BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038P17

Length=662
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010112705.1|  Serine/threonine-protein phosphatase BSL1          167   3e-48   
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                    166   6e-48   
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1               166   6e-48   Gossypium arboreum [tree cotton]
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1               166   9e-48   Gossypium arboreum [tree cotton]
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg             166   1e-47   Prunus persica
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    166   1e-47   Prunus mume [ume]
emb|CDP03570.1|  unnamed protein product                                165   2e-47   Coffea canephora [robusta coffee]
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    166   2e-47   Solanum tuberosum [potatoes]
ref|NP_001266004.1|  Hop-interacting protein THI129                     166   2e-47   Solanum lycopersicum
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...    166   3e-47   
ref|XP_002520710.1|  bsu-protein phosphatase, putative                  165   4e-47   Ricinus communis
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...    166   4e-47   Pyrus x bretschneideri [bai li]
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...    164   8e-47   Nicotiana sylvestris
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...    164   8e-47   
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...    162   9e-47   Cucumis melo [Oriental melon]
ref|XP_010556800.1|  PREDICTED: serine/threonine-protein phosphat...    166   1e-46   
gb|KDP21537.1|  hypothetical protein JCGZ_22008                         163   1e-46   Jatropha curcas
gb|EYU38113.1|  hypothetical protein MIMGU_mgv1a0013161mg               164   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...    166   2e-46   Sesamum indicum [beniseed]
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...    166   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_002321044.2|  phosphatase family protein                         164   2e-46   
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...    162   2e-46   Eucalyptus grandis [rose gum]
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    161   3e-46   
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...    162   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...    161   5e-46   Nicotiana tomentosiformis
emb|CDY17964.1|  BnaC03g30360D                                          165   6e-46   Brassica napus [oilseed rape]
emb|CDX90906.1|  BnaA03g25860D                                          165   6e-46   
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...    165   7e-46   Brassica rapa
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...    161   8e-46   
gb|KDO87445.1|  hypothetical protein CISIN_1g002713mg                   160   9e-46   Citrus sinensis [apfelsine]
gb|KJB22560.1|  hypothetical protein B456_004G054500                    166   9e-46   Gossypium raimondii
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg             165   9e-46   Capsella rubella
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...    163   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...    165   1e-45   Populus euphratica
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...    165   1e-45   Populus euphratica
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg             159   1e-45   Citrus clementina [clementine]
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...    166   1e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg             159   1e-45   Citrus clementina [clementine]
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...    165   1e-45   
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...    159   1e-45   Cicer arietinum [garbanzo]
ref|XP_004496005.1|  PREDICTED: serine/threonine-protein phosphat...    159   1e-45   
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...    165   1e-45   
ref|XP_004171648.1|  PREDICTED: serine/threonine-protein phosphat...    159   1e-45   
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...    164   2e-45   Camelina sativa [gold-of-pleasure]
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1             165   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                    165   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAM83219.1|  AT4g03080/T4I9_4                                        165   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...    157   5e-45   Fragaria vesca subsp. vesca
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...    160   6e-45   Vitis vinifera
ref|XP_006575099.1|  PREDICTED: serine/threonine-protein phosphat...    157   6e-45   
gb|AES61845.2|  serine/threonine-protein phosphatase                    157   9e-45   Medicago truncatula
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...    157   9e-45   Glycine max [soybeans]
gb|KFK30905.1|  hypothetical protein AALP_AA6G041300                    164   1e-44   Arabis alpina [alpine rockcress]
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g             156   1e-44   Phaseolus vulgaris [French bean]
gb|KJB42021.1|  hypothetical protein B456_007G132700                    158   1e-44   Gossypium raimondii
gb|EYU44112.1|  hypothetical protein MIMGU_mgv1a025841mg                157   1e-44   Erythranthe guttata [common monkey flower]
emb|CDY62088.1|  BnaC02g46770D                                          166   2e-44   Brassica napus [oilseed rape]
ref|XP_003591564.1|  Serine/threonine protein phosphatase               157   2e-44   
emb|CDX97296.1|  BnaA02g20870D                                          166   2e-44   
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...    156   2e-44   Morella rubra [Chinese arbutus]
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...    166   2e-44   Brassica rapa
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg             166   2e-44   Eutrema salsugineum [saltwater cress]
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...    157   4e-44   Gossypium arboreum [tree cotton]
gb|KJB22562.1|  hypothetical protein B456_004G054500                    160   5e-44   Gossypium raimondii
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...    154   6e-44   Glycine max [soybeans]
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...    158   7e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...    158   7e-44   Nelumbo nucifera [Indian lotus]
ref|XP_008813652.1|  PREDICTED: serine/threonine-protein phosphat...    159   3e-43   
ref|XP_008813653.1|  PREDICTED: serine/threonine-protein phosphat...    159   3e-43   Phoenix dactylifera
gb|EPS69063.1|  serine/threonine-protein phosphatase                    156   4e-43   Genlisea aurea
ref|XP_008813651.1|  PREDICTED: serine/threonine-protein phosphat...    159   4e-43   
ref|XP_011011094.1|  PREDICTED: serine/threonine-protein phosphat...    156   6e-43   Populus euphratica
ref|XP_002301559.1|  phosphatase family protein                         156   7e-43   
gb|AEK86563.1|  serine/threonine-protein phosphatase                    161   8e-43   Camellia sinensis [black tea]
ref|XP_010910522.1|  PREDICTED: serine/threonine-protein phosphat...    156   9e-43   Elaeis guineensis
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...    156   9e-43   Populus euphratica
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...    156   9e-43   Populus euphratica
gb|AFW82656.1|  hypothetical protein ZEAMMB73_760112                    158   9e-42   
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...    159   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...    158   2e-40   Zea mays [maize]
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...    158   2e-40   Zea mays [maize]
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440          157   2e-40   Sorghum bicolor [broomcorn]
ref|XP_004960470.1|  PREDICTED: serine/threonine-protein phosphat...    157   2e-40   Setaria italica
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    157   3e-40   Elaeis guineensis
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...    157   4e-40   Phoenix dactylifera
gb|EEE62303.1|  hypothetical protein OsJ_17091                          156   6e-40   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054625.1|  Os05g0144400                                       156   7e-40   
emb|CAN67846.1|  hypothetical protein VITISV_016669                     141   4e-39   Vitis vinifera
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...    152   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...    148   4e-37   Brachypodium distachyon [annual false brome]
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...    148   4e-37   Brachypodium distachyon [annual false brome]
ref|XP_006846753.1|  hypothetical protein AMTR_s00276p00018700          139   6e-37   
gb|KGN47885.1|  hypothetical protein Csa_6G409910                       139   3e-35   Cucumis sativus [cucumbers]
ref|XP_006654987.1|  PREDICTED: serine/threonine-protein phosphat...    140   2e-34   
gb|EMS55151.1|  Serine/threonine-protein phosphatase BSL1-like pr...    134   2e-32   Triticum urartu
gb|KHG00523.1|  Serine/threonine-protein phosphatase BSL3 -like p...    114   2e-26   Gossypium arboreum [tree cotton]
ref|XP_009598633.1|  PREDICTED: serine/threonine-protein phosphat...    113   3e-26   Nicotiana tomentosiformis
ref|XP_009598634.1|  PREDICTED: serine/threonine-protein phosphat...    113   3e-26   Nicotiana tomentosiformis
dbj|BAK03675.1|  predicted protein                                      114   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...    117   4e-26   Elaeis guineensis
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...    117   4e-26   Elaeis guineensis
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...    117   4e-26   Phoenix dactylifera
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...    117   4e-26   Phoenix dactylifera
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...    117   4e-26   Phoenix dactylifera
ref|XP_001760494.1|  predicted protein                                  117   5e-26   
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...    116   6e-26   
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAF00990.1|  putative phosphoprotein phosphatase                    114   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KGN66599.1|  hypothetical protein Csa_1G638460                       114   2e-25   Cucumis sativus [cucumbers]
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   Zea mays [maize]
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850          114   3e-25   Sorghum bicolor [broomcorn]
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   Setaria italica
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1          114   3e-25   
ref|XP_001781021.1|  predicted protein                                  114   3e-25   
ref|XP_010419412.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   Camelina sativa [gold-of-pleasure]
gb|KDO46578.1|  hypothetical protein CISIN_1g001895mg                   114   4e-25   Citrus sinensis [apfelsine]
gb|KJB55556.1|  hypothetical protein B456_009G082300                    114   4e-25   Gossypium raimondii
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...    114   4e-25   Gossypium arboreum [tree cotton]
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg             114   4e-25   
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg             114   4e-25   Citrus clementina [clementine]
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   Prunus mume [ume]
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010101992.1|  Serine/threonine-protein phosphatase BSL2          114   4e-25   
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   Pyrus x bretschneideri [bai li]
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg             114   5e-25   
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   Prunus mume [ume]
gb|EEC75832.1|  hypothetical protein OsI_12812                          114   5e-25   Oryza sativa Indica Group [Indian rice]
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...    114   5e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg             114   5e-25   Prunus persica
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...    114   5e-25   
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   Pyrus x bretschneideri [bai li]
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   Pyrus x bretschneideri [bai li]
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg             114   5e-25   Eutrema salsugineum [saltwater cress]
gb|KJB21740.1|  hypothetical protein B456_004G011600                    114   6e-25   Gossypium raimondii
emb|CDY57791.1|  BnaCnng32470D                                          114   6e-25   Brassica napus [oilseed rape]
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...    114   6e-25   
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...    114   6e-25   Fragaria vesca subsp. vesca
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...    113   6e-25   
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...    113   6e-25   Oryza brachyantha
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...    113   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB35474.1|  hypothetical protein B456_006G116600                    113   7e-25   Gossypium raimondii
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...    113   7e-25   Nelumbo nucifera [Indian lotus]
gb|KJB35473.1|  hypothetical protein B456_006G116600                    113   8e-25   Gossypium raimondii
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...    113   8e-25   Gossypium arboreum [tree cotton]
gb|KJB35470.1|  hypothetical protein B456_006G116600                    113   8e-25   Gossypium raimondii
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...    113   8e-25   Brassica rapa
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...    113   9e-25   Vitis vinifera
emb|CDY57485.1|  BnaAnng14650D                                          113   9e-25   Brassica napus [oilseed rape]
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3             113   9e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CBI24435.3|  unnamed protein product                                113   9e-25   Vitis vinifera
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...    113   9e-25   Zea mays [maize]
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3          113   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...    113   1e-24   
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g             113   1e-24   
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...    113   1e-24   Eucalyptus grandis [rose gum]
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...    113   1e-24   Populus euphratica
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Tarenaya hassleriana [spider flower]
gb|EYU25964.1|  hypothetical protein MIMGU_mgv1a0006242mg               109   1e-24   Erythranthe guttata [common monkey flower]
gb|EYU41291.1|  hypothetical protein MIMGU_mgv1a0202661mg               109   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Tarenaya hassleriana [spider flower]
gb|KDP42962.1|  hypothetical protein JCGZ_23904                         112   1e-24   Jatropha curcas
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Nicotiana tomentosiformis
ref|XP_003561867.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Brachypodium distachyon [annual false brome]
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Nicotiana tomentosiformis
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Nicotiana sylvestris
ref|XP_001765008.1|  predicted protein                                  112   1e-24   
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Nicotiana sylvestris
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Brachypodium distachyon [annual false brome]
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   Solanum tuberosum [potatoes]
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like     112   2e-24   Solanum tuberosum [potatoes]
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Nicotiana sylvestris
emb|CDP15567.1|  unnamed protein product                                112   2e-24   Coffea canephora [robusta coffee]
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Solanum tuberosum [potatoes]
ref|XP_006340328.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Solanum tuberosum [potatoes]
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    112   2e-24   Nicotiana sylvestris
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Sesamum indicum [beniseed]
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Solanum lycopersicum
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Sesamum indicum [beniseed]
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Sesamum indicum [beniseed]
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Solanum lycopersicum
ref|NP_001067290.1|  Os12g0617900                                       112   2e-24   
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   Populus euphratica
ref|XP_002313501.2|  kelch repeat-containing family protein             112   3e-24   
dbj|BAH19666.1|  AT1G08420                                              112   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43163.1|  hypothetical protein AALP_AA1G088000                    112   3e-24   Arabis alpina [alpine rockcress]
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...    112   3e-24   Sesamum indicum [beniseed]
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2             112   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008679907.1|  PREDICTED: serine/threonine-protein phosphat...    103   3e-24   
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2          111   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   Sesamum indicum [beniseed]
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg                111   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg             111   3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   
ref|XP_009110896.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   Brassica rapa
emb|CDY31148.1|  BnaA08g26980D                                          111   3e-24   Brassica napus [oilseed rape]
emb|CDX97481.1|  BnaC08g13460D                                          111   3e-24   
ref|XP_002889692.1|  kelch repeat-containing protein                    111   3e-24   Arabidopsis lyrata subsp. lyrata
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...    111   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118376.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   Brassica rapa
emb|CDY06313.1|  BnaA09g48900D                                          111   4e-24   
emb|CDY22684.1|  BnaC08g43180D                                          111   4e-24   Brassica napus [oilseed rape]
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...    111   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002464169.1|  hypothetical protein SORBIDRAFT_01g013460          111   4e-24   Sorghum bicolor [broomcorn]
ref|XP_004982314.1|  PREDICTED: serine/threonine-protein phosphat...    111   4e-24   Setaria italica
ref|XP_010313488.1|  PREDICTED: serine/threonine-protein phosphat...    111   5e-24   Solanum lycopersicum
ref|XP_006367867.1|  PREDICTED: serine/threonine-protein phosphat...    107   5e-24   
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...    110   6e-24   Solanum lycopersicum
gb|EPS67556.1|  serine/threonine-protein phosphatase                    105   6e-24   Genlisea aurea
ref|XP_003577251.1|  PREDICTED: serine/threonine-protein phosphat...    110   7e-24   Brachypodium distachyon [annual false brome]
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g             110   7e-24   Phaseolus vulgaris [French bean]
ref|XP_001769730.1|  predicted protein                                  110   7e-24   
gb|AAD26883.1|  putative phosphoprotein phosphatase                     110   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596905.1|  Serine/threonine protein phosphatase               110   7e-24   Medicago truncatula
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg             110   7e-24   Capsella rubella
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...    110   8e-24   
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...    110   8e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...    110   8e-24   Cicer arietinum [garbanzo]
tpg|DAA50299.1|  TPA: putative kelch repeat-containing protein co...    110   8e-24   
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...    110   8e-24   Populus euphratica
ref|XP_006826448.1|  hypothetical protein AMTR_s00004p00175690          110   9e-24   
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...    110   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006594918.1|  PREDICTED: serine/threonine-protein phosphat...    110   1e-23   Glycine max [soybeans]
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...    109   1e-23   Glycine max [soybeans]
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2               109   1e-23   Glycine soja [wild soybean]
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...    109   2e-23   Glycine max [soybeans]
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...    109   2e-23   
gb|EPS70499.1|  hypothetical protein M569_04238                         109   2e-23   Genlisea aurea
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...    108   3e-23   Cucumis melo [Oriental melon]
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...    108   3e-23   Cucumis sativus [cucumbers]
ref|XP_010658896.1|  PREDICTED: serine/threonine-protein phosphat...    108   4e-23   
ref|XP_010658894.1|  PREDICTED: serine/threonine-protein phosphat...    108   4e-23   
ref|NP_001266022.1|  Hop-interacting protein THI140                     108   5e-23   Solanum lycopersicum
ref|XP_010658895.1|  PREDICTED: serine/threonine-protein phosphat...    107   5e-23   
ref|XP_002262846.2|  PREDICTED: serine/threonine-protein phosphat...    108   5e-23   Vitis vinifera
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932             108   6e-23   
emb|CBI24997.3|  unnamed protein product                                107   6e-23   Vitis vinifera
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371             107   7e-23   
ref|XP_009788953.1|  PREDICTED: serine/threonine-protein phosphat...    107   7e-23   Nicotiana sylvestris
gb|EMS59471.1|  Serine/threonine-protein phosphatase BSL2-like pr...    107   8e-23   Triticum urartu
ref|XP_004164757.1|  PREDICTED: serine/threonine-protein phosphat...    106   1e-22   
gb|EEE59591.1|  hypothetical protein OsJ_11899                          107   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...    107   1e-22   Nicotiana tomentosiformis
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g             106   1e-22   Phaseolus vulgaris [French bean]
ref|XP_010522673.1|  PREDICTED: serine/threonine-protein phosphat...    106   2e-22   Tarenaya hassleriana [spider flower]
gb|AAF22889.1|AC006932_6  T27G7.10                                      106   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EMT33719.1|  Serine/threonine-phosphatase BSL2-like protein          106   2e-22   
ref|NP_171844.6|  serine/threonine-protein phosphatase BSU1           97.4    3e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...    105   4e-22   Medicago truncatula
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...    105   4e-22   Glycine max [soybeans]
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...    105   4e-22   Glycine max [soybeans]
ref|XP_002513730.1|  bsu-protein phosphatase, putative                  105   4e-22   
ref|XP_004173418.1|  PREDICTED: serine/threonine-protein phosphat...    102   5e-22   
ref|XP_006592360.1|  PREDICTED: serine/threonine-protein phosphat...    105   6e-22   
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...    105   6e-22   Cicer arietinum [garbanzo]
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...    104   7e-22   
gb|EEE65895.1|  hypothetical protein OsJ_21718                          104   7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...    104   7e-22   Glycine max [soybeans]
ref|XP_010474966.1|  PREDICTED: serine/threonine-protein phosphat...    103   1e-21   
ref|XP_006304779.1|  hypothetical protein CARUB_v10012319mg             103   1e-21   
gb|KDO87440.1|  hypothetical protein CISIN_1g002713mg                   103   1e-21   Citrus sinensis [apfelsine]
gb|KHN03759.1|  Serine/threonine-protein phosphatase BSL1               103   1e-21   Glycine soja [wild soybean]
gb|EMT11348.1|  Serine/threonine phosphatase BSL1-like protein          102   3e-21   
ref|XP_002892160.1|  Serine/threonine-protein phosphatase BSU1        96.3    5e-21   
gb|KEH38997.1|  serine/threonine-protein phosphatase BSL2-like pr...    102   6e-21   Medicago truncatula
gb|KHN36505.1|  Serine/threonine-protein phosphatase BSL2               101   1e-20   Glycine soja [wild soybean]
ref|XP_010457353.1|  PREDICTED: serine/threonine-protein phosphat...    100   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010031570.1|  PREDICTED: serine/threonine-protein phosphat...    100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_003605992.1|  Serine/threonine protein phosphatase             99.0    7e-20   
pir||T00913  probable phosphoprotein phosphatase (EC 3.1.3.16) F2...  98.6    7e-20
gb|AAF86539.1|AC002560_32  F21B7.7                                    98.6    8e-20   
ref|XP_002974662.1|  hypothetical protein SELMODRAFT_442608           97.8    2e-19   
ref|XP_002963377.1|  hypothetical protein SELMODRAFT_438528           97.8    2e-19   
gb|KFK42699.1|  hypothetical protein AALP_AA1G028300                  97.8    2e-19   
ref|XP_001689767.1|  protein phosphatase 1 beta                       96.3    4e-19   
ref|XP_002958148.1|  hypothetical protein VOLCADRAFT_84366            96.3    5e-19   
ref|XP_005846245.1|  hypothetical protein CHLNCDRAFT_135536           92.0    1e-17   
gb|KFK42698.1|  hypothetical protein AALP_AA1G028300                  92.4    1e-17   
gb|EMT08803.1|  Serine/threonine-phosphatase BSL2-like protein        91.7    2e-17   
gb|KDD72504.1|  hypothetical protein H632_c3260p0                     85.9    3e-17   
ref|XP_002499734.1|  predicted protein                                89.0    2e-16   
ref|XP_003058098.1|  predicted protein                                88.6    2e-16   
ref|XP_009144944.1|  PREDICTED: serine/threonine-protein phosphat...  87.8    3e-16   
emb|CDY29598.1|  BnaA05g15720D                                        87.4    3e-16   
ref|XP_001785960.1|  predicted protein                                87.0    6e-16   
ref|XP_006418234.1|  hypothetical protein EUTSA_v10009980mg           85.5    2e-15   
ref|XP_005645525.1|  protein phosphatase 1 beta                       84.3    5e-15   
gb|KIY99882.1|  hypothetical protein MNEG_8078                        82.0    2e-14   
ref|XP_007510268.1|  predicted protein                                79.3    2e-13   
gb|KJB22561.1|  hypothetical protein B456_004G054500                  78.2    4e-13   
ref|XP_011402161.1|  Serine/threonine-protein phosphatase BSL3        76.6    1e-12   
ref|XP_001420111.1|  predicted protein                                75.1    5e-12   
tpg|DAA36009.1|  TPA: hypothetical protein ZEAMMB73_169463            71.2    4e-11   
gb|KHN46606.1|  Serine/threonine-protein phosphatase BSL1             70.1    2e-10   
gb|AFW68154.1|  hypothetical protein ZEAMMB73_166373                  66.2    3e-10   
ref|XP_008643918.1|  PREDICTED: uncharacterized protein LOC100381...  67.8    9e-10   
emb|CEF99328.1|  Serine/threonine-specific protein phosphatase/bi...  65.5    6e-09   
ref|XP_010098907.1|  hypothetical protein L484_006545                 60.5    8e-09   
gb|KHN47652.1|  Serine/threonine-protein phosphatase BSL1             42.7    5e-08   
ref|XP_004166312.1|  PREDICTED: serine/threonine-protein phosphat...  58.2    7e-08   
tpg|DAA48783.1|  TPA: hypothetical protein ZEAMMB73_808698            61.6    9e-08   
tpg|DAA48983.1|  TPA: hypothetical protein ZEAMMB73_811880            60.5    2e-07   
ref|XP_008664401.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    1e-06   
ref|XP_008677859.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    1e-06   
ref|XP_007015660.1|  BRI1 suppressor 1 (BSU1)-like 3 isoform 4        57.4    2e-06   
ref|XP_008787777.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    2e-06   
ref|XP_008787776.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    2e-06   
gb|EMS49544.1|  Serine/threonine-protein phosphatase BSL2-like pr...  57.4    3e-06   
ref|XP_001782643.1|  predicted protein                                57.0    3e-06   
ref|XP_004982315.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    3e-06   
tpg|DAA46907.1|  TPA: hypothetical protein ZEAMMB73_094953            55.8    7e-06   
ref|XP_764058.1|  serine/threonine protein phosphatase                54.3    3e-05   
gb|KHN03760.1|  Serine/threonine-protein phosphatase BSL1             48.9    8e-05   
gb|EJY69834.1|  Serine/threonine-protein phosphatase                  52.4    1e-04   
ref|XP_010106779.1|  hypothetical protein L484_020801                 48.9    2e-04   
emb|CDS10881.1|  hypothetical protein LRAMOSA11367                    51.6    2e-04   
ref|XP_004036424.1|  protein serine threonine phosphatase alpha, ...  51.6    2e-04   
emb|CDW79491.1|  ser thr protein phosphatase family                   51.2    3e-04   
gb|EJY66618.1|  Serine/threonine-protein phosphatase                  50.4    6e-04   
emb|CDW91130.1|  ser thr protein phosphatase family protein           50.1    7e-04   
emb|CDH57752.1|  kelch domain-containing protein                      50.1    7e-04   



>ref|XP_010112705.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
 gb|EXC34663.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
Length=883

 Score =   167 bits (423),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAA VGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAATVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 52.0 bits (123),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR LET+WDTDED
Sbjct  1    MGSKPWLYPAPTYRPLETYWDTDED  25



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score =   166 bits (421),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGASSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 51.6 bits (122),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR+LET+WD+DED
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDED  25



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score =   166 bits (421),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 51.6 bits (122),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR+LET+WD+DED
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDED  25



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score =   166 bits (420),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 51.6 bits (122),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR+LET+WD+DED
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDED  25



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score =   166 bits (420),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDVLTRKWTRMRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 51.2 bits (121),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR+LET+WDTD+D
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDD  25



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score =   166 bits (420),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDVLTRKWTRMRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 51.2 bits (121),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR+LET+WDTD+D
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDD  25



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   165 bits (418),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/112 (95%), Positives = 108/112 (96%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGGNGG  GIRLAGVTN+IHSYDVLTRKW RL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNGGAPGIRLAGVTNSIHSYDVLTRKWIRLRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 51.2 bits (121),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYRSLETFW TD+D
Sbjct  1    MGSKPWLYPAPTYRSLETFWATDDD  25



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score =   166 bits (421),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 107/112 (96%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGGNG   GIRLAGVTN IHSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNGAAPGIRLAGVTNCIHSYDVLTRKWTRLRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 50.1 bits (118),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR LETFWDTD+D
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDD  25



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score =   166 bits (421),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 107/112 (96%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGGNG   GIRLAGVTN IHSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNGAAPGIRLAGVTNCIHSYDVLTRKWTRLRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 50.1 bits (118),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR LETFWDTD+D
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDD  25



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score =   166 bits (421),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG     GIRLAGVTN++HSYDVLTRKWTR++PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASAPGIRLAGVTNSVHSYDVLTRKWTRMRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 49.7 bits (117),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR+LET+WD D+D
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDD  25



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score =   165 bits (417),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAAT THGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATNTHGPRLILFGGATAIEGGGSSSAPGIRLAGVTNSVHSYDVLTRKWTRMRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 50.4 bits (119),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR LET+WDTDED
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDED  25



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score =   166 bits (419),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYD+LTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGGPSSAPGIRLAGVTNSVHSYDILTRKWTRMRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 50.1 bits (118),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR+LETFWD D+D
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDD  25



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score =   164 bits (416),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 107/112 (96%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG+G   GIRLAGVTN +HSYDVLTRKWTR++PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGSGAAPGIRLAGVTNCVHSYDVLTRKWTRVRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 50.1 bits (118),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR LETFWDTD+D
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDD  25



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score =   164 bits (416),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYD+LTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDILTRKWTRMRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDL NDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLANDKFKWHRVVVQ  146


 Score = 50.1 bits (118),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR+LETFWD D+D
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDD  25



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score =   162 bits (411),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATK+ GPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKSFGPRLILFGGATAIEGGASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 51.6 bits (122),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            MA+KPWLYPAP+YR+LET+WDTD+D
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDD  25



>ref|XP_010556800.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X3 [Tarenaya hassleriana]
Length=756

 Score =   166 bits (420),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLT VAATKTHGPRLILFGGATAIEGGN    GIRLAGVTN++HSYDVLTRKWTRL+PAG
Sbjct  34   TLTVVAATKTHGPRLILFGGATAIEGGNSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 48.1 bits (113),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP YR+LETFWDT++D
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDD  25



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score =   163 bits (413),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAAT +HGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATNSHGPRLILFGGATAIEGGGSSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 50.4 bits (119),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR LET+WDTDED
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDED  25



>gb|EYU38113.1| hypothetical protein MIMGU_mgv1a0013161mg, partial [Erythranthe 
guttata]
Length=696

 Score =   164 bits (415),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKT GPRLILFGGATAIE G+GG  GIRLAGVTN IHSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIESGSGGAPGIRLAGVTNCIHSYDVLTRKWTRLRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVG+MVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGSMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 50.1 bits (118),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAP YR+LE+FWDTD+D
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDD  25



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score =   166 bits (421),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/112 (95%), Positives = 109/112 (97%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGGNGG  GIRLAGVTN++HSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNGGAPGIRLAGVTNSVHSYDVLTRKWTRLRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 47.4 bits (111),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL PAPTYR+LE++WDTD+D
Sbjct  1    MGSKPWLCPAPTYRTLESYWDTDDD  25



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score =   166 bits (419),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLT VAATKTHGPRLILFGGATAIEGGN    GIRLAGVTN++HSYDVLTRKWTRL+PAG
Sbjct  34   TLTVVAATKTHGPRLILFGGATAIEGGNSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 47.8 bits (112),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP YR+LETFWDT++D
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDD  25



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score =   164 bits (416),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 105/112 (94%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK+ GPRLILFGGATAIEGG     GIRLAGVTN++HSYDVLTRKWTR+QPAG
Sbjct  34   TLTAVAATKSQGPRLILFGGATAIEGGASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 48.9 bits (115),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR+LET+WD+D+D
Sbjct  1    MGSKPWLHPAPTYRTLETYWDSDDD  25



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score =   162 bits (409),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATK+HGPRLILFGGATAIEGG       IRLAGVTN++HSYD+LT+KWTR++PA
Sbjct  34   TLTAVAATKSHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDILTKKWTRMKPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            G+PPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRV+VQ
Sbjct  94   GDPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVLVQ  146


 Score = 51.2 bits (121),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR+LET+WD DED
Sbjct  1    MGSKPWLYPAPTYRNLETYWDADED  25



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score =   161 bits (407),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATK+ GPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKSFGPRLILFGGATAIEGGASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDL+VLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLFVLDLTNDKFKWHRVVVQ  146


 Score = 51.6 bits (122),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            MA+KPWLYPAP+YR+LET+WDTD+D
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDD  25



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score =   162 bits (410),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG     GIRLAGVT+++HSYDVLTRKWTR++PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGGPSAPGIRLAGVTSSVHSYDVLTRKWTRIRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTN+K KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNEKFKWHRVVVQ  145


 Score = 49.7 bits (117),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYRS+ET W+TDED
Sbjct  1    MGSKPWLYPAPTYRSVETSWETDED  25



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score =   161 bits (408),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK HGPRLILFGGATAIEGG+G   GIRLAGVTN +HSYDVLTRKWTR++PAG
Sbjct  34   TLTAVAATKIHGPRLILFGGATAIEGGSGAAPGIRLAGVTNCVHSYDVLTRKWTRVRPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            +PPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   DPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 50.4 bits (119),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR LETFWDTD+D
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDD  25



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score =   165 bits (417),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGGN    GIRLAGVTN +HSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKYKWHRVVVQ  145


 Score = 46.6 bits (109),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            MAAKPWL+PAP Y++LETFWD ++D
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDD  25



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score =   165 bits (417),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGGN    GIRLAGVTN +HSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKYKWHRVVVQ  145


 Score = 46.6 bits (109),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            MAAKPWL+PAP Y++LETFWD ++D
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDD  25



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score =   165 bits (417),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGGN    GIRLAGVTN +HSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKYKWHRVVVQ  145


 Score = 46.6 bits (109),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            MAAKPWL+PAP Y++LETFWD ++D
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDD  25



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score =   161 bits (408),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGE  508
            TLTAVAATKTHGPRLILFGGATAIEGG       + GVTN++HSYDVLTRKWTR++PAGE
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASAPG-ITGVTNSVHSYDVLTRKWTRMRPAGE  92

Query  509  PPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            PPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  93   PPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  143


 Score = 49.7 bits (117),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR+LET+WD D+D
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDD  25



>gb|KDO87445.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=769

 Score =   160 bits (404),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKT GPRLILFGGATAIEGG       IRLAGVTN++H YDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTTGPRLILFGGATAIEGGATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 51.2 bits (121),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M AKPWL+PAP+YR+LET+WDTDED
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDED  25



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score =   166 bits (421),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 44.3 bits (103),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +K  LYPAPTYR+LET+WD+DED
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDED  25



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score =   165 bits (417),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG+    GIRLAGVTN++HSYDVLTRKWTRL PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGSSSVPGIRLAGVTNSVHSYDVLTRKWTRLVPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 45.8 bits (107),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWD +ED
Sbjct  1    MGSKPWLHPAPQYKTLETFWDEEED  25



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score =   163 bits (413),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKT GPRLILFGGATAIEGGN    GIRLAGVTN++HSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTRGPRLILFGGATAIEGGNSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDL+VLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLFVLDLTNDKFKWHRVVVQ  145


 Score = 47.4 bits (111),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWDT+ED
Sbjct  1    MGSKPWLHPAPMYQALETFWDTEED  25



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score =   165 bits (418),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 105/112 (94%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKT GPRLILFGGATAIEGG     GIRLAGVTN++HSYDVLTRKWTR+QPAG
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIEGGASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 45.4 bits (106),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL PAPTYR+L T+WD+D+D
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDD  25



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score =   165 bits (418),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 105/112 (94%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKT GPRLILFGGATAIEGG     GIRLAGVTN++HSYDVLTRKWTR+QPAG
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIEGGASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  145


 Score = 45.4 bits (106),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL PAPTYR+L T+WD+D+D
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDD  25



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score =   159 bits (403),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKT GPRLILFGGATAIEGG       IRLAGVTN++H YDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTTGPRLILFGGATAIEGGATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 50.8 bits (120),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M AKPWL+PAP+YR+LET+WDTDED
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDED  25



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score =   166 bits (421),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 107/112 (96%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG+    GIRLAGVTN++HSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 44.3 bits (103),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWD ++D
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDD  25



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score =   159 bits (403),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKT GPRLILFGGATAIEGG       IRLAGVTN++H YDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTTGPRLILFGGATAIEGGATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 50.8 bits (120),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M AKPWL+PAP+YR+LET+WDTDED
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDED  25



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score =   165 bits (417),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLT+VAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTRL+PA
Sbjct  34   TLTSVAATKTHGPRLILFGGATAIEGGGSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  146


 Score = 45.4 bits (106),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWD +ED
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEED  25



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score =   159 bits (403),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK+HGPRLILFGGATAIEGG+    GIRLAGVTN++HSYD+ T+KWTR++PAG
Sbjct  34   TLTAVAATKSHGPRLILFGGATAIEGGSSSAPGIRLAGVTNSVHSYDLQTKKWTRIKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            +PPSPRAAHAAA VGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   DPPSPRAAHAAATVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  145


 Score = 50.8 bits (120),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR++E+FWDTDED
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDED  25



>ref|XP_004496005.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Cicer arietinum]
Length=885

 Score =   159 bits (403),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK+HGPRLILFGGATAIEGG+    GIRLAGVTN++HSYD+ T+KWTR++PAG
Sbjct  34   TLTAVAATKSHGPRLILFGGATAIEGGSSSAPGIRLAGVTNSVHSYDLQTKKWTRIKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            +PPSPRAAHAAA VGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   DPPSPRAAHAAATVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  145


 Score = 50.8 bits (120),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR++E+FWDTDED
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDED  25



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score =   165 bits (417),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLT+VAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTRL+PA
Sbjct  34   TLTSVAATKTHGPRLILFGGATAIEGGGSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  146


 Score = 45.4 bits (106),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWD +ED
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEED  25



>ref|XP_004171648.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like, partial 
[Cucumis sativus]
Length=173

 Score =   159 bits (402),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATK+ GPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKSFGPRLILFGGATAIEGGASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDL+VLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLFVLDLTNDKFKWHRVVVQ  146


 Score = 51.2 bits (121),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            MA+KPWLYPAP+YR+LET+WDTD+D
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDD  25



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score =   164 bits (415),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLT+VAATKTHGPRLILFGGATAIEGG+      IRLAGVTN++HSYDVLTR+WTRL+PA
Sbjct  34   TLTSVAATKTHGPRLILFGGATAIEGGSTSSVPGIRLAGVTNSVHSYDVLTRRWTRLKPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  146


 Score = 45.8 bits (107),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWD +ED
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEED  25



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score =   165 bits (418),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG+    GIRLAGVTN +HSYD+LTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGSSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 44.3 bits (103),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWD ++D
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDD  25



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score =   165 bits (418),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG+    GIRLAGVTN +HSYD+LTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGSSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 44.3 bits (103),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWD ++D
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDD  25



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score =   165 bits (418),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG+    GIRLAGVTN +HSYD+LTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGSSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 44.3 bits (103),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP Y++LETFWD ++D
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDD  25



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score =   157 bits (396),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 103/113 (91%), Gaps = 4/113 (4%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+  DK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDM--DKFKWHRVVVQ  144


 Score = 52.0 bits (123),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M++KPWLYPAPTYR+LET+WDTD+D
Sbjct  1    MSSKPWLYPAPTYRTLETYWDTDDD  25



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   160 bits (405),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTA+A TKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTRL+PA
Sbjct  35   TLTAIAPTKTHGPRLILFGGATAIEGGASSSAPGIRLAGVTNSVHSYDVLTRKWTRLRPA  94

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPS RAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  95   GEPPSVRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  147


 Score = 47.8 bits (112),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  240  AKPWLYPAPTYRSLETFWDTDED  308
            +KPWLYPAPTYR+LE++WDTD+D
Sbjct  4    SKPWLYPAPTYRTLESYWDTDDD  26



>ref|XP_006575099.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Glycine max]
Length=753

 Score =   157 bits (397),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 103/112 (92%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKT GPRLILFGGATAIEGG+    GIRLAGVTN +HSYDV +RKWT ++PAG
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIEGGSSSAPGIRLAGVTNTVHSYDVQSRKWTSIKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  145


 Score = 50.8 bits (120),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR++ETFW TDED
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDED  25



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score =   157 bits (398),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 105/112 (94%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK+HGPRLILFGGATAIEGG+    GIRLAGVTN++H+YDV ++KWTR++PAG
Sbjct  34   TLTAVAATKSHGPRLILFGGATAIEGGSTSAPGIRLAGVTNSVHAYDVDSKKWTRIKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            +PPSPRAAHAAA VGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   DPPSPRAAHAAATVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  145


 Score = 50.1 bits (118),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTY+ +E+FWDTDED
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDED  25



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score =   157 bits (396),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 103/112 (92%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKT GPRLILFGGATAIEGG+    GIRLAGVTN +HSYDV +RKWT ++PAG
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIEGGSSSAPGIRLAGVTNTVHSYDVQSRKWTSIKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  145


 Score = 50.4 bits (119),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR++ETFW TDED
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDED  25



>gb|KFK30905.1| hypothetical protein AALP_AA6G041300 [Arabis alpina]
Length=878

 Score =   164 bits (415),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLT+VAATKTHGPRLILFGGATAIEGG+    GIRLAGVTN +HSYDVLTRKWTRL+PAG
Sbjct  34   TLTSVAATKTHGPRLILFGGATAIEGGSSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKYKWHRVVVQ  145


 Score = 43.5 bits (101),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            MA KP+L+PAP Y+SLETFWD ++D
Sbjct  1    MATKPFLHPAPQYKSLETFWDEEDD  25



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score =   156 bits (394),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 102/112 (91%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKT GPRLILFGGATAIEGG+    GIRLAGVTN +HSYDV TRKW  ++PAG
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIEGGSSSAPGIRLAGVTNTVHSYDVQTRKWISIKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  145


 Score = 51.6 bits (122),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPA TYR+LETFWDTDED
Sbjct  1    MGSKPWLYPASTYRNLETFWDTDED  25



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score =   158 bits (400),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKT GPRLILFGGATAIEGG       IRLAGVTN++HSYDVLT+KWTR++PA
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIEGGASSSSPGIRLAGVTNSVHSYDVLTKKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            G+PPSPRAAHAA  VGTMVVFQGGIGPAGHSTDDLYVLDLTN K KWHRVVVQ
Sbjct  94   GDPPSPRAAHAATVVGTMVVFQGGIGPAGHSTDDLYVLDLTNYKFKWHRVVVQ  146


 Score = 48.9 bits (115),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPW  PAPTYR+LETFWDTDED
Sbjct  1    MGSKPWQSPAPTYRTLETFWDTDED  25



>gb|EYU44112.1| hypothetical protein MIMGU_mgv1a025841mg [Erythranthe guttata]
Length=207

 Score =   157 bits (398),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKT GPRLILFGGATAIE G+GG    + LAGVTN IHSYDVLTRKWTRL+PA
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIESGSGGLSPFLGLAGVTNCIHSYDVLTRKWTRLRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVG+MVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGSMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 49.3 bits (116),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAP YR+LE+FWDTD+D
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDD  25



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score =   166 bits (420),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGGN      IRLAGVTN++HSYDVLTRKWTRL+PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKYKWHRVVVQ  146


 Score = 40.8 bits (94),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M  KP+++PAP Y+++ETFWD +ED
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEED  25



>ref|XP_003591564.1| Serine/threonine protein phosphatase, partial [Medicago truncatula]
Length=203

 Score =   157 bits (396),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 103/112 (92%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpgi-RLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK+HGPRLILFGGATAIEGG+      RLAGVTN++H+YDV ++KWTR++PAG
Sbjct  34   TLTAVAATKSHGPRLILFGGATAIEGGSTSAPGIRLAGVTNSVHAYDVDSKKWTRIKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            +PPSPRAAHAAA VGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   DPPSPRAAHAAATVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  145


 Score = 49.7 bits (117),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTY+ +E+FWDTDED
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDED  25



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score =   166 bits (419),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGGN      IRLAGVTN++HSYDVLTRKWTRL+PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNSPSVPGIRLAGVTNSVHSYDVLTRKWTRLKPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKYKWHRVVVQ  146


 Score = 40.8 bits (94),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M  KP+++PAP Y+++ETFWD +ED
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEED  25



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score =   156 bits (395),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATK+HG RLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR++PA
Sbjct  34   TLTAVAATKSHGARLILFGGATAIEGGASSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            G+PPS RAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GDPPSLRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  146


 Score = 50.1 bits (118),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL PAPTYR+LET+WDTDED
Sbjct  1    MGSKPWLSPAPTYRTLETYWDTDED  25



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score =   166 bits (419),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKTHGPRLILFGGATAIEGGN      IRLAGVTN++HSYDVLTRKWTRL+PA
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGNSPSVPGIRLAGVTNSVHSYDVLTRKWTRLKPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKYKWHRVVVQ  146


 Score = 40.8 bits (94),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M  KP+++PAP Y+++ETFWD +ED
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEED  25



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score =   166 bits (419),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKTHGPRLILFGGATAIEGG+    GIRLAGVTN +HSYDVLTRKWTRL+PAG
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGSSSLPGIRLAGVTNTVHSYDVLTRKWTRLKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD+TNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKFKWHRVVVQ  145


 Score = 40.4 bits (93),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M  K WL+PAP Y++LETFWD ++D
Sbjct  1    MGTKQWLHPAPQYKTLETFWDDEDD  25



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score =   157 bits (397),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATKT GPRLILFGGATAIEGG+      IRLAGVTN++HSYDVLT+KWTR++PA
Sbjct  34   TLTAVAATKTQGPRLILFGGATAIEGGSSSSSPGIRLAGVTNSVHSYDVLTKKWTRIRPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            G+PPSPRAAHAA  VGTMVVFQGGIGPAGHSTDDLYVLDLTN K KWHRVVVQ
Sbjct  94   GDPPSPRAAHAATVVGTMVVFQGGIGPAGHSTDDLYVLDLTNYKFKWHRVVVQ  146


 Score = 48.1 bits (113),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPW  PAPTYR+LETFWDTDED
Sbjct  1    MGSKPWQPPAPTYRTLETFWDTDED  25



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score =   160 bits (406),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 105/117 (90%), Gaps = 6/117 (5%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTR----  490
            TLTAVAATKTHGPRLILFGGATAIEGG       IRLAGVTN++HSYDVLTRKWTR    
Sbjct  34   TLTAVAATKTHGPRLILFGGATAIEGGAASSAPGIRLAGVTNSVHSYDVLTRKWTRFLLI  93

Query  491  LQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            ++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   IRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  150


 Score = 44.3 bits (103),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +K  LYPAPTYR+LET+WD+DED
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDED  25



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score =   154 bits (388),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATKT GPRLILFGGATAIEGG+    GIRLAGVTN +H+YDV +RKWT ++PAG
Sbjct  34   TLTAVAATKTLGPRLILFGGATAIEGGSSSAPGIRLAGVTNTVHAYDVQSRKWTSVKPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  145


 Score = 51.2 bits (121),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWLYPAPTYR++ET WDTDED
Sbjct  1    MGSKPWLYPAPTYRTIETVWDTDED  25



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score =   158 bits (399),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATK+HG RLILFGG TAIEGG       IRLAGVTN++HSYDVLTRKWTR+QP 
Sbjct  36   TLTAVAATKSHGHRLILFGGTTAIEGGGPSSVPGIRLAGVTNSVHSYDVLTRKWTRIQPV  95

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVG+MVVFQGGIGPAGHSTDDLYVLDLTN+K KWHRVVVQ
Sbjct  96   GEPPSPRAAHAAAAVGSMVVFQGGIGPAGHSTDDLYVLDLTNEKFKWHRVVVQ  148


 Score = 47.0 bits (110),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  231  GMAAKPWLYPAPTYRSLETFWDTDED  308
            G  +KPWLYPAPTYRS+ET W+TD D
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRD  27



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score =   158 bits (399),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATK+HG RLILFGG TAIEGG       IRLAGVTN++HSYDVLTRKWTR+QP 
Sbjct  36   TLTAVAATKSHGHRLILFGGTTAIEGGGPSSVPGIRLAGVTNSVHSYDVLTRKWTRIQPV  95

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVG+MVVFQGGIGPAGHSTDDLYVLDLTN+K KWHRVVVQ
Sbjct  96   GEPPSPRAAHAAAAVGSMVVFQGGIGPAGHSTDDLYVLDLTNEKFKWHRVVVQ  148


 Score = 47.0 bits (110),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  231  GMAAKPWLYPAPTYRSLETFWDTDED  308
            G  +KPWLYPAPTYRS+ET W+TD D
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRD  27



>ref|XP_008813652.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Phoenix dactylifera]
Length=350

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp--giRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAVAATK+HGPRLILFGGATAIEGG      GIRLAGVTN+IHSYDV TRKWTRL P 
Sbjct  34   SLTAVAATKSHGPRLILFGGATAIEGGASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPV  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146



>ref|XP_008813653.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Phoenix dactylifera]
Length=349

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp--giRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAVAATK+HGPRLILFGGATAIEGG      GIRLAGVTN+IHSYDV TRKWTRL P 
Sbjct  34   SLTAVAATKSHGPRLILFGGATAIEGGASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPV  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146



>gb|EPS69063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=348

 Score =   156 bits (395),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWT-RLQPA  502
            TLTAV+ATKTHGPRLILFGGATAIEGGNG   GIRLAGVTN++HSYDVLTRKWT RLQPA
Sbjct  34   TLTAVSATKTHGPRLILFGGATAIEGGNGAAPGIRLAGVTNSVHSYDVLTRKWTSRLQPA  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLD++++K KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDMSHNKFKWHRVVVQ  146


 Score = 45.8 bits (107),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAPTYR LE+FWD ++D
Sbjct  1    MGSKPWLHPAPTYRPLESFWDAEDD  25



>ref|XP_008813651.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Phoenix dactylifera]
Length=351

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 103/113 (91%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp--giRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAVAATK+HGPRLILFGGATAIEGG      GIRLAGVTN+IHSYDV TRKWTRL P 
Sbjct  34   SLTAVAATKSHGPRLILFGGATAIEGGASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPV  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146



>ref|XP_011011094.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X3 [Populus euphratica]
Length=781

 Score =   156 bits (395),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK+HGPRLILFGG TAIEGG     GIRL G TN++HSYDVLTRKW R+Q AG
Sbjct  34   TLTAVAATKSHGPRLILFGGVTAIEGGASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLT DK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTTDKFKWHRVVVQ  145


 Score = 45.1 bits (105),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP YR+LET+W +D+D
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDD  25



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score =   156 bits (395),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 99/114 (87%), Gaps = 3/114 (3%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp---giRLAGVTNAIHSYDVLTRKWTRLQP  499
            TLTAVAATK+HGPRLILFGG TAIEGG         RL G TN++HSYDVLTRKWTR+Q 
Sbjct  34   TLTAVAATKSHGPRLILFGGVTAIEGGASSAPGISYRLDGATNSVHSYDVLTRKWTRIQA  93

Query  500  AGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            AGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDL+ DK KWHRVVVQ
Sbjct  94   AGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLSTDKFKWHRVVVQ  147


 Score = 44.7 bits (104),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP YR+LET+W +D+D
Sbjct  1    MGSKPWLHPAPAYRALETYWSSDDD  25



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score =   161 bits (407),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 100/114 (88%), Gaps = 3/114 (3%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpgi---RLAGVTNAIHSYDVLTRKWTRLQP  499
            TLTAV+ATK+ GPRLILFGGATAIEGG         RLAGVTNAIHSYDVLTRKWTRL+P
Sbjct  34   TLTAVSATKSQGPRLILFGGATAIEGGASSSSAPGIRLAGVTNAIHSYDVLTRKWTRLRP  93

Query  500  AGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            AGEPPSPRAAH A AVGTMVVFQGGIGPAGHSTDDLYVLDL +DK KWHRVVVQ
Sbjct  94   AGEPPSPRAAHTAVAVGTMVVFQGGIGPAGHSTDDLYVLDLASDKFKWHRVVVQ  147


 Score = 39.7 bits (91),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +    YPAPTYR+LET+WD+D+D
Sbjct  1    MGSNRQFYPAPTYRTLETYWDSDDD  25



>ref|XP_010910522.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Elaeis guineensis]
Length=278

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 102/113 (90%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp--giRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LT VAATK+HGPRL+LFGGATAIEGG      GIRLAGVTN++HSYDV TRKWTRL P 
Sbjct  34   SLTTVAATKSHGPRLVLFGGATAIEGGASSAVPGIRLAGVTNSVHSYDVETRKWTRLHPV  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score =   156 bits (394),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK+HGPRLILFGG TAIEGG     GIRL G TN++HSYDVLTRKW R+Q AG
Sbjct  34   TLTAVAATKSHGPRLILFGGVTAIEGGASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLT DK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTTDKFKWHRVVVQ  145


 Score = 45.1 bits (105),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP YR+LET+W +D+D
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDD  25



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score =   156 bits (394),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAVAATK+HGPRLILFGG TAIEGG     GIRL G TN++HSYDVLTRKW R+Q AG
Sbjct  34   TLTAVAATKSHGPRLILFGGVTAIEGGASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLT DK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTTDKFKWHRVVVQ  145


 Score = 45.1 bits (105),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL+PAP YR+LET+W +D+D
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDD  25



>gb|AFW82656.1| hypothetical protein ZEAMMB73_760112 [Zea mays]
Length=491

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp--giRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAVA TK HGPRLILFGGATAIE G      GIRLAGVTN++HSYDV TR+WTRL PA
Sbjct  37   SLTAVAPTKGHGPRLILFGGATAIETGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPA  96

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  97   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  149



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score =   154 bits (390),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAV A+K+ GPRLILFGGATAIEGG       IRLAGVTN++HSYDV TRKWTR+ P 
Sbjct  34   SLTAVDASKSRGPRLILFGGATAIEGGASSAVPGIRLAGVTNSVHSYDVNTRKWTRIHPV  93

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAA VGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  94   GEPPSPRAAHAAAVVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  146


 Score = 42.0 bits (97),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDED  308
            M +KPWL PAP YR L++ W+TD+D
Sbjct  1    MGSKPWLIPAPNYRRLDSSWETDDD  25



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score =   159 bits (402),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            TLTAVAATK+ GPRLILFGGATAIEGG       IRLAGVTN++HSYDVLT+KWTR++PA
Sbjct  36   TLTAVAATKSQGPRLILFGGATAIEGGASSSAPGIRLAGVTNSVHSYDVLTKKWTRIRPA  95

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            G+PPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  96   GDPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQ  148


 Score = 36.2 bits (82),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 1/25 (4%)
 Frame = +3

Query  237  AAKPWLYPAPTYRS-LETFWDTDED  308
            ++KPWL PAP+Y   L++FWD+DED
Sbjct  3    SSKPWLQPAPSYTPLLDSFWDSDED  27



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAVA TK HGPRLILFGGATAIE G       IRLAGVTN++HSYDV TR+WTRL PA
Sbjct  129  SLTAVAPTKGHGPRLILFGGATAIETGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPA  188

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  189  GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  241



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAVA TK HGPRLILFGGATAIE G       IRLAGVTN++HSYDV TR+WTRL PA
Sbjct  129  SLTAVAPTKGHGPRLILFGGATAIETGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPA  188

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  189  GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  241



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAVA TK HGPRLILFGGATAIE G       IRLAGVTN++HSYDV  RKWTRL PA
Sbjct  37   SLTAVAPTKGHGPRLILFGGATAIEAGASSGLPGIRLAGVTNSVHSYDVEKRKWTRLHPA  96

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  97   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  149



>ref|XP_004960470.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Setaria italica]
Length=887

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp--giRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LTAVA TK HGPRLILFGGATAIE G      GIRLAGVTN++HSYDV  R+WTRL PA
Sbjct  37   SLTAVAPTKGHGPRLILFGGATAIEAGASSGLPGIRLAGVTNSVHSYDVEKRRWTRLHPA  96

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAH+AAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  97   GEPPSPRAAHSAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  149



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 1/112 (1%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggp-giRLAGVTNAIHSYDVLTRKWTRLQPAG  505
            TLTAV AT +HGPRLILFGG TAIEG      GIRLAGVTN++HS+DV TRKWTR+QPAG
Sbjct  34   TLTAVPATGSHGPRLILFGGTTAIEGSXPPAPGIRLAGVTNSVHSFDVQTRKWTRIQPAG  93

Query  506  EPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            EPPSPRAAHAAAAVGTMVVFQGGIGPAGHS+DDLYVLDLTNDK KWHRVVVQ
Sbjct  94   EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSSDDLYVLDLTNDKFKWHRVVVQ  145



>ref|XP_008795124.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=867

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGE  508
            TLTAV AT +HGPRLILFGG TAIEG   GPGIRLAGVTN +HS+DV TRKWTR QPAG+
Sbjct  34   TLTAVPATGSHGPRLILFGGGTAIEGSPCGPGIRLAGVTNWVHSFDVRTRKWTRAQPAGQ  93

Query  509  PPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            PPSPRAAHAAAAVGTMVVFQGGIGPAGHS+DDLYVLDLTNDK KWHRVVVQ
Sbjct  94   PPSPRAAHAAAAVGTMVVFQGGIGPAGHSSDDLYVLDLTNDKFKWHRVVVQ  144



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LT VA TK HGPRLILFGGATAIE G       IRLAGVTN++HSYDV TR+WTRL PA
Sbjct  37   SLTVVAPTKGHGPRLILFGGATAIEAGASSGMPGIRLAGVTNSVHSYDVDTRRWTRLHPA  96

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  97   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  149



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LT VA TK HGPRLILFGGATAIE G       IRLAGVTN++HSYDV TR+WTRL PA
Sbjct  37   SLTVVAPTKGHGPRLILFGGATAIEAGASSGMPGIRLAGVTNSVHSYDVDTRRWTRLHPA  96

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  97   GEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  149



>emb|CAN67846.1| hypothetical protein VITISV_016669 [Vitis vinifera]
Length=208

 Score =   141 bits (356),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 101/141 (72%), Gaps = 30/141 (21%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg----------------------------  424
            TLTA+A TKTHGPRLILFGGATAIEGG                                 
Sbjct  35   TLTAIAPTKTHGPRLILFGGATAIEGGASSSAPGIRTPHPIRFFFFVWIRVCVVASLCVV  94

Query  425  --iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHST  598
              + LAGVTN++HSYDVLTRKWTRL+PAGEPPS RAAHAAAAV TMVVFQGGIGPAGHST
Sbjct  95   CFLGLAGVTNSVHSYDVLTRKWTRLRPAGEPPSVRAAHAAAAVXTMVVFQGGIGPAGHST  154

Query  599  DDLYVLDLTNDKLKWHRVVVQ  661
            DDLYVLDLTNDK KWHRVVVQ
Sbjct  155  DDLYVLDLTNDKYKWHRVVVQ  175


 Score = 47.8 bits (112),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  237  AAKPWLYPAPTYRSLETFWDTDED  308
             +KPWLYPAPTYR+LE++WDTD+D
Sbjct  3    GSKPWLYPAPTYRTLESYWDTDDD  26



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPA  502
            +LT +A TK HGPRLILFGGATAIE G       IRLAGVTN++HSYDV  R+WTR+ PA
Sbjct  37   SLTFIAPTKGHGPRLILFGGATAIEAGASSGLPGIRLAGVTNSVHSYDVEKRRWTRMHPA  96

Query  503  GEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            G+PPSPRAAH+AAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHRVVVQ
Sbjct  97   GDPPSPRAAHSAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQ  149



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 97/124 (78%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggngg-------------pgiRLAGVTNAIHSYDV  469
            +LT +A TK HGPRLILFGGATAIE G                   RLAGVTN++HSYDV
Sbjct  37   SLTFIAPTKGHGPRLILFGGATAIEAGASSGLPGISSVPPPSLAPPRLAGVTNSVHSYDV  96

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
              R+WTR+ PAG+PPSPRAAH+AAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHR
Sbjct  97   EKRRWTRMHPAGDPPSPRAAHSAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHR  156

Query  650  VVVQ  661
            VVVQ
Sbjct  157  VVVQ  160



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 97/124 (78%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHGPRLILFggataieggngg-------------pgiRLAGVTNAIHSYDV  469
            +LT +A TK HGPRLILFGGATAIE G                   RLAGVTN++HSYDV
Sbjct  37   SLTFIAPTKGHGPRLILFGGATAIEAGASSGLPGISSVPPPSLAPPRLAGVTNSVHSYDV  96

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
              R+WTR+ PAG+PPSPRAAH+AAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK KWHR
Sbjct  97   EKRRWTRMHPAGDPPSPRAAHSAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHR  156

Query  650  VVVQ  661
            VVVQ
Sbjct  157  VVVQ  160



>ref|XP_006846753.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
 gb|ERN08334.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
Length=218

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  362  GPRLILFggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaa  541
            GPRLILFGGATAIE  + G GIRLAGVTN++HSYDVLTRKWTRLQP+GEPPSPRAAHAAA
Sbjct  59   GPRLILFGGATAIEMSSTGAGIRLAGVTNSVHSYDVLTRKWTRLQPSGEPPSPRAAHAAA  118

Query  542  aVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            AVGTMVV QGGIGPAGHSTDD+YVLD+T+ K +WHRVVVQ
Sbjct  119  AVGTMVVIQGGIGPAGHSTDDIYVLDITSAKSRWHRVVVQ  158



>gb|KGN47885.1| hypothetical protein Csa_6G409910 [Cucumis sativus]
Length=416

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +2

Query  431  LAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLY  610
            LAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDL+
Sbjct  3    LAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLF  62

Query  611  VLDLTNDKLKWHRVVVQ  661
            VLDLTNDK KWHRVVVQ
Sbjct  63   VLDLTNDKFKWHRVVVQ  79



>ref|XP_006654987.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Oryza brachyantha]
Length=829

 Score =   140 bits (354),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  431  LAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLY  610
            LAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLY
Sbjct  11   LAGVTNSVHSYDVETRRWTRLHPAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLY  70

Query  611  VLDLTNDKLKWHRVVVQ  661
            VLDLTNDK KWHRVVVQ
Sbjct  71   VLDLTNDKFKWHRVVVQ  87



>gb|EMS55151.1| Serine/threonine-protein phosphatase BSL1-like protein [Triticum 
urartu]
Length=770

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  431  LAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLY  610
            LAGVTN +HSYDV  R+WTRL PAG+PPSPRAAH+AAAVGTMVVFQGGIGPAGHSTDDLY
Sbjct  25   LAGVTNTVHSYDVDKRRWTRLHPAGDPPSPRAAHSAAAVGTMVVFQGGIGPAGHSTDDLY  84

Query  611  VLDLTNDKLKWHRVVVQ  661
            VLDLTNDK KWHRVVVQ
Sbjct  85   VLDLTNDKFKWHRVVVQ  101



>gb|KHG00523.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=315

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  102  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  161

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  162  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQPRPRW  221

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  222  HRVVVQ  227



>ref|XP_009598633.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=305

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  87   TLTAVPAVGEEGSANYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  146

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  147  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  206

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  207  HRVVVQ  212



>ref|XP_009598634.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=289

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  87   TLTAVPAVGEEGSANYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  146

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  147  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  206

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  207  HRVVVQ  212



>dbj|BAK03675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  86   TLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  145

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  146  LSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  205

Query  650  VVVQ  661
            VVVQ
Sbjct  206  VVVQ  209



>ref|XP_010907354.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Elaeis guineensis]
Length=1028

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 88/124 (71%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  117  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPPSSAGSAGIRLAGATADVHCYDV  176

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  177  LSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  236

Query  650  VVVQ  661
            VVVQ
Sbjct  237  VVVQ  240



>ref|XP_010907353.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Elaeis guineensis]
Length=1029

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 88/124 (71%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  117  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPPSSAGSAGIRLAGATADVHCYDV  176

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  177  LSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  236

Query  650  VVVQ  661
            VVVQ
Sbjct  237  VVVQ  240



>ref|XP_008811286.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Phoenix dactylifera]
Length=994

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 88/124 (71%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  83   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPPSSAGSAGIRLAGATADVHCYDV  142

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  143  LSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  202

Query  650  VVVQ  661
            VVVQ
Sbjct  203  VVVQ  206



>ref|XP_008811284.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Phoenix dactylifera]
Length=995

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 88/124 (71%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  83   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPPSSAGSAGIRLAGATADVHCYDV  142

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  143  LSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  202

Query  650  VVVQ  661
            VVVQ
Sbjct  203  VVVQ  206



>ref|XP_008811285.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Phoenix dactylifera]
Length=995

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 88/124 (71%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  83   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPPSSAGSAGIRLAGATADVHCYDV  142

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAHAA AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  143  LSNKWTRLTPLGEPPSPRAAHAATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  202

Query  650  VVVQ  661
            VVVQ
Sbjct  203  VVVQ  206



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 89/127 (70%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpgi----------RLAGVTNAIHS  460
            TLTAVAA    G      PRLILFGGATA+EG +   G           RLAG T  +H 
Sbjct  32   TLTAVAAVGEEGTPGYVGPRLILFGGATALEGNSSAAGGPQTAAAGAGIRLAGATADVHC  91

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDV +RKW+RL P G+PPSPRAAHAA AVGTMVV QGGIGPAG STDDL+VLDLT  K +
Sbjct  92   YDVTSRKWSRLIPVGDPPSPRAAHAATAVGTMVVIQGGIGPAGLSTDDLHVLDLTQAKPR  151

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  152  WHRVVVQ  158



>ref|XP_010941606.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Elaeis guineensis]
Length=978

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  65   TLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAAPPSSAGSAGIRLAGATADVHCYDV  124

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  125  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  184

Query  650  VVVQ  661
            VVVQ
Sbjct  185  VVVQ  188



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpgi-------RLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+EG +  P         RLAG T  +H YDV
Sbjct  76   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPASPTGSAGIRLAGATADVHCYDV  135

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTR+ P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  136  LSNKWTRVTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  195

Query  650  VVVQ  661
            VVVQ
Sbjct  196  VVVQ  199



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpgi-------RLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+EG +  P         RLAG T  +H YDV
Sbjct  77   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPASPAGSAGIRLAGATADVHCYDV  136

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  137  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  196

Query  650  VVVQ  661
            VVVQ
Sbjct  197  VVVQ  200



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpgi-------RLAGVTNAIHSYDV  469
            TLTAVAA    G      PRLILFGGATA+EG +  P         RLAG T  +H YDV
Sbjct  77   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPASPAGSAGIRLAGATADVHCYDV  136

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  137  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  196

Query  650  VVVQ  661
            VVVQ
Sbjct  197  VVVQ  200



>dbj|BAF00990.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=707

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  98   TLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  157

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  158  DVLSNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  217

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  218  HRVVVQ  223



>gb|KGN66599.1| hypothetical protein Csa_1G638460 [Cucumis sativus]
Length=736

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 88/126 (70%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKT------HGPRLILFggataieggnggpgi---------RLAGVTNAIHSY  463
            TLTAV+A          GPRLILFGGATA+EG +   G          RLAG T  +H Y
Sbjct  96   TLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAAAGTPTSAGNAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KWTR+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S++DL+VLDLT  + +W
Sbjct  156  DVLTNKWTRVTPLGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSSEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng-------gpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+EG +          GIRLAG T  +H YDV
Sbjct  89   TLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSATPPSPAGSAGIRLAGATADVHCYDV  148

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  149  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  208

Query  650  VVVQ  661
            VVVQ
Sbjct  209  VVVQ  212



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  99   TLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  158

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  159  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  218

Query  650  VVVQ  661
            VVVQ
Sbjct  219  VVVQ  222



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  88   TLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  147

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  148  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  207

Query  650  VVVQ  661
            VVVQ
Sbjct  208  VVVQ  211



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  108  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  167

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  168  DVLTNKWSRISPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  227

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  228  HRVVVQ  233



>ref|XP_001781021.1| predicted protein [Physcomitrella patens]
 gb|EDQ54130.1| predicted protein [Physcomitrella patens]
Length=1047

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 84/125 (67%), Gaps = 14/125 (11%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF--------ggataieggnggpgiRLAGVTNAIHSYD  466
            TLTAVA+    G      PRLILF          A   +  + G GIRLAG T  +H YD
Sbjct  131  TLTAVASVNEEGSPGYIGPRLILFGGATALEGSSAAGPQAASSGAGIRLAGATADVHCYD  190

Query  467  VLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWH  646
            V + +WTR+ P G+PPSPRAAHAA AVGTMVV QGGIGPAG STDDL+VLDLT  K +WH
Sbjct  191  VQSNQWTRITPVGDPPSPRAAHAATAVGTMVVIQGGIGPAGLSTDDLHVLDLTQAKPRWH  250

Query  647  RVVVQ  661
            RVVVQ
Sbjct  251  RVVVQ  255



>ref|XP_010419412.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1003

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  98   TLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  157

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  158  DVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  217

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  218  HRVVVQ  223



>gb|KDO46578.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=975

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  96   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  156  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           +       G  GIRLAG T  +H Y
Sbjct  108  TLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSASAGTPSSAGSAGIRLAGATADVHCY  167

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  168  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  227

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  228  HRVVVQ  233



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           ++      G  GIRLAG T  +H Y
Sbjct  108  TLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSASSGTPSSAGSAGIRLAGATADVHCY  167

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  168  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  227

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  228  HRVVVQ  233



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  96   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  156  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  95   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  154

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  155  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  214

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  215  HRVVVQ  220



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  96   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  156  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  97   TLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  156

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  157  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  216

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  217  HRVVVQ  222



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  105  TLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  164

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  165  DVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  224

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  225  HRVVVQ  230



>ref|XP_010101992.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
 gb|EXB91212.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
Length=1084

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  110  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSAAGSAGIRLAGATADVHCY  169

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  170  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  229

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  230  HRVVVQ  235



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  97   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  156

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  157  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  216

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  217  HRVVVQ  222



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  96   TLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  156  DVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  97   TLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  156

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  157  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  216

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  217  HRVVVQ  222



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  93   TLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  152

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  153  LSNKWSRLTPQGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  212

Query  650  VVVQ  661
            VVVQ
Sbjct  213  VVVQ  216



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  93   TLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  152

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  153  LSNKWSRLTPQGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  212

Query  650  VVVQ  661
            VVVQ
Sbjct  213  VVVQ  216



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A       G  GIRLAG T  IH Y
Sbjct  109  TLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAAAGTPSSAGSAGIRLAGATADIHCY  168

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  K +W
Sbjct  169  DVLTNKWSRIAPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQKPRW  228

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  229  HRVVVQ  234



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  97   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  156

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  157  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  216

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  217  HRVVVQ  222



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  94   TLTAVPAVGEEGTSGYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  153

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  154  DVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  213

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  214  HRVVVQ  219



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  94   TLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  153

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  154  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  213

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  214  HRVVVQ  219



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  94   TLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  153

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  154  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  213

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  214  HRVVVQ  219



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  94   TLTAVAAVGEEGTPGYFGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  153

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  154  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  213

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  214  HRVVVQ  219



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  101  TLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  160

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  161  DVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  220

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  221  HRVVVQ  226



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  97   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  156

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  157  DVLTNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  216

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  217  HRVVVQ  222



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  102  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  161

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  162  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQPRPRW  221

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  222  HRVVVQ  227



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRLILFGGATA+E                GIRLAG T  +H 
Sbjct  89   TLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGGTGTPTSAGSAGGIRLAGATADVHC  148

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  149  YDVLTNKWSRLSPHGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  208

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  209  WHRVVVQ  215



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 88/126 (70%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKT------HGPRLILFggataieggnggpgi---------RLAGVTNAIHSY  463
            TLTAV+A          GPRLILFGGATA+EG +   G          RLAG T  +H Y
Sbjct  96   TLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAAAGTPTSAGNAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KWTR+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S++DL+VLDLT  + +W
Sbjct  156  DVLTNKWTRVTPLGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSSEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  88   TLTAVAAVGEEGSPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D+LT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  148  DILTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  207

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  208  HRVVVQ  213



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 88/126 (70%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKT------HGPRLILFggataieggnggpgi---------RLAGVTNAIHSY  463
            TLTAV+A          GPRLILFGGATA+EG +   G          RLAG T  +H Y
Sbjct  69   TLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAAAGTPTSAGNAGIRLAGATADVHCY  128

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KWTR+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S++DL+VLDLT  + +W
Sbjct  129  DVLTNKWTRVTPLGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSSEDLHVLDLTQQRPRW  188

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  189  HRVVVQ  194



>ref|XP_006651637.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=940

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  30   TLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  89

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  90   LSNKWSRLTPQGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  149

Query  650  VVVQ  661
            VVVQ
Sbjct  150  VVVQ  153



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng-------gpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+EG +          GIRLAG T  +H YDV
Sbjct  72   TLTAVPAVGEEGTPGFIGPRLILFGGATALEGNSAAPPSPAGSAGIRLAGATADVHCYDV  131

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ +WTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  132  LSNRWTRLMPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  191

Query  650  VVVQ  661
            VVVQ
Sbjct  192  VVVQ  195



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  104  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  163

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  164  DVLSNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  223

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  224  HRVVVQ  229



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 87/126 (69%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTA+AA    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  109  TLTAIAAVGEEGTPGYIGPRLILFGGATALEGNAAASGPPSSAGSAGIRLAGATADVHCY  168

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DV++ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  169  DVISNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  228

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  229  HRVVVQ  234



>gb|KJB35473.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1001

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  104  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  163

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  164  DVLSNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  223

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  224  HRVVVQ  229



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  104  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  163

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  164  DVLSNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  223

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  224  HRVVVQ  229



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  104  TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  163

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  164  DVLSNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  223

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  224  HRVVVQ  229



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTH------GPRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A          GPRLILFGGATA+E                GIRLAG T  +H 
Sbjct  90   TLTAVPAVGEERSANYIGPRLILFGGATALEGNSGGTGTPTSAGSAGGIRLAGATADVHC  149

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  150  YDVLTNKWSRLTPHGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  209

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  210  WHRVVVQ  216



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  95   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  154

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DV+T KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  155  DVITNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  214

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  215  HRVVVQ  220



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRLILFGGATA+E                GIRLAG T  +H 
Sbjct  90   TLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGGTGTPTSAGSAGGIRLAGATADVHC  149

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVLT KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  150  YDVLTNKWSRLTPHGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  209

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  210  WHRVVVQ  216



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  98   TLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  157

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  158  DVLSNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  217

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  218  HRVVVQ  223



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  67   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  126

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DV+T KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  127  DVITNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  186

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  187  HRVVVQ  192



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 85/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  86   TLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  145

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGP G S +DL+VLDLT  + +WHR
Sbjct  146  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPTGLSAEDLHVLDLTQQRPRWHR  205

Query  650  VVVQ  661
            VVVQ
Sbjct  206  VVVQ  209



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  98   TLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  157

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  158  DVLSNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  217

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  218  HRVVVQ  223



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 85/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  86   TLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  145

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGP G S +DL+VLDLT  + +WHR
Sbjct  146  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPTGLSAEDLHVLDLTQQRPRWHR  205

Query  650  VVVQ  661
            VVVQ
Sbjct  206  VVVQ  209



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLT VAA    G      PRLILF           +T      G  GIRLAG T  +H Y
Sbjct  101  TLTNVAAVGEEGTPGYIGPRLILFGGATALEGNSASTGTPSSAGSAGIRLAGATADVHCY  160

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KWTR+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  161  DVLTNKWTRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  220

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  221  HRVVVQ  226



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 88/126 (70%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng---------gpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+EG +            GIRLAG T  +H Y
Sbjct  89   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGAPSSAGNAGIRLAGATADVHCY  148

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  149  DVLTNKWSRITPFGEPPTPRAAHVACAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  208

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  209  HRVVVQ  214



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLT VAA    G      PRLILF           +T      G  GIRLAG T  +H Y
Sbjct  101  TLTNVAAVGEEGTPGYIGPRLILFGGATALGGNSASTGTPSSAGSAGIRLAGATADVHCY  160

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KWTR+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  161  DVLTNKWTRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  220

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  221  HRVVVQ  226



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  106  TLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGGTGTPSSAGSAGIRLAGATADVHCY  165

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  166  DVLSNKWTRLTPYGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  225

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  226  HRVVVQ  231



>gb|EYU25964.1| hypothetical protein MIMGU_mgv1a0006242mg, partial [Erythranthe 
guttata]
Length=340

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 79/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  93   TLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAASGTPTSAGSAGIRLAGATADVHCY  152

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D LT KWTR+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  153  DALTNKWTRVTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  212

Query  644  HRVVVQ  661
            HRVVV 
Sbjct  213  HRVVVH  218



>gb|EYU41291.1| hypothetical protein MIMGU_mgv1a0202661mg, partial [Erythranthe 
guttata]
Length=340

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 79/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  93   TLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAASGTPTSAGSAGIRLAGATADVHCY  152

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D LT KWTR+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  153  DALTNKWTRVTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  212

Query  644  HRVVVQ  661
            HRVVV 
Sbjct  213  HRVVVH  218



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  105  TLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGGTGTPSSAGSAGIRLAGATADVHCY  164

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  165  DVLSNKWTRLTPYGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  224

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  225  HRVVVQ  230



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 88/126 (70%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng---------gpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+EG +            GIRLAG T  +H Y
Sbjct  98   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGAPSSAGNAGIRLAGATADVHCY  157

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  158  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  217

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  218  HRVVVQ  223



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  106  TLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGGTGTPSSAGSAGIRLAGATADVHCY  165

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  166  DVLSNKWTRLTPYGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  225

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  226  HRVVVQ  231



>ref|XP_009587046.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=989

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  86   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAASGTPSAAGSAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  146  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  205

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  206  HRVVVQ  211



>ref|XP_003561867.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X2 [Brachypodium distachyon]
Length=993

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLT+V A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  85   TLTSVPAVGEEGSQSYVGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  144

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  145  LSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  204

Query  650  VVVQ  661
            VVVQ
Sbjct  205  VVVQ  208



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  86   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAASGTPSAAGSAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  146  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  205

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  206  HRVVVQ  211



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  86   TLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  146  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  205

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  206  HRVVVQ  211



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 88/126 (70%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpg---------iRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+EG +   G         IRLAG T  +H Y
Sbjct  59   TLTAVAAVGEEGSPAYIGPRLILFGGATALEGNSSQAGPQTAVAGAGIRLAGATADVHCY  118

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D  T KW+RL P G+PPSPRAAHAA AVGTMVV QGGIGPAG ST+DL+VLDLT  K +W
Sbjct  119  DAHTNKWSRLIPVGDPPSPRAAHAATAVGTMVVIQGGIGPAGLSTEDLHVLDLTQAKPRW  178

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  179  HRVVVQ  184



>ref|XP_009770254.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Nicotiana sylvestris]
Length=982

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  86   TLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  146  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  205

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  206  HRVVVQ  211



>ref|XP_010232097.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X1 [Brachypodium distachyon]
Length=1021

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLT+V A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  85   TLTSVPAVGEEGSQSYVGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  144

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  145  LSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  204

Query  650  VVVQ  661
            VVVQ
Sbjct  205  VVVQ  208



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF            +      G  GIRLAG T  +H Y
Sbjct  88   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAGSGTPSSAGSAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  148  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  207

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  208  HRVVVQ  213



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  86   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAASGTPSAAGSAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  146  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  205

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  206  HRVVVQ  211



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF            +      G  GIRLAG T  +H Y
Sbjct  88   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAGSGTPSSAGSAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  148  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  207

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  208  HRVVVQ  213



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  86   TLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  146  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  205

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  206  HRVVVQ  211



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  106  TLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  165

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  166  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  225

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  226  HRVVVQ  231



>ref|XP_006340327.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum tuberosum]
Length=996

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  88   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  148  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  207

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  208  HRVVVQ  213



>ref|XP_006340328.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=994

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  88   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  148  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  207

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  208  HRVVVQ  213



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  88   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAAPGTPSSAGSAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  148  DVLTNKWSRMTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  207

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  208  HRVVVQ  213



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  96   TLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  156  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  86   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAGSGTPSSAGSAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  146  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  205

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  206  HRVVVQ  211



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  106  TLTAVAAVGEEGTAGYIGPRLILFGGATALEGNSAASGPPSSAGSAGIRLAGATADVHCY  165

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DV + KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  166  DVNSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  225

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  226  HRVVVQ  231



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  96   TLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  156  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  96   TLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  155

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  156  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  215

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  216  HRVVVQ  221



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  86   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAGSGTPSSAGSAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  146  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  205

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  206  HRVVVQ  211



>ref|NP_001067290.1| Os12g0617900 [Oryza sativa Japonica Group]
 sp|Q2QM47.2|BSL2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL2 homolog; 
AltName: Full=BSU1-like protein 2 homolog [Oryza sativa 
Japonica Group]
 gb|ABA99873.2| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30309.1| Os12g0617900 [Oryza sativa Japonica Group]
 dbj|BAG89347.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69687.1| hypothetical protein OsI_39138 [Oryza sativa Indica Group]
Length=1009

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 85/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  98   TLTAVPAVGEEGAPGYVGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  157

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
             + KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  158  SSNKWSRLTPVGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  217

Query  650  VVVQ  661
            VVVQ
Sbjct  218  VVVQ  221



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           +T      G  GIRLAG T  +H Y
Sbjct  101  TLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSASTGTPSSAGSAGIRLAGATADVHCY  160

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  161  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  220

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  221  HRVVVQ  226



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           +T      G  GIRLAG T  +H Y
Sbjct  101  TLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSASTGTPSSAGSAGIRLAGATADVHCY  160

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  161  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  220

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  221  HRVVVQ  226



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRL+LFGGATA+E            G  GIRLAG T  +H Y
Sbjct  109  TLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  168

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  169  DVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  228

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  229  HRVVVQ  234



>gb|KFK43163.1| hypothetical protein AALP_AA1G088000 [Arabis alpina]
Length=1016

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 86/127 (68%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRL+LFGGATA+E             G  GIRLAG T  +H 
Sbjct  107  TLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSAAGSAGIRLAGATADVHC  166

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  167  YDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  226

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  227  WHRVVVQ  233



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  105  TLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  164

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  165  DVLTNKWSRVTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  224

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  225  HRVVVQ  230



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRL+LFGGATA+E            G  GIRLAG T  +H Y
Sbjct  109  TLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  168

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  169  DVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  228

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  229  HRVVVQ  234



>ref|XP_008679907.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Zea mays]
Length=109

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  482  WTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHRVVVQ  661
            + RL PAGEPPSPRAAHAA AVGTMVVFQGGIGPAGHS DDLYVLDLTNDK KWHRVVVQ
Sbjct  13   FCRLHPAGEPPSPRAAHAATAVGTMVVFQGGIGPAGHSIDDLYVLDLTNDKFKWHRVVVQ  72



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRL+LFGGATA+E            G  GIRLAG T  +H Y
Sbjct  109  TLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  168

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  169  DVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  228

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  229  HRVVVQ  234



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  105  TLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  164

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  165  DVLTNKWSRVTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  224

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  225  HRVVVQ  230



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  97   TLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSGASGTPSSAGSAGIRLAGATADVHCY  156

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A  VGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  157  DVLTNKWSRITPIGEPPTPRAAHVATTVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  216

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  217  HRVVVQ  222



>ref|XP_006417691.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
 gb|ESQ36044.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
Length=1012

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 86/127 (68%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRL+LFGGATA+E             G  GIRLAG T  +H 
Sbjct  102  TLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSAAGSAGIRLAGATADVHC  161

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  162  YDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  221

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  222  WHRVVVQ  228



>ref|XP_006664752.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=941

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng-------gpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+EG +          GIRLAG T  +H YDV
Sbjct  30   TLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSATPPSPAGSAGIRLAGATADVHCYDV  89

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
             + KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  90   SSNKWSRLTPVGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  149

Query  650  VVVQ  661
            VVVQ
Sbjct  150  VVVQ  153



>ref|XP_009110896.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Brassica 
rapa]
Length=990

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRL+LFGGATA+E                GIRLAG T  +H 
Sbjct  88   TLTAVPAVGEEGTPGYIGPRLVLFGGATALEDNSGGTGTPTSAAPSAGIRLAGATADVHC  147

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  148  YDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  207

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  208  WHRVVVQ  214



>emb|CDY31148.1| BnaA08g26980D [Brassica napus]
Length=990

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRL+LFGGATA+E                GIRLAG T  +H 
Sbjct  88   TLTAVPAVGEEGTNGYIGPRLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHC  147

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  148  YDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  207

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  208  WHRVVVQ  214



>emb|CDX97481.1| BnaC08g13460D [Brassica napus]
Length=992

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRL+LFGGATA+E                GIRLAG T  +H 
Sbjct  90   TLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHC  149

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  150  YDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  209

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  210  WHRVVVQ  216



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRL+LFGGATA+E            G  GIRLAG T  +H Y
Sbjct  108  TLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  167

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  168  DVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  227

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  228  HRVVVQ  233



>gb|ABV91338.1| kelch repeat-containing protein /serine/threonine phosphoesterase 
family protein [Arabidopsis thaliana]
Length=1018

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRL+LFGGATA+E            G  GIRLAG T  +H Y
Sbjct  109  TLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATPDVHCY  168

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  169  DVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  228

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  229  HRVVVQ  234



>ref|XP_009118376.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Brassica 
rapa]
Length=992

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRL+LFGGATA+E                GIRLAG T  +H 
Sbjct  86   TLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSATPSAGIRLAGATADVHC  145

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  146  YDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  205

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  206  WHRVVVQ  212



>emb|CDY06313.1| BnaA09g48900D [Brassica napus]
Length=992

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRL+LFGGATA+E                GIRLAG T  +H 
Sbjct  86   TLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGGTGTPTSATPSAGIRLAGATADVHC  145

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  146  YDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  205

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  206  WHRVVVQ  212



>emb|CDY22684.1| BnaC08g43180D [Brassica napus]
Length=995

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 85/127 (67%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie----------ggnggpgiRLAGVTNAIHS  460
            TLTAV A    G      PRL+LFGGATA+E                GIRLAG T  +H 
Sbjct  89   TLTAVPAVGEEGAPGYIGPRLVLFGGATALEGNSGGTGTPTSATPSAGIRLAGATADVHC  148

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +
Sbjct  149  YDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPR  208

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  209  WHRVVVQ  215



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggngg-------pgiRLAGVTNAIHSYDV  469
            TLTAV      G      PRLILFGGATA+EG +          GIRLAG T  +H YD+
Sbjct  72   TLTAVPPVGEEGTPGYIGPRLILFGGATALEGNSAAPPSPAGTAGIRLAGATADVHCYDM  131

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  132  LSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  191

Query  650  VVVQ  661
            VVVQ
Sbjct  192  VVVQ  195



>ref|XP_002464169.1| hypothetical protein SORBIDRAFT_01g013460 [Sorghum bicolor]
 gb|EER91167.1| hypothetical protein SORBIDRAFT_01g013460 [Sorghum bicolor]
Length=998

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 85/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  89   TLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  148

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
             + KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  149  SSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  208

Query  650  VVVQ  661
            VVVQ
Sbjct  209  VVVQ  212



>ref|XP_004982314.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X1 [Setaria italica]
Length=998

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 85/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  89   TLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  148

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
             + KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  149  SSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  208

Query  650  VVVQ  661
            VVVQ
Sbjct  209  VVVQ  212



>ref|XP_010313488.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum lycopersicum]
Length=995

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  89   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  148

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DV T KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  149  DVFTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  208

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  209  HRVVVQ  214



>ref|XP_006367867.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=367

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 86/127 (68%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpgi---------RLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+EG +              RLAG T  +HSY
Sbjct  75   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAAAAAPSSPGGAGIRLAGATADVHSY  134

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTND-KLK  640
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT   + +
Sbjct  135  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQHRPR  194

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  195  WHRVVVQ  201



>ref|XP_004251224.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum lycopersicum]
Length=997

 Score =   110 bits (276),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  89   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCY  148

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DV T KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  149  DVFTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  208

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  209  HRVVVQ  214



>gb|EPS67556.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=238

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 84/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHGP------RLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G       R+ILFGGATA+E            G  GIRLAG T  +H Y
Sbjct  29   TLTAVTAVGEEGSPGYIGARMILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  88

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DV T KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  89   DVSTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  148

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  149  HRVVVQ  154



>ref|XP_003577251.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Brachypodium distachyon]
Length=988

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 85/124 (69%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHGP------RLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G       RLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  80   TLTAVPAVGEEGSPGYIGQRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  139

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
            L+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  140  LSNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  199

Query  650  VVVQ  661
            VVVQ
Sbjct  200  VVVQ  203



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  86   TLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAASGTPSSAGNAGIRLAGATADVHCY  145

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT    +W
Sbjct  146  DVLTNKWSRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQWPRW  205

Query  644  HRVVVQ  661
            HRV VQ
Sbjct  206  HRVSVQ  211



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 88/126 (70%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpg---------iRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+EG +   G         IRLAG T  +H Y
Sbjct  49   TLTAVAAVGEEGKLAYVGPRLILFGGATALEGNSSQAGPQMAVAGAGIRLAGATADVHCY  108

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D+ + KW+RL P G+PPSPRAAHAA  VGTMVV QGGIGPAG ST++L+VLDLT  K +W
Sbjct  109  DIHSNKWSRLIPVGDPPSPRAAHAATTVGTMVVIQGGIGPAGLSTEELHVLDLTQAKPRW  168

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  169  HRVVVQ  174



>gb|AAD26883.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=715

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 83/126 (66%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+E           +      LAG T  +H Y
Sbjct  74   TLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGGTGTPTSSNVSYAGLAGATADVHCY  133

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  134  DVLSNKWSRLTPYGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  193

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  194  HRVVVQ  199



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  88   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGNAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT    +W
Sbjct  148  DVLTNKWSRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQWPRW  207

Query  644  HRVVVQ  661
            HRV VQ
Sbjct  208  HRVSVQ  213



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 86/126 (68%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRL+LFGGATA+E            G  GIRLAG T  +H Y
Sbjct  109  TLTAVPAVGDEGTPSYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCY  168

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL+ KW+RL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  169  DVLSNKWSRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  228

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  229  HRVVVQ  234



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 88/128 (69%), Gaps = 17/128 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng-----------gpgiRLAGVTNAIH  457
            TLTAV A    G      PRL+LFGGATA+EG +G             GIRLAG T  +H
Sbjct  106  TLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGGGGTGTPTSAGSAGIRLAGATADVH  165

Query  458  SYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKL  637
             YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + 
Sbjct  166  CYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRP  225

Query  638  KWHRVVVQ  661
            +WHRVVVQ
Sbjct  226  RWHRVVVQ  233



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 88/128 (69%), Gaps = 17/128 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng-----------gpgiRLAGVTNAIH  457
            TLTAV A    G      PRL+LFGGATA+EG +G             GIRLAG T  +H
Sbjct  111  TLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGGGGTGTPTSAGSAGIRLAGATADVH  170

Query  458  SYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKL  637
             YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + 
Sbjct  171  CYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRP  230

Query  638  KWHRVVVQ  661
            +WHRVVVQ
Sbjct  231  RWHRVVVQ  238



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpgi---------RLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+EG +   G          RLAG T  +H Y
Sbjct  94   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPTSAGNAGIRLAGATADVHCY  153

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+RL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT    +W
Sbjct  154  DVLTNKWSRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQWPRW  213

Query  644  HRVVVQ  661
            HRV VQ
Sbjct  214  HRVSVQ  219



>tpg|DAA50299.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=924

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 84/124 (68%), Gaps = 13/124 (10%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie-------ggnggpgiRLAGVTNAIHSYDV  469
            TLTAV A    G      PRLILFGGATA+E          G  GIRLAG T  +H YDV
Sbjct  92   TLTAVPAVGEEGAPGYIGPRLILFGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDV  151

Query  470  LTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKWHR  649
               KW+RL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +WHR
Sbjct  152  SLNKWSRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHR  211

Query  650  VVVQ  661
            VVVQ
Sbjct  212  VVVQ  215



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 81/126 (64%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PRLILF           +T      G  GIRLAG T  +H Y
Sbjct  101  TLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSASTGTPSSAGSAGIRLAGATADVHCY  160

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S ++L+VLDLT  + +W
Sbjct  161  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEELHVLDLTQQRPRW  220

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  221  HRVVVQ  226



>ref|XP_006826448.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
 gb|ERM93685.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
Length=1423

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 86/129 (67%), Gaps = 18/129 (14%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpg------------iRLAGVTNAI  454
            TLTAVAA    G      PRLILFGGATA+EG +                IRLAG T  +
Sbjct  91   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSSSTAPSGPPSSGGNAGIRLAGATADV  150

Query  455  HSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK  634
            H YDVL+ KW+RL P GE PSPRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  +
Sbjct  151  HCYDVLSNKWSRLTPLGEQPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQR  210

Query  635  LKWHRVVVQ  661
             +WHRVVVQ
Sbjct  211  PRWHRVVVQ  219



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 88/129 (68%), Gaps = 18/129 (14%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng------------gpgiRLAGVTNAI  454
            TLTAV A    G      PRL+LFGGATA+EG +G              GIRLAG T  +
Sbjct  111  TLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGGGGGTGTPTSAGSAGIRLAGATADV  170

Query  455  HSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDK  634
            H YDVL+ KWTRL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  +
Sbjct  171  HCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQR  230

Query  635  LKWHRVVVQ  661
             +WHRVVVQ
Sbjct  231  PRWHRVVVQ  239



>ref|XP_006594918.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=877

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  88   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGNAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT    +W
Sbjct  148  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQWPRW  207

Query  644  HRVVVQ  661
            HRV VQ
Sbjct  208  HRVSVQ  213



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  88   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGNAGIRLAGATADVHCY  147

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT    +W
Sbjct  148  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQWPRW  207

Query  644  HRVVVQ  661
            HRV VQ
Sbjct  208  HRVSVQ  213



>gb|KHN17986.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=929

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           A+      G  GIRLAG T  +H Y
Sbjct  17   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGNAGIRLAGATADVHCY  76

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT    +W
Sbjct  77   DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQWPRW  136

Query  644  HRVVVQ  661
            HRV VQ
Sbjct  137  HRVSVQ  142



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           AT      G  GIRLAG T  +H Y
Sbjct  91   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAATGTPSSAGNAGIRLAGATADVHCY  150

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT    +W
Sbjct  151  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQWPRW  210

Query  644  HRVVVQ  661
            HRV VQ
Sbjct  211  HRVSVQ  216



>ref|XP_006592783.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=998

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILF           AT      G  GIRLAG T  +H Y
Sbjct  91   TLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAATGTPSSAGNAGIRLAGATADVHCY  150

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT    +W
Sbjct  151  DVLTNKWSRITPFGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQWPRW  210

Query  644  HRVVVQ  661
            HRV VQ
Sbjct  211  HRVSVQ  216



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataie---------ggnggpgiRLAGVTNAIHSY  463
            TLTAV A    G      PR+ILFGGATA+E            G  GIRLAG T  IH Y
Sbjct  98   TLTAVPAVGEEGTPGYIGPRMILFGGATALEGNSGGTGTPTSAGSAGIRLAGATADIHCY  157

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DV+T KW+R+ P GEPP+PRAAH A +VGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  158  DVMTNKWSRMTPIGEPPTPRAAHVATSVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  217

Query  644  HRVVVQ  661
            HRVVV 
Sbjct  218  HRVVVH  223



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV +    G      PRLILF           A+      G  GIRLAG T  +H +
Sbjct  93   TLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCF  152

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL  KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  153  DVLANKWSRITPLGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  212

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  213  HRVVVQ  218



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILF---------ggataieggnggpgiRLAGVTNAIHSY  463
            TLTAV +    G      PRLILF           A+      G  GIRLAG T  +H +
Sbjct  93   TLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAASGTPSSAGSAGIRLAGATADVHCF  152

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            DVL  KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT  + +W
Sbjct  153  DVLANKWSRITPLGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRW  212

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  213  HRVVVQ  218



>ref|XP_010658896.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X4 [Vitis vinifera]
Length=869

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng---------gpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+E                IRLAG T  +H Y
Sbjct  65   TLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTSGALSSPGSSSIRLAGATADVHCY  124

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGGIGPAG S++DL+ LDLT  + +W
Sbjct  125  DISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGGIGPAGLSSEDLHALDLTQQQPRW  184

Query  644  HRVVVQ  661
            H+V VQ
Sbjct  185  HKVAVQ  190



>ref|XP_010658894.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Vitis vinifera]
Length=884

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng---------gpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+E                IRLAG T  +H Y
Sbjct  65   TLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTSGALSSPGSSSIRLAGATADVHCY  124

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGGIGPAG S++DL+ LDLT  + +W
Sbjct  125  DISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGGIGPAGLSSEDLHALDLTQQQPRW  184

Query  644  HRVVVQ  661
            H+V VQ
Sbjct  185  HKVAVQ  190



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 86/127 (68%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpgi---------RLAGVTNAIHSY  463
            TLTAV A    G      PRLILFGGATA+EG +              RLAG T  +HSY
Sbjct  74   TLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAAAAAPSSPGGAGIRLAGATADVHSY  133

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTND-KLK  640
            DVLT KW+R+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT   + +
Sbjct  134  DVLTNKWSRITPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQHRPR  193

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  194  WHRVVVQ  200



>ref|XP_010658895.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Vitis vinifera]
Length=875

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng---------gpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+E                IRLAG T  +H Y
Sbjct  65   TLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTSGALSSPGSSSIRLAGATADVHCY  124

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGGIGPAG S++DL+ LDLT  + +W
Sbjct  125  DISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGGIGPAGLSSEDLHALDLTQQQPRW  184

Query  644  HRVVVQ  661
            H+V VQ
Sbjct  185  HKVAVQ  190



>ref|XP_002262846.2| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
 ref|XP_010658893.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
Length=976

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng---------gpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+E                IRLAG T  +H Y
Sbjct  65   TLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTSGALSSPGSSSIRLAGATADVHCY  124

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGGIGPAG S++DL+ LDLT  + +W
Sbjct  125  DISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGGIGPAGLSSEDLHALDLTQQQPRW  184

Query  644  HRVVVQ  661
            H+V VQ
Sbjct  185  HKVAVQ  190



>ref|XP_002976889.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
 gb|EFJ21999.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
Length=994

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng---------gpgiRLAGVTNAIHSY  463
            TLT+VAA    G      PRLILFGGATA+EG +            GIRLAG T  +H +
Sbjct  87   TLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSAAAPTPPPAGNAGIRLAGATADVHCF  146

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D+++ KW+RL   GEPPSPRAAHAA AVG+MVV QGGIGPAG S++DL+VLDLT  + +W
Sbjct  147  DIISNKWSRLNAVGEPPSPRAAHAATAVGSMVVIQGGIGPAGVSSEDLHVLDLTQARPRW  206

Query  644  HRVVVQ  661
            HRVVVQ
Sbjct  207  HRVVVQ  212



>emb|CBI24997.3| unnamed protein product [Vitis vinifera]
Length=928

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggng---------gpgiRLAGVTNAIHSY  463
            TLTAVAA    G      PRLILFGGATA+E                IRLAG T  +H Y
Sbjct  65   TLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTSGALSSPGSSSIRLAGATADVHCY  124

Query  464  DVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLKW  643
            D+ ++KW+R+ P GEPP+PRAAH AAAVGTMVV QGGIGPAG S++DL+ LDLT  + +W
Sbjct  125  DISSKKWSRITPLGEPPTPRAAHVAAAVGTMVVIQGGIGPAGLSSEDLHALDLTQQQPRW  184

Query  644  HRVVVQ  661
            H+V VQ
Sbjct  185  HKVAVQ  190



>ref|XP_002980607.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
 gb|EFJ18258.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
Length=995

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 87/127 (69%), Gaps = 16/127 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggn----------ggpgiRLAGVTNAIHS  460
            TLT+VAA    G      PRLILFGGATA+EG +               RLAG T  +H 
Sbjct  87   TLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSAAAPTPPPAGNAGISRLAGATADVHC  146

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKLK  640
            +D+++ KW+RL   GEPPSPRAAHAA AVG+MVV QGGIGPAG S++DL+VLDLT  + +
Sbjct  147  FDIISNKWSRLNAVGEPPSPRAAHAATAVGSMVVIQGGIGPAGVSSEDLHVLDLTQARPR  206

Query  641  WHRVVVQ  661
            WHRVVVQ
Sbjct  207  WHRVVVQ  213



>ref|XP_009788953.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
 ref|XP_009788954.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=709

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 85/128 (66%), Gaps = 17/128 (13%)
 Frame = +2

Query  329  TLTAVAATKTHG------PRLILFggataieggnggpgi----------RLAGVTNAIHS  460
            TLTAV A    G      PRLILFGGATA+EG +               RLAG T  +H 
Sbjct  71   TLTAVPAVGEEGTSNYIGPRLILFGGATALEGNSAASAPAPSSPGSAGIRLAGATADVHC  130

Query  461  YDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLYVLDLT-NDKL  637
            YDVLT KW+RL P GEPP+PRAAH A AVGTMVV QGGIGPAG S +DL+VLDLT   + 
Sbjct  131  YDVLTNKWSRLTPIGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQQRP  190

Query  638  KWHRVVVQ  661
            +WHRVVVQ
Sbjct  191  RWHRVVVQ  198



>gb|EMS59471.1| Serine/threonine-protein phosphatase BSL2-like protein [Triticum 
urartu]
Length=864

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  431  LAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLY  610
            LAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMVV QGGIGPAG S +DL+
Sbjct  4    LAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMVVIQGGIGPAGLSAEDLH  63

Query  611  VLDLTNDKLKWHRVVVQ  661
            VLDLT  + +WHRVVVQ
Sbjct  64   VLDLTQQRPRWHRVVVQ  80



>ref|XP_004164757.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like, partial 
[Cucumis sativus]
Length=864

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  431  LAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMVVFQGGIGPAGHSTDDLY  610
            LAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMVV QGGIGPAG S++DL+
Sbjct  1    LAGATADVHCYDVLTNKWTRVTPLGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSSEDLH  60

Query  611  VLDLTNDKLKWHRVVVQ  661
            VLDLT  + +WHRVVVQ
Sbjct  61   VLDLTQQRPRWHRVVVQ  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320