSP G+V
Sbjct  26   FLSSSSAELTDKGVNFEVLALIGIKSSLVDPHGVLQNWDDTAVDPCSWNMITCSPDGFV  84



>ref|XP_008807034.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Phoenix 
dactylifera]
Length=604

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = +1

Query  172  GFVLWVFI---ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            G  L VF     S+   LSP GVN+EV ALM IK SL DP++VLENWD +SVDPCSW M 
Sbjct  9    GLFLMVFFWTWASAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDQDSVDPCSWTMV  68

Query  343  TCSPXGYV  366
            TCSP   V
Sbjct  69   TCSPDNLV  76



>ref|XP_008783060.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 4/70 (6%)
 Frame = +1

Query  175  FVLWVFI----ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
             V W+       S+ A LSP GVN+EV ALM +K  L DP+NVLENWD +SVDPCSW M 
Sbjct  9    LVFWMVFFWSWASATAILSPKGVNFEVQALMGLKAFLKDPHNVLENWDKDSVDPCSWTMV  68

Query  343  TCSPXGYVSA  372
            TCSP   V+ 
Sbjct  69   TCSPQNLVTG  78



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW F  ++   LSP GVNYEV AL+ IK SLHDP+ VL+NWD ++VDPCSW M TCSP  
Sbjct  19   LW-FSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPES  77

Query  361  YV  366
             V
Sbjct  78   LV  79



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW F  ++   LSP GVNYEV AL+ IK SLHDP+ VL+NWD ++VDPCSW M TCSP  
Sbjct  19   LW-FSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPES  77

Query  361  YV  366
             V
Sbjct  78   LV  79



>dbj|BAG93736.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            A LSP GVNYEV ALM IKTSL DP+ VL+NWD +SVDPCSW M TCSP   V+ 
Sbjct  27   ALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTG  81



>ref|XP_008807033.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Phoenix 
dactylifera]
Length=624

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = +1

Query  172  GFVLWVFI---ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            G  L VF     S+   LSP GVN+EV ALM IK SL DP++VLENWD +SVDPCSW M 
Sbjct  9    GLFLMVFFWTWASAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDQDSVDPCSWTMV  68

Query  343  TCSPXGYV  366
            TCSP   V
Sbjct  69   TCSPDNLV  76



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +1

Query  166  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            V   + WV   S    LSP GVNYEV ALM IK SL DP+ VLENWD ++VDPCSW M T
Sbjct  14   VASLLFWV--SSINGLLSPKGVNYEVQALMGIKASLQDPHGVLENWDGDAVDPCSWTMVT  71

Query  346  CSPXGYV  366
            CSP   V
Sbjct  72   CSPESLV  78



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M R+  +   V  F LW     +   LSP GVNYEV ALM IK SLHDP++VL NWD NS
Sbjct  1    MRREEAVFCFVALFGLWT---CACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDENS  57

Query  316  VDPCSWRMXTCS  351
            VDPCSW + TCS
Sbjct  58   VDPCSWALVTCS  69



>ref|XP_010549936.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Tarenaya hassleriana]
 gb|ABD96874.1| hypothetical protein [Cleome spinosa]
Length=634

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +1

Query  133  IMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVN  312
            +M R++ + +   GF LW+ + S+ A LSP GVN+EV ALM IK SL+DP+ VLE+WD +
Sbjct  10   VMIRRFSVCF--FGF-LWL-LGSASALLSPQGVNFEVRALMDIKASLNDPHGVLESWDRD  65

Query  313  SVDPCSWRMXTCSPXGYV  366
            +VDPCSW M TCS   +V
Sbjct  66   AVDPCSWTMVTCSSENFV  83



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M R+  +   V  F LW     +   LSP GVNYEV ALM IK SLHDP++VL NWD NS
Sbjct  1    MRREEAVFCFVALFGLWT---CACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDENS  57

Query  316  VDPCSWRMXTCS  351
            VDPCSW + TCS
Sbjct  58   VDPCSWALVTCS  69



>ref|XP_010558548.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Tarenaya 
hassleriana]
Length=636

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
             GF+L   + S+ A LSP GVN+EV ALM IK SLHDP+ VLE+WD ++VDPCSW M TC
Sbjct  19   FGFLL--LLGSANALLSPQGVNFEVQALMDIKASLHDPHGVLESWDRDAVDPCSWTMVTC  76

Query  349  SPXGYV  366
            S   +V
Sbjct  77   SSDNFV  82



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
             GF+L   + S+ A LSP GVN+EV ALM IK SLHDP+ VLE+WD ++VDPCSW M TC
Sbjct  19   FGFLL--LLGSANALLSPQGVNFEVQALMDIKASLHDPHGVLESWDRDAVDPCSWTMVTC  76

Query  349  SPXGYV  366
            S   +V
Sbjct  77   SSDNFV  82



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            LW++  S+   LSP GVN+EV ALM IK  LHDP+NVLENWD ++VDPCSW M TCS
Sbjct  22   LWIW-NSANGLLSPKGVNFEVQALMRIKDCLHDPHNVLENWDKDAVDPCSWTMVTCS  77



>gb|KDO70178.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=517

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M R+  +   V  F LW     +   LSP GVNYEV ALM IK SLHDP++VL NWD NS
Sbjct  1    MRREEAVFCFVALFGLWT---CACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDENS  57

Query  316  VDPCSWRMXTCS  351
            VDPCSW + TCS
Sbjct  58   VDPCSWALVTCS  69



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 49/80 (61%), Gaps = 6/80 (8%)
 Frame = +1

Query  127  REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWD  306
            REI   K   LY     VLW    S+   LSP GVN+EV ALMAIK +L DP+ VL+NWD
Sbjct  5    REI---KVAFLYVATFLVLW---SSAAGLLSPKGVNFEVQALMAIKVALKDPHGVLDNWD  58

Query  307  VNSVDPCSWRMXTCSPXGYV  366
              SVDPCSW M TCS    V
Sbjct  59   STSVDPCSWAMVTCSSESLV  78



>ref|XP_009400110.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F LW  +    ATLSP GVN+EV  LM IK  L DP+ VLENWD +SVDPCSW M TCSP
Sbjct  19   FFLWTIVT---ATLSPKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSP  75

Query  355  XGYV  366
               V
Sbjct  76   ENSV  79



>ref|XP_006844161.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
 gb|ERN05836.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
Length=620

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  199  SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            SS A LSP GVN+EV ALM IK +L DP +VLENWD +SVDPCSW M TCSP   V
Sbjct  18   SSTALLSPKGVNFEVQALMGIKQALKDPLSVLENWDGDSVDPCSWAMITCSPENLV  73



>ref|XP_009400102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F LW  +    ATLSP GVN+EV  LM IK  L DP+ VLENWD +SVDPCSW M TCSP
Sbjct  19   FFLWTIVT---ATLSPKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSP  75

Query  355  XGYV  366
               V
Sbjct  76   ENSV  79



>gb|KHN14464.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  166  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            +L F  ++F  S+ A LSP GVN+EV ALM IK SL DP+ VL+NWD ++VDPCSW M T
Sbjct  9    LLSFTSFLFWSSANALLSPKGVNFEVQALMGIKYSLEDPHGVLDNWDGDAVDPCSWTMVT  68

Query  346  CSPXGYV  366
            CS    V
Sbjct  69   CSSENLV  75



>ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max]
Length=623

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  166  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            +L F  ++F  S+ A LSP GVN+EV ALM IK SL DP+ VL+NWD ++VDPCSW M T
Sbjct  9    LLSFTSFLFWSSANALLSPKGVNFEVQALMGIKYSLEDPHGVLDNWDGDAVDPCSWTMVT  68

Query  346  CSPXGYV  366
            CS    V
Sbjct  69   CSSENLV  75



>ref|XP_009417563.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=542

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +1

Query  172  GFVLWVFI---ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            G ++ VF+     + A LSP GVNYEV ALM +K SL DP++VLENWD +SVDPCSW M 
Sbjct  20   GLLVLVFLWTWSPAAAVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSVDPCSWTMV  79

Query  343  TCSPXGYV  366
            TCSP   V
Sbjct  80   TCSPENLV  87



>gb|AAM65586.1| receptor protein kinase-like protein [Arabidopsis thaliana]
Length=629

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            LGF L +   S    LSP GVN+EV ALM IK SLHDP+ VL+NWD ++VDPCSW M TC
Sbjct  10   LGF-LCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTC  68

Query  349  SPXGYV  366
            S   +V
Sbjct  69   SSENFV  74



>ref|XP_006400129.1| hypothetical protein EUTSA_v10012948mg [Eutrema salsugineum]
 gb|ESQ41582.1| hypothetical protein EUTSA_v10012948mg [Eutrema salsugineum]
Length=637

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +1

Query  133  IMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVN  312
            +M  +  ++Y  LGF+    + S    LS  GVN+EV ALM IK SLHDP+ VL+NWD +
Sbjct  8    MMTMRRSLVY-FLGFL--CLLSSVNGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRD  64

Query  313  SVDPCSWRMXTCSPXGYVSA  372
            +VDPCSW M TCSP  +V+ 
Sbjct  65   AVDPCSWTMVTCSPENFVTG  84



>ref|NP_197104.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
 sp|Q9LFS4.1|NIK1_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 1; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC01799.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAL66960.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAN86199.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59368.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92233.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
Length=638

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  169  LGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTC  348
            LGF L +   S    LSP GVN+EV ALM IK SLHDP+ VL+NWD ++VDPCSW M TC
Sbjct  19   LGF-LCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTC  77

Query  349  SPXGYV  366
            S   +V
Sbjct  78   SSENFV  83



>ref|XP_010100900.1| Protein NSP-INTERACTING KINASE 1 [Morus notabilis]
 gb|EXB85824.1| Protein NSP-INTERACTING KINASE 1 [Morus notabilis]
Length=695

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW F   +   LSP GVN+EV ALM IK SL DP+ VLENWD +SVDPCSW M TCSP  
Sbjct  17   LW-FWSCANGILSPKGVNFEVQALMGIKHSLEDPHGVLENWDGDSVDPCSWTMVTCSPES  75

Query  361  YV  366
             V
Sbjct  76   LV  77



>gb|AFW73242.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=80

 Score = 78.2 bits (191),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +1

Query  169  LGFVLWVFIESSFAT--LSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            L  VL  F     A+  LSP GVNYEV ALM IK  L DP+ VL+NWD +SVDPCSW M 
Sbjct  10   LALVLLFFCSCGPASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMV  69

Query  343  TCSPXGYVSA  372
            TCSP   V+ 
Sbjct  70   TCSPENLVTG  79



>ref|XP_006395648.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
 gb|ESQ32934.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
Length=643

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVFIE-SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F++ +F+  SS+A L+  GVN+EV+AL+ IK+SL DP+ VL NWD  +VDPCSW M TCS
Sbjct  28   FLIIIFLLCSSYAELTDKGVNFEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCS  87

Query  352  PXGYV  366
            P G+V
Sbjct  88   PDGFV  92



>ref|XP_010927979.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Elaeis 
guineensis]
Length=591

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  172  GFVLWVFI---ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            G  L VF+    S+   LSP GVN+EV AL+ IK SL DP++VLENWD +SVDPCSW M 
Sbjct  20   GLFLMVFLWTWASAAGLLSPKGVNFEVQALIDIKVSLKDPHSVLENWDQDSVDPCSWAMV  79

Query  343  TCSPXGYV  366
            TCSP   V
Sbjct  80   TCSPDNLV  87



>ref|XP_003633015.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Vitis vinifera]
Length=620

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F L +   +S + LSP GVNYEV ALMA+K  ++D  NVL+ WD+NSVDPC+W M  C+P
Sbjct  12   FCLPIMGGASISLLSPKGVNYEVAALMAMKNKMNDESNVLDGWDINSVDPCTWNMVGCTP  71

Query  355  XGYV  366
             G+V
Sbjct  72   EGFV  75



>ref|XP_006348615.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=621

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +1

Query  166  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            V GFV L  F+  S A L+P GVNYEV ALM IK SLHDP  VL NWD +SVDPCSW M 
Sbjct  6    VFGFVVLLSFLVYSNAMLTPGGVNYEVQALMEIKNSLHDPLGVL-NWDESSVDPCSWNMI  64

Query  343  TCSPXGYVSA  372
            TCS   +V+ 
Sbjct  65   TCSNDKFVTG  74



>ref|XP_009394555.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=634

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 46/73 (63%), Gaps = 8/73 (11%)
 Frame = +1

Query  148  WCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPC  327
            W + +  LGF        + A LSP GVN+EV ALM IK SL DP+ VL NWD +SVDPC
Sbjct  23   WVVFFWTLGF--------ASALLSPKGVNFEVQALMDIKASLKDPHGVLGNWDRDSVDPC  74

Query  328  SWRMXTCSPXGYV  366
            SW M +CSP   V
Sbjct  75   SWSMVSCSPENLV  87



>ref|XP_010453748.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Camelina sativa]
Length=639

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +1

Query  157  LYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWR  336
            ++  LG +L V + S    LSP GVN+EV ALM IK SLHDP+ VL+NWD ++VDPCSW 
Sbjct  15   IFCFLGLLLCV-LSSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWT  73

Query  337  MXTCSPXGYV  366
            M TCS   +V
Sbjct  74   MVTCSSENFV  83



>gb|KJB80538.1| hypothetical protein B456_013G102600 [Gossypium raimondii]
Length=624

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 48/73 (66%), Gaps = 6/73 (8%)
 Frame = +1

Query  148  WCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPC  327
            WC +      VL++F  S+ A LSP GVN+EV ALM IK  L DP+ VL+NWD  +VDPC
Sbjct  10   WCWV------VLFLFCSSATALLSPKGVNFEVQALMGIKELLVDPHGVLDNWDEAAVDPC  63

Query  328  SWRMXTCSPXGYV  366
            SW M TCS  G V
Sbjct  64   SWNMVTCSIDGLV  76



>gb|KHG05227.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=624

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 48/73 (66%), Gaps = 6/73 (8%)
 Frame = +1

Query  148  WCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPC  327
            WC +      VL++F  S+ A LSP GVN+EV ALM IK  L DP+ VL+NWD  +VDPC
Sbjct  10   WCWV------VLFLFCSSATALLSPKGVNFEVQALMGIKELLVDPHGVLDNWDEAAVDPC  63

Query  328  SWRMXTCSPXGYV  366
            SW M TCS  G V
Sbjct  64   SWNMVTCSIDGLV  76



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  172  GFVLWVFI---ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            G  L VF+    S+   LSP GVN+EV AL+ IK SL DP++VLENWD +SVDPCSW M 
Sbjct  20   GLFLMVFLWTWASAAGLLSPKGVNFEVQALIDIKVSLKDPHSVLENWDQDSVDPCSWAMV  79

Query  343  TCSPXGYV  366
            TCSP   V
Sbjct  80   TCSPDNLV  87



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  166  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            +L + L+ F  S+ A LSP GVN+EV ALM+IK SL DP+ VL+NWD ++VDPCSW M T
Sbjct  9    LLFYTLFFFWCSADAVLSPKGVNFEVQALMSIKQSLEDPHGVLDNWDGDAVDPCSWTMVT  68

Query  346  CSPXGYV  366
            CS    V
Sbjct  69   CSSENLV  75



>ref|XP_009596697.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=603

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = +1

Query  166  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            VLG++ L+ F+  + A L+P GVNYEV ALM IK  L+DP+NVL NWD N+VDPCSW M 
Sbjct  4    VLGYLTLFCFLAYANAMLTPAGVNYEVQALMEIKKVLNDPHNVL-NWDENAVDPCSWNMV  62

Query  343  TCSPXGYV  366
            TCS   +V
Sbjct  63   TCSTDKFV  70



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 48/80 (60%), Gaps = 6/80 (8%)
 Frame = +1

Query  127  REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWD  306
            REI A     LY      LW    S+   LSP GVN+EV ALMAIK +L DP+ VL+NWD
Sbjct  5    REIKAS---FLYVATFLALW---SSAAGLLSPKGVNFEVQALMAIKVALKDPHGVLDNWD  58

Query  307  VNSVDPCSWRMXTCSPXGYV  366
              SVDPCSW M TCS    V
Sbjct  59   STSVDPCSWAMVTCSSESLV  78



>ref|XP_009596696.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = +1

Query  166  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            VLG++ L+ F+  + A L+P GVNYEV ALM IK  L+DP+NVL NWD N+VDPCSW M 
Sbjct  4    VLGYLTLFCFLAYANAMLTPAGVNYEVQALMEIKKVLNDPHNVL-NWDENAVDPCSWNMV  62

Query  343  TCSPXGYV  366
            TCS   +V
Sbjct  63   TCSTDKFV  70



>ref|XP_002871697.1| nsp-interacting kinase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47956.1| nsp-interacting kinase 1 [Arabidopsis lyrata subsp. lyrata]
Length=638

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +1

Query  157  LYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWR  336
            L+  LGF L +   S    LSP G+N+EV ALM IK SLHDP+ VL+NWD ++VDPCSW 
Sbjct  15   LFCFLGF-LCLLSSSVDGLLSPKGINFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWT  73

Query  337  MXTCSPXGYV  366
            M TCS   +V
Sbjct  74   MVTCSSENFV  83



>gb|KDO58880.1| hypothetical protein CISIN_1g036225mg [Citrus sinensis]
Length=622

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            F  ++   LS  GVNYEV ALM +K SLHDP+ VLENWD ++VDPCSW M TCSP   V
Sbjct  17   FWTTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAVDPCSWTMVTCSPESLV  75



>ref|XP_006482337.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Citrus sinensis]
Length=622

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            F  ++   LS  GVNYEV ALM +K SLHDP+ VLENWD ++VDPCSW M TCSP   V
Sbjct  17   FWTTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAVDPCSWTMVTCSPESLV  75



>ref|XP_006430876.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
 gb|ESR44116.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
Length=622

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  190  FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            F  ++   LS  GVNYEV ALM +K SLHDP+ VLENWD ++VDPCSW M TCSP   V
Sbjct  17   FWTTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAVDPCSWTMVTCSPESLV  75



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +1

Query  175  FVLWVFI----ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
             V W+       ++ A LSP GVNYEV ALM IK SL DP++VLENWD +SVDPCSW M 
Sbjct  9    LVFWMMFFWSWAAATAVLSPKGVNYEVQALMGIKASLVDPHSVLENWDKDSVDPCSWTMI  68

Query  343  TCSPXGYV  366
            TCS    V
Sbjct  69   TCSSENLV  76



>gb|KDO70179.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=400

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +1

Query  136  MARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNS  315
            M R+  +   V  F LW     +   LSP GVNYEV ALM IK SLHDP++VL NWD NS
Sbjct  1    MRREEAVFCFVALFGLWT---CACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDENS  57

Query  316  VDPCSWRMXTCS  351
            VDPCSW + TCS
Sbjct  58   VDPCSWALVTCS  69



>emb|CBI30706.3| unnamed protein product [Vitis vinifera]
Length=604

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  199  SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            +S + LSP GVNYEV ALMA+K  ++D  NVL+ WD+NSVDPC+W M  C+P G+V
Sbjct  4    ASISLLSPKGVNYEVAALMAMKNKMNDESNVLDGWDINSVDPCTWNMVGCTPEGFV  59



>ref|XP_009619541.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Nicotiana tomentosiformis]
Length=617

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVFIE-SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F+ W+ +  +S + LSP GVNYEV ALM++K  + D Y VL+ WD+NSVDPC+W M  CS
Sbjct  12   FLFWLAVTPASMSLLSPKGVNYEVAALMSMKNKMRDEYQVLDGWDINSVDPCTWYMVGCS  71

Query  352  PXGYV  366
              G+V
Sbjct  72   SEGFV  76



>ref|XP_009619542.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Nicotiana tomentosiformis]
Length=610

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVFIE-SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F+ W+ +  +S + LSP GVNYEV ALM++K  + D Y VL+ WD+NSVDPC+W M  CS
Sbjct  12   FLFWLAVTPASMSLLSPKGVNYEVAALMSMKNKMRDEYQVLDGWDINSVDPCTWYMVGCS  71

Query  352  PXGYV  366
              G+V
Sbjct  72   SEGFV  76



>ref|XP_010274435.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X5 [Nelumbo nucifera]
Length=669

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F  +  + +S + LSP GVNYEV ALM++K+ L D  +VL+ WD+NSVDPC+W M  CSP
Sbjct  68   FARFPVVRASDSLLSPKGVNYEVAALMSVKSKLRDTLHVLDGWDINSVDPCTWNMVGCSP  127

Query  355  XGYV  366
             G+V
Sbjct  128  EGFV  131



>ref|XP_010274434.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X4 [Nelumbo nucifera]
Length=672

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F  +  + +S + LSP GVNYEV ALM++K+ L D  +VL+ WD+NSVDPC+W M  CSP
Sbjct  68   FARFPVVRASDSLLSPKGVNYEVAALMSVKSKLRDTLHVLDGWDINSVDPCTWNMVGCSP  127

Query  355  XGYV  366
             G+V
Sbjct  128  EGFV  131



>ref|XP_006574993.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Glycine 
max]
 ref|XP_006574994.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Glycine 
max]
Length=621

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F LW    S  A LSP GVNYEV ALM+IK SL DP++VL NWD ++VDPC+W M TCS 
Sbjct  15   FFLWT---SVAALLSPKGVNYEVQALMSIKNSLVDPHSVLNNWDTDAVDPCNWAMVTCSS  71

Query  355  XGYVSA  372
              +V A
Sbjct  72   DHFVIA  77



>ref|XP_010274437.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X7 [Nelumbo nucifera]
Length=627

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F  +  + +S + LSP GVNYEV ALM++K+ L D  +VL+ WD+NSVDPC+W M  CSP
Sbjct  68   FARFPVVRASDSLLSPKGVNYEVAALMSVKSKLRDTLHVLDGWDINSVDPCTWNMVGCSP  127

Query  355  XGYV  366
             G+V
Sbjct  128  EGFV  131



>ref|XP_004173630.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like, partial [Cucumis 
sativus]
Length=393

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            L  ++ S    LSP GVNYEV ALM IK SL DP+ VLENWD ++VDPCSW M TCSP  
Sbjct  17   LLFWVSSINGLLSPKGVNYEVQALMGIKASLQDPHGVLENWDGDAVDPCSWTMVTCSPES  76

Query  361  YV  366
             V
Sbjct  77   LV  78



>ref|XP_010274433.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X3 [Nelumbo nucifera]
Length=675

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F  +  + +S + LSP GVNYEV ALM++K+ L D  +VL+ WD+NSVDPC+W M  CSP
Sbjct  68   FARFPVVRASDSLLSPKGVNYEVAALMSVKSKLRDTLHVLDGWDINSVDPCTWNMVGCSP  127

Query  355  XGYV  366
             G+V
Sbjct  128  EGFV  131



>gb|KHN07744.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=621

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F LW    S  A LSP GVNYEV ALM+IK SL DP++VL NWD ++VDPC+W M TCS 
Sbjct  15   FFLWT---SVAALLSPKGVNYEVQALMSIKNSLVDPHSVLNNWDTDAVDPCNWAMVTCSS  71

Query  355  XGYVSA  372
              +V A
Sbjct  72   DHFVIA  77



>ref|XP_010274432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Nelumbo nucifera]
Length=689

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F  +  + +S + LSP GVNYEV ALM++K+ L D  +VL+ WD+NSVDPC+W M  CSP
Sbjct  68   FARFPVVRASDSLLSPKGVNYEVAALMSVKSKLRDTLHVLDGWDINSVDPCTWNMVGCSP  127

Query  355  XGYV  366
             G+V
Sbjct  128  EGFV  131



>ref|XP_011020829.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW    +++  L+  GVNYEV ALM IK SLHDP+N+L NWD ++VDPCSW M TCSP  
Sbjct  19   LWT---TAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDN  74

Query  361  YVSA  372
            +V++
Sbjct  75   FVTS  78



>ref|XP_010274431.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Nelumbo nucifera]
Length=692

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F  +  + +S + LSP GVNYEV ALM++K+ L D  +VL+ WD+NSVDPC+W M  CSP
Sbjct  68   FARFPVVRASDSLLSPKGVNYEVAALMSVKSKLRDTLHVLDGWDINSVDPCTWNMVGCSP  127

Query  355  XGYV  366
             G+V
Sbjct  128  EGFV  131



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  172  GFVLWVFI---ESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            G  L VF+    S+ A LSP GVN+EV ALM IK SL DP++VLENWD +SVDPCSW M 
Sbjct  20   GLFLLVFLWTWASAAALLSPKGVNFEVQALMYIKDSLKDPHSVLENWDRDSVDPCSWAMV  79

Query  343  TCSPXGYV  366
            TCS    V
Sbjct  80   TCSSENLV  87



>ref|XP_009803966.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = +1

Query  166  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            +LG++ L+ F+  + A L+P GVNYEV ALM IK +L DP+NVL NWD N+VDPCSW M 
Sbjct  4    ILGYLTLFSFLAYANAMLTPAGVNYEVQALMEIKKALTDPHNVL-NWDENAVDPCSWNMV  62

Query  343  TCSPXGYV  366
            TCS   +V
Sbjct  63   TCSTDKFV  70



>ref|XP_009803965.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = +1

Query  166  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            +LG++ L+ F+  + A L+P GVNYEV ALM IK +L DP+NVL NWD N+VDPCSW M 
Sbjct  4    ILGYLTLFSFLAYANAMLTPAGVNYEVQALMEIKKALTDPHNVL-NWDENAVDPCSWNMV  62

Query  343  TCSPXGYV  366
            TCS   +V
Sbjct  63   TCSTDKFV  70



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  178  VLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPX  357
            V + F  SS A LSP GVN+EV ALM IK  L DP+ +L+NWD ++VDPCSW M TCSP 
Sbjct  15   VFFWFWSSSNALLSPKGVNFEVQALMGIKAFLVDPHGILDNWDGDAVDPCSWNMVTCSPE  74

Query  358  GYV  366
              V
Sbjct  75   NLV  77



>ref|NP_001146634.1| uncharacterized LOC100280233 precursor [Zea mays]
 ref|XP_008643516.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643517.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643518.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 gb|ACL54438.1| unknown [Zea mays]
 gb|AFW73243.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 1 [Zea mays]
 gb|AFW73244.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 2 [Zea mays]
 gb|AFW73245.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 3 [Zea mays]
 gb|AFW73246.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 4 [Zea mays]
Length=626

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +1

Query  169  LGFVLWVFIESSFAT--LSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            L  VL  F     A+  LSP GVNYEV ALM IK  L DP+ VL+NWD +SVDPCSW M 
Sbjct  10   LALVLLFFCSCGPASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMV  69

Query  343  TCSPXGYVSA  372
            TCSP   V+ 
Sbjct  70   TCSPENLVTG  79



>ref|XP_002311408.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
 gb|EEE88775.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
Length=622

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW    +++  L+  GVNYEV ALM IK SLHDP+N+L NWD ++VDPCSW M TCSP  
Sbjct  19   LWT---TAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDN  74

Query  361  YVSA  372
            +V++
Sbjct  75   FVTS  78



>ref|XP_011009019.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 58/79 (73%), Gaps = 2/79 (3%)
 Frame = +1

Query  133  IMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVN  312
            ++ARK   L+  +G ++ ++  +++  L+ TGVN+EV ALM IK SLHDP++VL+ WD +
Sbjct  1    MVARKKNALFCCVGLLICLW-NTAYGELTATGVNFEVEALMGIKASLHDPHDVLK-WDEH  58

Query  313  SVDPCSWRMXTCSPXGYVS  369
            SVDPCSW M TCS  G+V+
Sbjct  59   SVDPCSWIMVTCSTDGFVT  77



>ref|XP_002314905.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
 gb|EEF01076.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
Length=627

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 58/79 (73%), Gaps = 2/79 (3%)
 Frame = +1

Query  133  IMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVN  312
            ++ARK   L+  +G ++ ++  +++  L+ TGVN+EV ALM IK SLHDP++VL+ WD +
Sbjct  1    MVARKKNALFCCVGLLICLW-NTAYGELTATGVNFEVEALMGIKASLHDPHDVLK-WDEH  58

Query  313  SVDPCSWRMXTCSPXGYVS  369
            SVDPCSW M TCS  G+V+
Sbjct  59   SVDPCSWIMVTCSTDGFVT  77



>ref|XP_011011496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW    +++  L+  GVNYEV ALM IK SLHDP+N+L NWD ++VDPCSW M TCSP  
Sbjct  19   LWT---TAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDN  74

Query  361  YVSA  372
            +V++
Sbjct  75   FVTS  78



>ref|XP_010528022.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Tarenaya hassleriana]
Length=637

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
             ++ + SS A L+  GVNYEV+ALM IK SL DP+ VL+NWD  +VDPCSW M +CSP G
Sbjct  22   FFLLLGSSSAELTDKGVNYEVLALMGIKNSLVDPHEVLKNWDETAVDPCSWNMVSCSPDG  81

Query  361  YV  366
             V
Sbjct  82   LV  83



>ref|XP_010999763.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Populus euphratica]
 ref|XP_010999764.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Populus euphratica]
 ref|XP_010999765.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Populus euphratica]
Length=616

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  154  ILYEVLGFVLWV-FIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCS  330
            IL+ +   V WV F +++ + LSP GVNYEV ALMA+K  + D   V+  WD+NSVDPC+
Sbjct  4    ILFHIFFAVFWVHFAQATGSLLSPKGVNYEVAALMAVKKEMRDESGVMNGWDLNSVDPCT  63

Query  331  WRMXTCSPXGYV  366
            W M  CS  G+V
Sbjct  64   WNMVGCSFEGFV  75



>ref|XP_006833053.1| hypothetical protein AMTR_s00170p00030060 [Amborella trichopoda]
 gb|ERM98331.1| hypothetical protein AMTR_s00170p00030060 [Amborella trichopoda]
Length=545

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  214  LSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            LSP GVNYEV ALM +K+ + D ++V E WD+NSVDPC+W M  CSP G+V A
Sbjct  29   LSPKGVNYEVAALMGVKSGMKDEFHVFEGWDINSVDPCTWAMIGCSPEGFVIA  81



>ref|XP_010514169.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Camelina sativa]
Length=646

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  LIGNQRI*REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDP  282
            LI  + + R    +K C L+ V  F    F+  S A L+  GVNYEV+AL+ IK+SL DP
Sbjct  7    LIKTKMMQRTREVKKSCALFSVTFFFFICFLSFSSAELTDKGVNYEVLALIGIKSSLIDP  66

Query  283  YNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            + VL NWD  +VDPCSW M +CSP G+V
Sbjct  67   HGVLMNWDDTAVDPCSWNMISCSPDGFV  94



>emb|CDP02372.1| unnamed protein product [Coffea canephora]
Length=624

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
             VL+    S+   LSP GVN+EV ALMAIK +L DP+ VL+NWD +SVDPCSW M TCS 
Sbjct  12   LVLFCCWSSALGLLSPKGVNFEVQALMAIKDALEDPHGVLDNWDGDSVDPCSWTMITCSA  71

Query  355  XGYV  366
               V
Sbjct  72   ESLV  75



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  214  LSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            LSP GVN+EV ALM IK SL DP+ VL+NWD +SVDPCSW M TCSP   V+ 
Sbjct  26   LSPKGVNFEVQALMGIKASLVDPHGVLDNWDGDSVDPCSWTMVTCSPQSLVTG  78



>ref|XP_004485913.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like [Cicer arietinum]
Length=644

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +1

Query  154  ILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSW  333
            + + +L  V  + +E + + LSP GVNYEV ALM++K+ ++D  +V++ WD+NSVDPC+W
Sbjct  33   VSFMLLHLVAMIVVEGTESLLSPKGVNYEVAALMSMKSKMNDGLHVMDGWDINSVDPCTW  92

Query  334  RMXTCSPXGYV  366
             M  CS  GYV
Sbjct  93   YMVACSAQGYV  103



>ref|XP_010091686.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
 gb|EXB44952.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
Length=619

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F ++     S   LSP GVNYEV ALM+IK  L DP+NVL NWD  +VDPCSW M TCSP
Sbjct  14   FNIFCLCHFSAGMLSPKGVNYEVQALMSIKYLLKDPHNVLGNWDDAAVDPCSWTMVTCSP  73

Query  355  XGYV  366
             G V
Sbjct  74   DGSV  77



>ref|XP_007153543.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
 gb|ESW25537.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
Length=621

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +1

Query  163  EVLGFVLWVFIESS--FATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWR  336
            +V  F L +F  S+     LSP GVNYEV ALM+IK SL DP++VL NWD ++VDPC+W 
Sbjct  6    DVALFCLALFFLSTSVVGLLSPKGVNYEVQALMSIKNSLMDPHSVLGNWDADAVDPCNWA  65

Query  337  MXTCSPXGYVSA  372
            M TCS   +V+A
Sbjct  66   MVTCSSDHFVTA  77



>gb|KEH25224.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=527

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  169  LGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            L FV L++F   + A LSP G+N+EV AL++IK SL DP+ + ENWD ++VDPCSW M T
Sbjct  10   LCFVTLFMFWSCANALLSPKGINFEVQALVSIKESLMDPHGIFENWDGDAVDPCSWNMVT  69

Query  346  CSPXGYV  366
            CSP   V
Sbjct  70   CSPENLV  76



>emb|CDO96836.1| unnamed protein product [Coffea canephora]
Length=617

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVF-IESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F+ W   +  S + LSP GVNYEV ALM+IK  + D  +VL+ WD+NSVDPC+W M  CS
Sbjct  11   FLFWTARVSVSTSLLSPKGVNYEVAALMSIKGKMRDDNHVLDGWDINSVDPCTWNMVGCS  70

Query  352  PXGYV  366
            P G+V
Sbjct  71   PEGFV  75



>ref|XP_008379484.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=625

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW F   +   LSP GVN+EV ALM IK SL DP+ VL+NWD +SVDPCSW M TCSP  
Sbjct  18   LWSFTCGN-GLLSPKGVNFEVQALMGIKGSLVDPHGVLDNWDDDSVDPCSWTMVTCSPES  76

Query  361  YV  366
             V
Sbjct  77   LV  78



>gb|KEH25223.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=625

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  169  LGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            L FV L++F   + A LSP G+N+EV AL++IK SL DP+ + ENWD ++VDPCSW M T
Sbjct  10   LCFVTLFMFWSCANALLSPKGINFEVQALVSIKESLMDPHGIFENWDGDAVDPCSWNMVT  69

Query  346  CSPXGYV  366
            CSP   V
Sbjct  70   CSPENLV  76



>ref|XP_006358116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like isoform X1 [Solanum tuberosum]
Length=616

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVFIE-SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F+ WV    +S   LSP GVNYEV ALM++K  + D Y+VL+ WDVNSVDPC+W M  CS
Sbjct  11   FLHWVATTPASMGFLSPKGVNYEVAALMSMKNRMRDEYHVLDGWDVNSVDPCTWYMVGCS  70

Query  352  PXGYV  366
              G+V
Sbjct  71   SEGFV  75



>ref|XP_006287253.1| hypothetical protein CARUB_v10000442mg [Capsella rubella]
 gb|EOA20151.1| hypothetical protein CARUB_v10000442mg [Capsella rubella]
Length=640

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  214  LSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            LSP GVN+EV ALM IK SLHDP+ VL+NWD ++VDPCSW M TCS   +V
Sbjct  35   LSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSENFV  85



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  214  LSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            LSP GVNYEV ALM IK  L DP+ VL+NWD +SVDPCSW M TCSP   V+ 
Sbjct  28   LSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTG  80



>ref|XP_011099082.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Sesamum 
indicum]
Length=627

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = +1

Query  127  REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWD  306
            RE+ A  W I +         F  S+   LSP GVN+EV ALM IK  L DP+ VL+NWD
Sbjct  6    REMEAALWVITF-------LCFWSSAIGLLSPKGVNFEVQALMGIKAGLRDPHGVLDNWD  58

Query  307  VNSVDPCSWRMXTCSPXGYV  366
             ++VDPCSW M TCS    V
Sbjct  59   GDAVDPCSWTMVTCSSESLV  78



>ref|XP_010274436.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X6 [Nelumbo nucifera]
Length=644

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F  +  + +S + LSP GVNYEV ALM++K+ L D  +VL+ WD+NSVDPC+W M  CSP
Sbjct  68   FARFPVVRASDSLLSPKGVNYEVAALMSVKSKLRDTLHVLDGWDINSVDPCTWNMVGCSP  127

Query  355  XGYV  366
             G+V
Sbjct  128  EGFV  131



>ref|XP_011099081.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Sesamum 
indicum]
Length=631

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = +1

Query  127  REIMARKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWD  306
            RE+ A  W I +         F  S+   LSP GVN+EV ALM IK  L DP+ VL+NWD
Sbjct  6    REMEAALWVITF-------LCFWSSAIGLLSPKGVNFEVQALMGIKAGLRDPHGVLDNWD  58

Query  307  VNSVDPCSWRMXTCSPXGYV  366
             ++VDPCSW M TCS    V
Sbjct  59   GDAVDPCSWTMVTCSSESLV  78



>ref|XP_006358118.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like isoform X3 [Solanum tuberosum]
Length=587

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVFIE-SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F+ WV    +S   LSP GVNYEV ALM++K  + D Y+VL+ WDVNSVDPC+W M  CS
Sbjct  11   FLHWVATTPASMGFLSPKGVNYEVAALMSMKNRMRDEYHVLDGWDVNSVDPCTWYMVGCS  70

Query  352  PXGYV  366
              G+V
Sbjct  71   SEGFV  75



>ref|XP_006358117.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like isoform X2 [Solanum tuberosum]
Length=609

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVFIE-SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F+ WV    +S   LSP GVNYEV ALM++K  + D Y+VL+ WDVNSVDPC+W M  CS
Sbjct  11   FLHWVATTPASMGFLSPKGVNYEVAALMSMKNRMRDEYHVLDGWDVNSVDPCTWYMVGCS  70

Query  352  PXGYV  366
              G+V
Sbjct  71   SEGFV  75



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  214  LSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            LSP GVNYEV ALM IK  L DP+ VL+NWD +SVDPCSW M TCSP   V+ 
Sbjct  28   LSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTG  80



>ref|XP_003517902.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=621

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +1

Query  142  RKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVD  321
            R+   L+ +  F LW    S  A LSP GVNYEV ALM I+ SL DP++VL NWD ++VD
Sbjct  4    RRDVALFCLALFFLWT---SVAALLSPKGVNYEVQALMGIRNSLADPHSVLNNWDPDAVD  60

Query  322  PCSWRMXTCSPXGYVSA  372
            PC+W M TCS   +V A
Sbjct  61   PCNWAMVTCSSDHFVIA  77



>ref|XP_010424117.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like, partial [Camelina 
sativa]
Length=493

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            L   + S    LSP GVN+EV ALM IK SLHDP+ VL+NWD ++VDPCSW M TCS   
Sbjct  21   LICLLSSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSEN  80

Query  361  YV  366
            +V
Sbjct  81   FV  82



>ref|XP_004953781.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Setaria 
italica]
 ref|XP_004953782.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Setaria 
italica]
 ref|XP_004953783.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X3 [Setaria 
italica]
Length=624

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  214  LSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            LSP GVNYEV ALM IK  L DP+ VL+NWD +SVDPCSW M TCSP   V+ 
Sbjct  26   LSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTG  78



>ref|XP_006643812.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Oryza brachyantha]
Length=590

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  253  MAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            MAIKT L DPYNVL+NWD+NSVDPCSWRM TCS  GYVSA
Sbjct  1    MAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYVSA  40



>gb|EMT25229.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=737

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
            F L   +   F    P      VVALMAIKT L D YNVL+NWD+NSVDPCSWRM TCS 
Sbjct  110  FCLITCLLPRFGEAEPQSSWVAVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSS  169

Query  355  XGYVSA  372
             GYVSA
Sbjct  170  DGYVSA  175



>ref|XP_006593318.1| PREDICTED: NSP-interacting kinase isoform X2 [Glycine max]
Length=510

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            A LSP GVN+EV ALM IK SL DP+ +L+NWD ++VDPCSW M TCSP   V
Sbjct  24   ALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLV  76



>ref|XP_004134925.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like [Cucumis sativus]
 ref|XP_004163360.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like [Cucumis sativus]
 gb|KGN49314.1| hypothetical protein Csa_6G519660 [Cucumis sativus]
Length=616

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  166  VLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXT  345
            +L F +WV + +S + LSP GVNYEV ALM++K+ + D   V++ WD+NSVDPC+W M  
Sbjct  9    LLLFFIWV-VSASDSHLSPKGVNYEVAALMSMKSRIKDERRVMQGWDINSVDPCTWNMVA  67

Query  346  CSPXGYV  366
            CS  G+V
Sbjct  68   CSTEGFV  74



>gb|KHN07168.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=582

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +1

Query  142  RKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVD  321
            R+   L+ +  F LW    S  A LSP GVNYEV ALM I+ SL DP++VL NWD ++VD
Sbjct  4    RRDVALFCLALFFLWT---SVAALLSPKGVNYEVQALMGIRNSLADPHSVLNNWDPDAVD  60

Query  322  PCSWRMXTCSPXGYVSA  372
            PC+W M TCS   +V A
Sbjct  61   PCNWAMVTCSSDHFVIA  77



>ref|XP_009781120.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Nicotiana sylvestris]
Length=617

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVFIE-SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F+ W+ +  +S + LSP GVNYEV ALM++K  + D + VL+ WD+NSVDPC+W M  CS
Sbjct  12   FLFWLAVTPASMSLLSPKGVNYEVAALMSMKNKMRDEHQVLDGWDINSVDPCTWYMVGCS  71

Query  352  PXGYV  366
              G+V
Sbjct  72   SEGFV  76



>ref|XP_009781121.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Nicotiana sylvestris]
Length=610

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  175  FVLWVFIE-SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            F+ W+ +  +S + LSP GVNYEV ALM++K  + D + VL+ WD+NSVDPC+W M  CS
Sbjct  12   FLFWLAVTPASMSLLSPKGVNYEVAALMSMKNKMRDEHQVLDGWDINSVDPCTWYMVGCS  71

Query  352  PXGYV  366
              G+V
Sbjct  72   SEGFV  76



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            A LSP GVN+EV ALM IK SL DP+ +L+NWD ++VDPCSW M TCSP   V
Sbjct  24   ALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLV  76



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVS  369
            A LSP GVN+EV ALM IK  L DP+NVLENWD +SVDPCSW M TCS    V+
Sbjct  24   AILSPKGVNFEVQALMGIKAFLKDPHNVLENWDKDSVDPCSWTMVTCSSQKLVT  77



>ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=621

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +1

Query  166  VLGFV-LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMX  342
            V GFV L+ F+  S A L+P GVNYEV ALM IK SLHDP  VL NWD +SVDPCSW   
Sbjct  6    VFGFVVLFSFLVYSNAMLTPGGVNYEVQALMEIKNSLHDPLGVL-NWDESSVDPCSWNTI  64

Query  343  TCSPXGYV  366
            +CS   +V
Sbjct  65   SCSSDKFV  72



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYV  366
            A LSP GVN+EV ALM IK SL DP+ +L+NWD ++VDPCSW M TCSP   V
Sbjct  24   ALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLV  76



>ref|XP_009378313.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW F   +   LSP GVN+EV ALM IK SL DP+ VL+NWD +SVDPCSW M TCSP  
Sbjct  29   LWSFTCVN-GLLSPKGVNFEVQALMGIKGSLVDPHGVLDNWDDDSVDPCSWTMVTCSPES  87

Query  361  YV  366
             V
Sbjct  88   LV  89



>ref|XP_010681338.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  199  SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCS  351
            SS + L+P GVNYEV ALM IK SL DP+ VL+NWD N+VDPCSW M +CS
Sbjct  23   SSLSLLTPDGVNYEVQALMDIKESLRDPHGVLDNWDRNAVDPCSWAMVSCS  73



>gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa]
Length=622

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 4/64 (6%)
 Frame = +1

Query  181  LWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXG  360
            LW    +++  L+  GVNYEV ALM  K SLHDP+N+L NWD ++VDPCSW M TCSP  
Sbjct  19   LWT---TAYGELTAAGVNYEVEALMGFKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDN  74

Query  361  YVSA  372
            +V++
Sbjct  75   FVTS  78



>ref|XP_010261776.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +1

Query  142  RKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVD  321
            R+  +L  VL F  W +  SS   LSP GVN+EV ALM IK SL DP   L NWD +SVD
Sbjct  5    RRNAVLCLVLLF--WFYTPSS-GLLSPKGVNFEVQALMGIKASLVDPRGALSNWDGDSVD  61

Query  322  PCSWRMXTCSPXGYV  366
            PCSW M TCSP   V
Sbjct  62   PCSWAMVTCSPESLV  76



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  142  RKWCILYEVLGFVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVD  321
            R+  +L  V    LW    S+ + LSP GVN+EV ALM+IK SL DP +VLENWD ++VD
Sbjct  5    RREAVLCFVAFLCLW---NSASSLLSPKGVNFEVQALMSIKNSLIDPRSVLENWDKDAVD  61

Query  322  PCSWRMXTCS  351
            PCSW M TCS
Sbjct  62   PCSWNMITCS  71



>gb|KEH21800.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=626

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  199  SSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
            SS A LS  GVNYEV ALM+IK SL DP+ VLENWD ++VDPCSW M TCS    V+ 
Sbjct  23   SSHALLSSKGVNYEVQALMSIKDSLVDPHGVLENWDGDAVDPCSWTMVTCSSENLVTG  80



>ref|XP_006647834.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Oryza brachyantha]
Length=626

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  208  ATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSPXGYVSA  372
              LSP GVNYEV ALM IK  L DP+ VL+NWD +SVDPCSW M TCSP   V+ 
Sbjct  26   GVLSPKGVNYEVQALMMIKDYLKDPHGVLKNWDQDSVDPCSWTMVTCSPDNLVTG  80



>ref|XP_009630581.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Nicotiana tomentosiformis]
Length=625

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +1

Query  175  FVLWVFIESSFATLSPTGVNYEVVALMAIKTSLHDPYNVLENWDVNSVDPCSWRMXTCSP  354
              LW    ++   LSP GVN+EV ALMAIK +L DP+ VL+NWD  SVDPCSW M TCS 
Sbjct  17   LALW---NTATGLLSPKGVNFEVQALMAIKAALKDPHGVLDNWDGTSVDPCSWAMVTCSA  73

Query  355  XGYV  366
              +V
Sbjct  74   ESFV  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568922768400