BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038P14

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617291.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    341   3e-111   Nicotiana tomentosiformis
ref|XP_009617290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    337   1e-109   Nicotiana tomentosiformis
ref|XP_006345041.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    336   4e-109   Solanum tuberosum [potatoes]
emb|CDP18933.1|  unnamed protein product                                333   5e-108   Coffea canephora [robusta coffee]
ref|XP_004236119.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    333   7e-108   
ref|XP_010028184.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    332   9e-108   Eucalyptus grandis [rose gum]
ref|XP_011071828.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    332   2e-107   Sesamum indicum [beniseed]
gb|KJB53132.1|  hypothetical protein B456_008G294300                    326   3e-106   Gossypium raimondii
gb|AFK41217.1|  unknown                                                 328   4e-106   Lotus japonicus
gb|AFW86313.1|  restorer of fertility2                                  324   2e-105   
gb|KJB53133.1|  hypothetical protein B456_008G294300                    326   2e-105   Gossypium raimondii
gb|KHN18468.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    326   3e-105   Glycine soja [wild soybean]
gb|KJB53131.1|  hypothetical protein B456_008G294300                    326   3e-105   Gossypium raimondii
gb|AHM26656.1|  aldehyde dehydrogenase 2-1                              326   3e-105   Zea mays subsp. mays [corn]
ref|XP_007155410.1|  hypothetical protein PHAVU_003G199100g             326   4e-105   Phaseolus vulgaris [French bean]
ref|XP_007155411.1|  hypothetical protein PHAVU_003G199100g             325   4e-105   Phaseolus vulgaris [French bean]
dbj|BAB92019.1|  mitochondrial aldehyde dehydrogenase                   325   9e-105   Sorghum bicolor [broomcorn]
gb|AAK58370.1|AF269064_1  T-cytoplasm male sterility restorer fac...    325   1e-104   Zea mays [maize]
ref|NP_001105891.1|  mitochondrial aldehyde dehydrogenase 2             325   1e-104   Zea mays [maize]
gb|AAO72532.1|  aldehyde dehydrogenase 1 precursor                      324   2e-104   Lotus corniculatus
gb|KDP26565.1|  hypothetical protein JCGZ_17723                         323   4e-104   Jatropha curcas
ref|XP_007210569.1|  hypothetical protein PRUPE_ppa003869mg             323   6e-104   Prunus persica
ref|XP_010101190.1|  Aldehyde dehydrogenase family 2 member             323   6e-104   Morus notabilis
ref|XP_009363534.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    322   7e-104   Pyrus x bretschneideri [bai li]
gb|AES91175.2|  NAD-dependent aldehyde dehydrogenase family protein     322   8e-104   Medicago truncatula
ref|XP_003608978.1|  Mitochondrial aldehyde dehydrogenase               322   9e-104   
ref|XP_008374451.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    322   1e-103   Malus domestica [apple tree]
ref|XP_008239742.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    322   2e-103   Prunus mume [ume]
gb|AAZ79355.1|  aldehyde dehydrogenase                                  321   2e-103   Vitis pseudoreticulata
ref|XP_002283132.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    321   2e-103   Vitis vinifera
emb|CAN63005.1|  hypothetical protein VITISV_013710                     321   2e-103   Vitis vinifera
gb|KHG08400.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    321   3e-103   Gossypium arboreum [tree cotton]
ref|XP_008221788.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   5e-103   Prunus mume [ume]
ref|XP_010678738.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   5e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010251301.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   6e-103   Nelumbo nucifera [Indian lotus]
ref|XP_004138115.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   6e-103   Cucumis sativus [cucumbers]
ref|XP_004155012.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   7e-103   
ref|XP_004965205.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   1e-102   Setaria italica
ref|XP_010682576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   2e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010914166.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   2e-102   Elaeis guineensis
emb|CDP00179.1|  unnamed protein product                                318   2e-102   Coffea canephora [robusta coffee]
ref|XP_007036177.1|  Aldehyde dehydrogenase family 2 member B4          319   2e-102   
ref|XP_009363532.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    318   2e-102   Pyrus x bretschneideri [bai li]
ref|XP_010546022.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    318   3e-102   Tarenaya hassleriana [spider flower]
gb|AAF73828.1|AF162665_1  aldehyde dehydrogenase                        318   3e-102   Oryza sativa [red rice]
ref|XP_004297642.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    318   3e-102   Fragaria vesca subsp. vesca
ref|XP_007221800.1|  hypothetical protein PRUPE_ppa004036mg             318   3e-102   Prunus persica
ref|NP_001057358.1|  Os06g0270900                                       318   4e-102   
gb|EAZ00462.1|  hypothetical protein OsI_22484                          318   4e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_010503421.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    318   5e-102   Camelina sativa [gold-of-pleasure]
ref|XP_008389628.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   6e-102   
ref|XP_010426271.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   6e-102   Camelina sativa [gold-of-pleasure]
ref|XP_002877590.1|  ALDH2B4                                            317   7e-102   
ref|XP_010928601.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   1e-101   Elaeis guineensis
ref|XP_010913576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   1e-101   Elaeis guineensis
ref|XP_010515110.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_009391259.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793883.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   2e-101   
ref|XP_010682575.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   2e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004508853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   2e-101   Cicer arietinum [garbanzo]
ref|XP_004298932.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   2e-101   Fragaria vesca subsp. vesca
ref|XP_007153639.1|  hypothetical protein PHAVU_003G052500g             316   3e-101   Phaseolus vulgaris [French bean]
ref|XP_008367527.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   3e-101   
gb|EYU42550.1|  hypothetical protein MIMGU_mgv1a004919mg                314   4e-101   Erythranthe guttata [common monkey flower]
ref|XP_002511424.1|  aldehyde dehydrogenase, putative                   315   4e-101   
gb|AGV54428.1|  mitochondrial aldehyde dehydrogenase                    315   4e-101   Phaseolus vulgaris [French bean]
emb|CDY36910.1|  BnaA06g16950D                                          315   5e-101   Brassica napus [oilseed rape]
ref|XP_008453101.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    315   5e-101   Cucumis melo [Oriental melon]
ref|XP_009149853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    315   5e-101   Brassica rapa
emb|CDY44985.1|  BnaCnng12150D                                          315   5e-101   Brassica napus [oilseed rape]
gb|KDO69715.1|  hypothetical protein CISIN_1g012806mg                   310   6e-101   Citrus sinensis [apfelsine]
gb|KDO69714.1|  hypothetical protein CISIN_1g012806mg                   310   6e-101   Citrus sinensis [apfelsine]
ref|XP_007031424.1|  Aldehyde dehydrogenase 2B4 isoform 2               310   7e-101   
ref|XP_003527026.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    314   9e-101   
ref|XP_006404308.1|  hypothetical protein EUTSA_v10010271mg             314   1e-100   Eutrema salsugineum [saltwater cress]
ref|XP_008781996.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    314   2e-100   Phoenix dactylifera
gb|KDO69713.1|  hypothetical protein CISIN_1g012806mg                   311   2e-100   Citrus sinensis [apfelsine]
gb|KDP31120.1|  hypothetical protein JCGZ_11496                         313   2e-100   Jatropha curcas
ref|XP_009612265.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   2e-100   Nicotiana tomentosiformis
gb|EPS72983.1|  mitochondrial benzaldehyde dehydrogenase                313   2e-100   Genlisea aurea
ref|XP_011028588.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   2e-100   Populus euphratica
ref|XP_009391258.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391257.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009759823.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   4e-100   Nicotiana sylvestris
ref|XP_009391256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   5e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006290873.1|  hypothetical protein CARUB_v10016983mg             312   7e-100   Capsella rubella
ref|XP_010477684.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    312   8e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010460154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    311   9e-100   Camelina sativa [gold-of-pleasure]
ref|XP_007031423.1|  Aldehyde dehydrogenase 2B4 isoform 1               311   1e-99    
ref|XP_006844236.1|  hypothetical protein AMTR_s00006p00268060          310   2e-99    
emb|CAA71003.1|  aldehyde dehydrogenase (NAD+)                          310   3e-99    Nicotiana tabacum [American tobacco]
ref|XP_004238676.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    310   3e-99    
ref|XP_006439784.1|  hypothetical protein CICLE_v10019638mg             310   4e-99    Citrus clementina [clementine]
ref|XP_006656871.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    310   4e-99    Oryza brachyantha
gb|KHG27537.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    310   4e-99    Gossypium arboreum [tree cotton]
ref|XP_011463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    310   4e-99    Fragaria vesca subsp. vesca
gb|KJB50197.1|  hypothetical protein B456_008G158500                    310   4e-99    Gossypium raimondii
gb|ABK92547.1|  unknown                                                 306   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_003517756.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    310   5e-99    
ref|XP_011044320.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    310   6e-99    Populus euphratica
ref|XP_006355977.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    309   6e-99    Solanum tuberosum [potatoes]
gb|KCW86739.1|  hypothetical protein EUGRSUZ_B03349                     310   7e-99    Eucalyptus grandis [rose gum]
ref|XP_010044646.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    310   8e-99    Eucalyptus grandis [rose gum]
ref|XP_002301540.1|  mitochondrial aldehyde dehydrogenase family ...    309   9e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010498885.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    309   1e-98    Camelina sativa [gold-of-pleasure]
gb|ACM89738.1|  mitochondrial benzaldehyde dehydrogenase                309   1e-98    Antirrhinum majus [garden snapdragon]
ref|XP_006476755.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    309   1e-98    Citrus sinensis [apfelsine]
ref|XP_004297641.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   2e-98    Fragaria vesca subsp. vesca
gb|KHN00347.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    308   2e-98    Glycine soja [wild soybean]
gb|AFK49345.1|  unknown                                                 300   2e-98    Medicago truncatula
ref|XP_010551563.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   2e-98    Tarenaya hassleriana [spider flower]
ref|XP_010653335.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   3e-98    Vitis vinifera
ref|XP_010029207.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   3e-98    Eucalyptus grandis [rose gum]
gb|KFK34098.1|  hypothetical protein AALP_AA5G101700                    308   3e-98    Arabis alpina [alpine rockcress]
ref|XP_003519638.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   3e-98    
gb|KCW56067.1|  hypothetical protein EUGRSUZ_I01824                     306   4e-98    Eucalyptus grandis [rose gum]
ref|XP_002274863.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    307   6e-98    Vitis vinifera
gb|KDO82494.1|  hypothetical protein CISIN_1g009035mg                   302   6e-98    Citrus sinensis [apfelsine]
ref|XP_011086550.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    307   6e-98    Sesamum indicum [beniseed]
dbj|BAB62757.1|  mitochondrial aldehyde dehydrogenase ALDH2             307   7e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002318034.1|  aldehyde dehydrogenase 1 precursor family pr...    307   7e-98    Populus trichocarpa [western balsam poplar]
ref|XP_004509834.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    307   7e-98    Cicer arietinum [garbanzo]
ref|XP_004509835.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    307   8e-98    
gb|AAL77004.1|  aldehyde dehydrogenase                                  298   1e-97    Allium cepa
ref|NP_190383.1|  aldehyde dehydrogenase 2B4                            306   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399660.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    306   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010552639.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    305   2e-97    Tarenaya hassleriana [spider flower]
ref|XP_010477682.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    305   3e-97    Camelina sativa [gold-of-pleasure]
ref|XP_003552014.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    305   3e-97    
gb|KJB31274.1|  hypothetical protein B456_005G183300                    304   3e-97    Gossypium raimondii
gb|KDO82493.1|  hypothetical protein CISIN_1g009035mg                   303   4e-97    Citrus sinensis [apfelsine]
ref|XP_010682577.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    305   4e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO82492.1|  hypothetical protein CISIN_1g009035mg                   302   4e-97    Citrus sinensis [apfelsine]
gb|EYU31278.1|  hypothetical protein MIMGU_mgv1a004311mg                305   5e-97    Erythranthe guttata [common monkey flower]
dbj|BAB92017.1|  mitochondrial aldehyde dehydrogenase                   305   5e-97    Secale cereale
gb|KEH35052.1|  NAD-dependent aldehyde dehydrogenase family protein     301   5e-97    Medicago truncatula
gb|EMT04899.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    305   6e-97    
ref|XP_011003158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    304   7e-97    Populus euphratica
gb|KEH35053.1|  NAD-dependent aldehyde dehydrogenase family protein     301   8e-97    Medicago truncatula
gb|EMS51754.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    305   8e-97    Triticum urartu
gb|ABK24267.1|  unknown                                                 304   8e-97    Picea sitchensis
gb|KEH35051.1|  NAD-dependent aldehyde dehydrogenase family protein     301   1e-96    Medicago truncatula
ref|XP_003532011.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   1e-96    
gb|KJB11462.1|  hypothetical protein B456_001G261100                    298   1e-96    Gossypium raimondii
ref|NP_564204.1|  aldehyde dehydrogenase 2B7                            303   2e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAL99612.1|AF348416_1  mitochondrial aldehyde dehydrogenase          303   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438422.1|  hypothetical protein CICLE_v10031155mg             303   4e-96    Citrus clementina [clementine]
gb|KDO82485.1|  hypothetical protein CISIN_1g009035mg                   303   4e-96    Citrus sinensis [apfelsine]
gb|KEH19981.1|  NAD-dependent aldehyde dehydrogenase family protein     301   5e-96    Medicago truncatula
ref|XP_002893307.1|  hypothetical protein ARALYDRAFT_472641             302   6e-96    
ref|XP_006307216.1|  hypothetical protein CARUB_v10008816mg             302   6e-96    Capsella rubella
ref|XP_009761724.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    302   6e-96    Nicotiana sylvestris
ref|XP_007157468.1|  hypothetical protein PHAVU_002G072100g             302   7e-96    Phaseolus vulgaris [French bean]
ref|XP_010029206.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   7e-96    Eucalyptus grandis [rose gum]
gb|KEH19980.1|  NAD-dependent aldehyde dehydrogenase family protein     302   7e-96    Medicago truncatula
ref|XP_004139235.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   9e-96    
ref|XP_004156463.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   9e-96    
ref|XP_009115500.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   9e-96    Brassica rapa
gb|KFK44454.1|  hypothetical protein AALP_AA1G258900                    301   1e-95    Arabis alpina [alpine rockcress]
gb|KEH35050.1|  NAD-dependent aldehyde dehydrogenase family protein     301   1e-95    Medicago truncatula
ref|XP_008456004.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   1e-95    Cucumis melo [Oriental melon]
emb|CDY47634.1|  BnaC05g18900D                                          301   2e-95    Brassica napus [oilseed rape]
ref|XP_011044321.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   2e-95    Populus euphratica
ref|XP_009150211.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   2e-95    Brassica rapa
ref|XP_011071082.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   2e-95    
gb|KJB11461.1|  hypothetical protein B456_001G261100                    300   3e-95    Gossypium raimondii
gb|KGN60807.1|  hypothetical protein Csa_2G010420                       301   3e-95    Cucumis sativus [cucumbers]
ref|XP_010682578.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   4e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG06517.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    300   4e-95    Gossypium arboreum [tree cotton]
ref|XP_009110081.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    299   7e-95    Brassica rapa
emb|CDY57318.1|  BnaA08g20300D                                          299   1e-94    Brassica napus [oilseed rape]
ref|XP_003563967.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    299   1e-94    Brachypodium distachyon [annual false brome]
gb|EYU22484.1|  hypothetical protein MIMGU_mgv1a004342mg                298   2e-94    Erythranthe guttata [common monkey flower]
emb|CDY61548.1|  BnaA09g29890D                                          298   2e-94    Brassica napus [oilseed rape]
emb|CDX77883.1|  BnaC03g53360D                                          298   3e-94    
ref|XP_009600000.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   3e-94    
emb|CDX91724.1|  BnaC08g06430D                                          297   3e-94    
ref|XP_010271955.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    297   5e-94    Nelumbo nucifera [Indian lotus]
ref|XP_004245256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    296   8e-94    Solanum lycopersicum
ref|XP_010037573.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   3e-93    Eucalyptus grandis [rose gum]
ref|XP_006356663.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    294   6e-93    Solanum tuberosum [potatoes]
ref|XP_010316283.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    294   7e-93    Solanum lycopersicum
gb|AAC98035.1|  Strong similarity to gb|Y09876 aldehyde dehydroge...    292   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416054.1|  hypothetical protein EUTSA_v10007303mg             293   2e-92    Eutrema salsugineum [saltwater cress]
ref|XP_007044551.1|  Aldehyde dehydrogenase 2B4                         292   3e-92    
ref|XP_008793866.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    292   4e-92    Phoenix dactylifera
ref|XP_002525343.1|  aldehyde dehydrogenase, putative                   287   6e-92    
ref|XP_006594290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    291   6e-92    Glycine max [soybeans]
gb|KHN47185.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    291   6e-92    Glycine soja [wild soybean]
ref|XP_003542700.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    291   6e-92    
gb|AAZ79358.1|  aldehyde dehydrogenase                                  290   2e-91    Vitis pseudoreticulata
gb|AEV54528.1|  aldehyde dehydrogenase ALDH2B4_V3                       290   2e-91    Vitis vinifera
ref|XP_010100483.1|  Aldehyde dehydrogenase family 2 member             290   3e-91    Morus notabilis
ref|XP_010265814.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    289   5e-91    Nelumbo nucifera [Indian lotus]
gb|KHN23562.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    286   2e-90    Glycine soja [wild soybean]
ref|XP_004953799.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    288   2e-90    Setaria italica
ref|XP_010928603.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    287   3e-90    Elaeis guineensis
ref|XP_004953798.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    287   5e-90    
gb|ACU18804.1|  unknown                                                 272   1e-88    Glycine max [soybeans]
ref|XP_007151102.1|  hypothetical protein PHAVU_004G018000g             281   5e-88    Phaseolus vulgaris [French bean]
emb|CDY21806.1|  BnaA06g20750D                                          277   1e-86    Brassica napus [oilseed rape]
gb|AAW50842.1|  aldehyde dehydrogenase                                  263   4e-85    Aegiceras corniculatum
gb|KDO82484.1|  hypothetical protein CISIN_1g009035mg                   272   9e-85    Citrus sinensis [apfelsine]
gb|AAZ79356.1|  aldehyde dehydrogenase                                  270   2e-84    Vitis pseudoreticulata
gb|AEV54527.1|  aldehyde dehydrogenase ALDH2B4_V2                       270   2e-84    Vitis vinifera
gb|KJB50198.1|  hypothetical protein B456_008G158500                    269   9e-84    Gossypium raimondii
gb|AFW63787.1|  hypothetical protein ZEAMMB73_379378                    264   6e-83    
ref|XP_002321583.2|  aldehyde dehydrogenase 1 precursor family pr...    266   2e-82    
ref|XP_006647839.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    267   3e-82    
gb|AFW63788.1|  hypothetical protein ZEAMMB73_379378                    264   4e-82    
gb|ACG32898.1|  aldehyde dehydrogenase                                  266   8e-82    Zea mays [maize]
dbj|BAB92018.1|  mitochondrial aldehyde dehydrogenase                   265   1e-81    Sorghum bicolor [broomcorn]
gb|EEC73936.1|  hypothetical protein OsI_08800                          265   2e-81    Oryza sativa Indica Group [Indian rice]
gb|KHN05814.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    260   2e-81    Glycine soja [wild soybean]
ref|NP_001048010.1|  Os02g0730000                                       265   2e-81    
ref|NP_001105576.1|  aldehyde dehydrogenase2                            265   2e-81    Zea mays [maize]
gb|AAL99614.2|AF348418_1  mitochondrial aldehyde dehydrogenase RF2B     264   3e-81    Zea mays [maize]
gb|AHM26657.1|  aldehyde dehydrogenase 2-2                              264   3e-81    Zea mays subsp. mays [corn]
gb|ABD35815.1|  putative mitochondrial aldehyde dehydrogenase           251   5e-81    Populus x canadensis [Canadian poplar]
gb|EMT22926.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    261   1e-78    
ref|XP_006439785.1|  hypothetical protein CICLE_v10019638mg             255   2e-78    
ref|XP_001785650.1|  predicted protein                                  255   5e-78    
gb|AAK57987.1|  T cytoplasm male sterility restorer factor 2            229   6e-73    Zea mays [maize]
emb|CDY49384.1|  BnaA03g50730D                                          225   2e-69    Brassica napus [oilseed rape]
ref|XP_002978501.1|  hypothetical protein SELMODRAFT_233128             230   1e-68    
ref|XP_002970420.1|  hypothetical protein SELMODRAFT_231526             227   1e-67    
ref|XP_002983210.1|  hypothetical protein SELMODRAFT_234195             225   8e-67    
ref|WP_036269309.1|  betaine-aldehyde dehydrogenase                     223   4e-66    Methylocaldum szegediense
ref|XP_002961352.1|  hypothetical protein SELMODRAFT_266598             223   6e-66    
ref|XP_002983288.1|  hypothetical protein SELMODRAFT_180171             219   2e-64    
ref|XP_002961274.1|  hypothetical protein SELMODRAFT_164447             219   3e-64    
ref|WP_036502729.1|  betaine-aldehyde dehydrogenase                     214   1e-62    Nitrosococcus oceani
ref|WP_002814365.1|  betaine-aldehyde dehydrogenase                     214   2e-62    Nitrosococcus oceani
emb|CDW77748.1|  betaine-aldehyde dehydrogenase                         212   1e-61    Stylonychia lemnae
gb|ABR16485.1|  unknown                                                 211   1e-61    Picea sitchensis
ref|WP_013034365.1|  betaine-aldehyde dehydrogenase                     211   2e-61    Nitrosococcus halophilus
gb|EWM25899.1|  aldehyde dehydrogenase                                  212   5e-61    Nannochloropsis gaditana
ref|WP_013219586.1|  betaine-aldehyde dehydrogenase                     207   8e-60    Nitrosococcus watsonii
ref|WP_015249427.1|  betaine-aldehyde dehydrogenase                     206   1e-59    Singulisphaera acidiphila
ref|WP_002643666.1|  betaine-aldehyde dehydrogenase                     206   1e-59    Gimesia maris
ref|WP_021832205.1|  Aldehyde dehydrogenase                             202   3e-59    
ref|XP_003608940.1|  Aldehyde dehydrogenase                             198   8e-59    
gb|EJY82344.1|  hypothetical protein OXYTRI_20134                       203   2e-58    Oxytricha trifallax
emb|CCQ61589.1|  Aldehyde dehydrogenase                                 202   3e-58    Crocosphaera watsonii WH 0401
ref|WP_007307870.1|  betaine-aldehyde dehydrogenase                     202   3e-58    Crocosphaera watsonii
emb|CCQ69085.1|  Aldehyde dehydrogenase                                 202   3e-58    Crocosphaera watsonii WH 0402
emb|CDW85535.1|  betaine-aldehyde dehydrogenase                         197   4e-58    Stylonychia lemnae
ref|WP_007312907.1|  betaine-aldehyde dehydrogenase                     202   4e-58    Crocosphaera watsonii
ref|WP_008272605.1|  betaine-aldehyde dehydrogenase                     200   2e-57    Cyanothece sp. CCY0110
ref|XP_005642981.1|  aldehyde dehydrogenase                             200   3e-57    Coccomyxa subellipsoidea C-169
ref|XP_005642984.1|  aldehyde dehydrogenase                             201   4e-57    Coccomyxa subellipsoidea C-169
ref|XP_002948098.1|  hypothetical protein VOLCADRAFT_73567              199   2e-56    Volvox carteri f. nagariensis
ref|WP_036019563.1|  betaine-aldehyde dehydrogenase                     198   2e-56    
gb|EKU99215.1|  NAD-dependent aldehyde dehydrogenase                    198   2e-56    Leptolyngbya sp. PCC 7375
gb|EJY79302.1|  hypothetical protein OXYTRI_23427                       198   2e-56    Oxytricha trifallax
ref|WP_011612157.1|  betaine-aldehyde dehydrogenase                     198   2e-56    Trichodesmium erythraeum
ref|XP_002324977.1|  aldehyde dehydrogenase family protein              197   3e-56    
ref|WP_009547631.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       197   3e-56    Cyanothece
ref|WP_017550804.1|  betaine-aldehyde dehydrogenase                     197   3e-56    Bacillus coagulans
ref|WP_014098431.1|  betaine-aldehyde dehydrogenase                     197   4e-56    Bacillus coagulans
ref|WP_013859232.1|  betaine-aldehyde dehydrogenase                     197   4e-56    Bacillus coagulans
ref|WP_029141634.1|  betaine-aldehyde dehydrogenase                     197   4e-56    Bacillus coagulans
ref|WP_017554076.1|  betaine-aldehyde dehydrogenase                     197   4e-56    Bacillus coagulans
ref|WP_017721107.1|  betaine-aldehyde dehydrogenase                     197   5e-56    Oscillatoria sp. PCC 10802
ref|WP_009782331.1|  betaine-aldehyde dehydrogenase                     196   8e-56    Lyngbya sp. PCC 8106
ref|WP_010676364.1|  betaine-aldehyde dehydrogenase                     196   9e-56    Bacillus timonensis
ref|WP_008181335.1|  betaine-aldehyde dehydrogenase                     196   1e-55    Moorea producens
ref|WP_018662214.1|  betaine-aldehyde dehydrogenase                     196   1e-55    Bacillus acidiproducens
ref|WP_044747140.1|  betaine-aldehyde dehydrogenase                     196   1e-55    Bacillus alveayuensis
ref|WP_013324932.1|  betaine-aldehyde dehydrogenase                     195   2e-55    Cyanothece sp. PCC 7822
ref|WP_023069382.1|  aldehyde dehydrogenase family protein              195   2e-55    Lyngbya aestuarii
ref|WP_026683483.1|  betaine-aldehyde dehydrogenase                     195   2e-55    Bacillus coagulans
ref|WP_008665861.1|  aldehyde dehydrogenase                             195   2e-55    Rhodopirellula europaea
ref|WP_019721171.1|  betaine-aldehyde dehydrogenase                     195   2e-55    Bacillus coagulans
emb|CAD30313.1|  aldehyde dehydrogenase                                 195   2e-55    Geobacillus stearothermophilus
ref|WP_008654380.1|  aldehyde dehydrogenase                             195   2e-55    Rhodopirellula europaea
ref|WP_035202128.1|  betaine-aldehyde dehydrogenase                     195   3e-55    Bacillus clausii
ref|WP_007334248.1|  betaine-aldehyde dehydrogenase                     194   3e-55    Rhodopirellula baltica
ref|WP_011122652.1|  betaine-aldehyde dehydrogenase                     194   3e-55    Rhodopirellula
ref|WP_037245914.1|  betaine-aldehyde dehydrogenase                     194   4e-55    
ref|WP_043903379.1|  betaine-aldehyde dehydrogenase                     194   4e-55    
ref|WP_011244911.1|  betaine-aldehyde dehydrogenase                     194   4e-55    
ref|WP_027725052.1|  betaine-aldehyde dehydrogenase                     194   4e-55    
ref|XP_011043446.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    194   4e-55    
ref|WP_025909157.1|  betaine-aldehyde dehydrogenase                     194   5e-55    
ref|XP_006842238.1|  hypothetical protein AMTR_s00078p00188120          192   5e-55    
ref|XP_008808790.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    194   5e-55    
ref|XP_004711052.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    194   6e-55    
ref|WP_026100754.1|  betaine-aldehyde dehydrogenase                     194   6e-55    
ref|XP_010926057.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    194   1e-54    
ref|WP_019390529.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       193   1e-54    
ref|WP_008297989.1|  Phenylacetaldehyde dehydrogenase                   193   1e-54    
ref|WP_002654069.1|  betaine-aldehyde dehydrogenase                     193   1e-54    
ref|WP_041845367.1|  betaine-aldehyde dehydrogenase                     193   2e-54    
ref|XP_007524179.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    193   2e-54    
ref|WP_041847559.1|  betaine-aldehyde dehydrogenase                     193   2e-54    
ref|WP_034769244.1|  betaine-aldehyde dehydrogenase                     193   2e-54    
ref|WP_007911497.1|  betaine-aldehyde dehydrogenase                     192   2e-54    
ref|XP_004600315.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    193   2e-54    
ref|NP_001043453.1|  Os01g0591000                                       193   2e-54    
ref|XP_003940113.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    193   2e-54    
ref|XP_010967936.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    193   2e-54    
ref|XP_004747712.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    193   2e-54    
ref|XP_001690955.1|  aldehyde dehydrogenase                             193   2e-54    
ref|XP_003569290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    192   3e-54    
ref|XP_010688155.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    192   3e-54    
ref|XP_006886928.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    192   3e-54    
ref|WP_035430826.1|  betaine-aldehyde dehydrogenase                     192   4e-54    
ref|NP_001266946.1|  aldehyde dehydrogenase X, mitochondrial            192   4e-54    
ref|XP_004969048.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    192   4e-54    
ref|XP_004581021.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    192   4e-54    
gb|EFB19337.1|  hypothetical protein PANDA_000873                       192   4e-54    
emb|CAD70567.1|  aldehyde dehydrogenase                                 192   5e-54    
ref|XP_538742.2|  PREDICTED: aldehyde dehydrogenase X, mitochondr...    192   5e-54    
ref|WP_020062114.1|  betaine-aldehyde dehydrogenase                     191   5e-54    
gb|ABO93608.1|  cytosolic aldehyde dehydrogenase                        191   5e-54    
ref|XP_002913100.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    192   5e-54    
dbj|BAG36147.1|  unnamed protein product                                192   6e-54    
ref|NP_000683.3|  aldehyde dehydrogenase X, mitochondrial precursor     192   6e-54    
gb|KIZ05750.1|  aldehyde dehydrogenase (NAD+)                           192   6e-54    
ref|XP_004048099.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   7e-54    
ref|XP_003995700.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   8e-54    
ref|XP_008140103.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   8e-54    
ref|XP_003785199.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   8e-54    
ref|XP_010088836.1|  Aldehyde dehydrogenase family 2 member C4          191   9e-54    
ref|XP_010926163.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    191   9e-54    
emb|CDP03348.1|  unnamed protein product                                191   9e-54    
ref|WP_041075921.1|  betaine-aldehyde dehydrogenase                     191   1e-53    
ref|XP_005326359.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   1e-53    
ref|XP_004969047.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    191   1e-53    
gb|EMS47816.1|  Aldehyde dehydrogenase family 2 member C4               191   1e-53    
ref|XP_004631881.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   1e-53    
ref|XP_008270467.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    191   1e-53    
ref|NP_001127576.1|  aldehyde dehydrogenase X, mitochondrial prec...    191   1e-53    
ref|XP_006644328.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    191   1e-53    
ref|XP_003385758.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    189   1e-53    
ref|XP_004327205.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   1e-53    
ref|XP_009048780.1|  hypothetical protein LOTGIDRAFT_177987             191   1e-53    
ref|WP_006098251.1|  betaine-aldehyde dehydrogenase                     190   1e-53    
ref|XP_002914982.2|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   1e-53    
ref|XP_006053036.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    192   1e-53    
ref|XP_010926277.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    191   1e-53    
ref|XP_004271508.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    191   1e-53    
emb|CBH32543.1|  retinal dehydrogenase, putative, expressed             190   1e-53    
gb|EFB16854.1|  hypothetical protein PANDA_002930                       191   1e-53    
ref|WP_019153463.1|  betaine-aldehyde dehydrogenase                     190   2e-53    
pdb|1AG8|A  Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria    190   2e-53    
ref|WP_000080305.1|  aldehyde dehydrogenase                             184   2e-53    
gb|AHM26658.1|  aldehyde dehydrogenase 2-3                              190   2e-53    
gb|EDL98822.1|  rCG55098                                                191   2e-53    
ref|XP_009234277.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    190   2e-53    
ref|NP_001068835.1|  aldehyde dehydrogenase, mitochondrial precursor    190   2e-53    
ref|XP_006204897.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    190   2e-53    
ref|WP_026573699.1|  betaine-aldehyde dehydrogenase                     190   2e-53    
ref|XP_008582577.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    190   2e-53    
ref|XP_010049711.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    190   2e-53    
ref|XP_007118627.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    190   2e-53    
ref|XP_004392372.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    190   2e-53    
ref|XP_010049712.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    190   2e-53    
ref|XP_004017458.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    190   2e-53    
ref|WP_026562048.1|  betaine-aldehyde dehydrogenase                     190   2e-53    
ref|WP_036654086.1|  betaine-aldehyde dehydrogenase                     189   3e-53    
gb|AAH01619.1|  Aldehyde dehydrogenase 1 family, member B1              190   3e-53    
sp|P30837.3|AL1B1_HUMAN  RecName: Full=Aldehyde dehydrogenase X, ...    190   3e-53    
ref|XP_004395895.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    190   3e-53    
gb|AAP36452.1|  Homo sapiens aldehyde dehydrogenase 1 family, mem...    190   3e-53    
gb|ABW03290.1|  aldehyde dehydrogenase 1 family, member B1              190   3e-53    
ref|XP_003353634.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    190   3e-53    
ref|XP_004677554.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    190   3e-53    
ref|XP_008775315.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    189   3e-53    
ref|XP_003500134.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    190   4e-53    
ref|XP_005078799.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    190   4e-53    
emb|CAD10505.1|  aldehyde dehydrogenase                                 190   4e-53    
ref|WP_033674165.1|  betaine-aldehyde dehydrogenase                     183   4e-53    
ref|WP_042353774.1|  betaine-aldehyde dehydrogenase                     189   4e-53    
ref|WP_026677159.1|  betaine-aldehyde dehydrogenase                     189   4e-53    
ref|WP_028782193.1|  betaine-aldehyde dehydrogenase                     189   4e-53    
ref|XP_008657785.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    181   4e-53    
ref|WP_010896716.1|  betaine-aldehyde dehydrogenase                     189   4e-53    
ref|WP_029629697.1|  betaine-aldehyde dehydrogenase                     189   4e-53    
ref|XP_003796031.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    189   5e-53    
ref|XP_006735811.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    189   5e-53    
ref|WP_034639974.1|  betaine-aldehyde dehydrogenase                     189   5e-53    
ref|WP_004434073.1|  betaine-aldehyde dehydrogenase                     189   5e-53    
gb|EJR50331.1|  hypothetical protein IIK_01400                          183   5e-53    
gb|KIE10085.1|  betaine-aldehyde dehydrogenase                          189   5e-53    
ref|XP_004753300.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    189   5e-53    
ref|XP_005883979.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   5e-53    
ref|WP_019503923.1|  betaine-aldehyde dehydrogenase                     189   5e-53    
ref|XP_008463377.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    188   5e-53    
ref|NP_001043454.1|  Os01g0591300                                       189   5e-53    
gb|EGF24028.1|  aldehyde dehydrogenase 2                                188   5e-53    
gb|ELP34093.1|  retinal dehydrogenase                                   188   5e-53    
dbj|BAD32861.1|  putative cytosolic aldehyde dehydrogenase              189   5e-53    
ref|XP_006973760.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   6e-53    
gb|EAY74764.1|  hypothetical protein OsI_02656                          189   6e-53    
ref|XP_003805159.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   6e-53    
ref|XP_007197093.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   6e-53    
ref|NP_001105046.1|  cytosolic aldehyde dehydrogenase RF2C              189   6e-53    
ref|XP_006735810.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    189   7e-53    
ref|XP_007966861.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   7e-53    
gb|AHH02396.1|  aldehyde dehydrogenase                                  177   7e-53    
dbj|BAJ87654.1|  predicted protein                                      189   7e-53    
ref|XP_002514327.1|  aldehyde dehydrogenase, putative                   189   7e-53    
ref|XP_004635977.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    189   7e-53    
gb|KCW82463.1|  hypothetical protein EUGRSUZ_C03853                     186   7e-53    
gb|AAL99608.1|AF348412_1  cytosolic aldehyde dehydrogenase RF2C         189   7e-53    
ref|XP_006096562.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    189   7e-53    
ref|NP_001038076.1|  aldehyde dehydrogenase, mitochondrial precursor    189   7e-53    
gb|ACD02422.1|  mitochondrial aldehyde dehydrogenase 2                  189   8e-53    
ref|NP_001011975.1|  aldehyde dehydrogenase X, mitochondrial prec...    189   8e-53    
gb|EHH23951.1|  Aldehyde dehydrogenase X, mitochondrial                 189   8e-53    
ref|XP_005581304.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   9e-53    
gb|EHH57231.1|  Aldehyde dehydrogenase X, mitochondrial                 189   9e-53    
dbj|BAE30339.1|  unnamed protein product                                189   9e-53    
ref|WP_017560580.1|  aldehyde dehydrogenase                             182   9e-53    
gb|EAY74759.1|  hypothetical protein OsI_02651                          189   9e-53    
ref|XP_001639716.1|  predicted protein                                  189   9e-53    
ref|XP_010368301.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   9e-53    
gb|AJF41235.1|  mitochondrial aldehyde dehydrogenase 2                  188   9e-53    
emb|CAJ83424.1|  aldehyde dehydrogenase 2 family (mitochondrial)        189   9e-53    
ref|WP_024094213.1|  putative aldehyde dehydrogenase DhaS               188   9e-53    
ref|XP_008463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    188   1e-52    
ref|NP_001004907.1|  aldehyde dehydrogenase, mitochondrial              189   1e-52    
ref|XP_003911526.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    188   1e-52    
ref|WP_020722661.1|  betaine-aldehyde dehydrogenase                     188   1e-52    
ref|XP_005883980.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    190   1e-52    
ref|XP_005996458.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    189   1e-52    
ref|XP_007130063.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    188   1e-52    
ref|WP_013056742.1|  betaine-aldehyde dehydrogenase                     188   1e-52    
gb|AJI22990.1|  aldehyde dehydrogenase family protein                   188   1e-52    
ref|WP_040106853.1|  betaine-aldehyde dehydrogenase                     188   1e-52    
ref|WP_013082880.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       188   1e-52    
ref|WP_026963171.1|  betaine-aldehyde dehydrogenase                     187   1e-52    
ref|WP_017746980.1|  betaine-aldehyde dehydrogenase                     187   1e-52    
ref|XP_002736989.1|  PREDICTED: retinal dehydrogenase 1-like            188   1e-52    
gb|KCW82462.1|  hypothetical protein EUGRSUZ_C03853                     186   1e-52    
ref|XP_003761415.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    188   1e-52    
ref|XP_010250355.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   2e-52    
ref|XP_006143784.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    188   2e-52    
ref|XP_007448232.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    188   2e-52    
ref|XP_007966859.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   2e-52    
ref|XP_007966855.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   2e-52    
ref|XP_007966858.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   2e-52    
ref|XP_008050620.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    188   2e-52    
ref|XP_009002916.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    186   2e-52    
ref|WP_034410238.1|  betaine-aldehyde dehydrogenase                     187   2e-52    
gb|KHE90517.1|  aldehyde dehydrogenase (NAD)                            187   2e-52    
gb|AGN03871.1|  retinol dehydrogenase 2                                 187   2e-52    
ref|XP_007966860.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    189   2e-52    
ref|WP_043903901.1|  betaine-aldehyde dehydrogenase                     187   2e-52    
ref|XP_008361254.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   2e-52    
ref|WP_038563577.1|  betaine-aldehyde dehydrogenase                     187   2e-52    
ref|XP_004658363.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    187   2e-52    
ref|XP_004910950.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    187   3e-52    
ref|XP_007529015.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    187   3e-52    
ref|XP_005329685.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    187   3e-52    
ref|XP_003462990.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    187   3e-52    
ref|XP_005362186.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    187   3e-52    
ref|WP_038179413.1|  betaine-aldehyde dehydrogenase                     187   3e-52    
gb|KEH21359.1|  cytosolic aldehyde dehydrogenase RF2C                   184   3e-52    
ref|NP_082546.1|  aldehyde dehydrogenase X, mitochondrial precursor     187   3e-52    
ref|XP_010049713.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   3e-52    
ref|XP_010688154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   3e-52    
ref|XP_005403230.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    187   3e-52    
ref|XP_006644329.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   3e-52    
ref|XP_010925091.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   3e-52    
ref|XP_004315892.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    187   4e-52    
gb|EPQ18726.1|  Aldehyde dehydrogenase X, mitochondrial                 189   4e-52    
ref|XP_002110539.1|  expressed hypothetical protein                     187   4e-52    
gb|ACH63235.1|  alcohol dehydrogenase                                   187   4e-52    
ref|XP_009402158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   4e-52    
ref|XP_009402159.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   4e-52    
ref|XP_010688156.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   4e-52    
ref|WP_015955732.1|  betaine-aldehyde dehydrogenase                     186   4e-52    
ref|XP_010049715.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    186   4e-52    
ref|XP_005382913.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    187   4e-52    
ref|XP_001114412.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    187   5e-52    
ref|XP_006451112.1|  hypothetical protein CICLE_v10008077mg             186   5e-52    
ref|WP_026694659.1|  betaine-aldehyde dehydrogenase                     186   5e-52    
gb|AIV00511.1|  aldehyde dehydrogenase 2-5                              186   5e-52    
gb|KDO82486.1|  hypothetical protein CISIN_1g009035mg                   185   5e-52    
ref|WP_039742627.1|  betaine-aldehyde dehydrogenase                     186   5e-52    
ref|XP_009347162.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    186   5e-52    
ref|NP_001087022.1|  aldehyde dehydrogenase 2 family (mitochondrial)    187   5e-52    
ref|WP_015783713.1|  betaine-aldehyde dehydrogenase                     186   6e-52    
ref|WP_035609083.1|  betaine-aldehyde dehydrogenase                     186   6e-52    
ref|XP_003994722.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    186   6e-52    
ref|XP_007013215.1|  Aldehyde dehydrogenase 2C4                         186   6e-52    
ref|XP_010049714.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    186   6e-52    
ref|WP_015121640.1|  NAD-dependent aldehyde dehydrogenase               186   6e-52    
gb|KJB54166.1|  hypothetical protein B456_009G024000                    184   6e-52    
ref|XP_006863194.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    186   6e-52    
gb|EDZ67421.1|  aldehyde dehydrogenase (NAD) family protein             179   6e-52    
emb|CDP12738.1|  unnamed protein product                                186   7e-52    
ref|WP_026576774.1|  betaine-aldehyde dehydrogenase                     186   7e-52    
ref|XP_009336918.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    186   7e-52    
ref|XP_006865489.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    186   8e-52    
ref|WP_033677838.1|  betaine-aldehyde dehydrogenase                     186   8e-52    
ref|WP_042979097.1|  betaine-aldehyde dehydrogenase                     186   8e-52    



>ref|XP_009617291.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Nicotiana tomentosiformis]
Length=535

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  91   FPSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  270
            FPSASA LG   GV   I RFSTAAAVEE+ +P V+V +T+ +ING+FVDSASGKTFPTL
Sbjct  16   FPSASAPLGRSNGVARHINRFSTAAAVEEVTTPPVQVSFTKLLINGQFVDSASGKTFPTL  75

Query  271  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  450
            DPRTE+VIA+VAEG+AEDINRAVAAARKAFDEGPWPKMSAYERS+IM KFADLVEKH DE
Sbjct  76   DPRTEEVIANVAEGDAEDINRAVAAARKAFDEGPWPKMSAYERSKIMFKFADLVEKHNDE  135

Query  451  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  630
            LA LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGV
Sbjct  136  LAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  195

Query  631  AGQIIPWNFPLAMFAW  678
            AGQIIPWNFPL MFAW
Sbjct  196  AGQIIPWNFPLLMFAW  211



>ref|XP_009617290.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Nicotiana tomentosiformis]
Length=536

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 176/197 (89%), Gaps = 1/197 (1%)
 Frame = +1

Query  91   FPSASAFL-GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            FPSASA L G   GV   I RFSTAAAVEE+ +P V+V +T+ +ING+FVDSASGKTFPT
Sbjct  16   FPSASAPLAGRSNGVARHINRFSTAAAVEEVTTPPVQVSFTKLLINGQFVDSASGKTFPT  75

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRTE+VIA+VAEG+AEDINRAVAAARKAFDEGPWPKMSAYERS+IM KFADLVEKH D
Sbjct  76   LDPRTEEVIANVAEGDAEDINRAVAAARKAFDEGPWPKMSAYERSKIMFKFADLVEKHND  135

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            ELA LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIG
Sbjct  136  ELAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIG  195

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL MFAW
Sbjct  196  VAGQIIPWNFPLLMFAW  212



>ref|XP_006345041.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Solanum tuberosum]
Length=535

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +1

Query  91   FPSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  270
             PSASA LG  +GV   I RFSTAAAVEEL++P V+V +T+ +ING+FVDSASGKTFPTL
Sbjct  16   LPSASASLGRSHGVARHINRFSTAAAVEELITPPVQVNHTKLLINGQFVDSASGKTFPTL  75

Query  271  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  450
            DPRT +VIA+VAEG+ ED+NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH DE
Sbjct  76   DPRTGEVIANVAEGDLEDVNRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHNDE  135

Query  451  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  630
            +A LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGV
Sbjct  136  IAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGV  195

Query  631  AGQIIPWNFPLAMFAW  678
            AGQIIPWNFPL M AW
Sbjct  196  AGQIIPWNFPLLMMAW  211



>emb|CDP18933.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = +1

Query  100  ASAFLGWKYGVESGIQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  276
            +S+F G  YGV SG+ RFSTA AAVEE +SP V++ YT+ +ING+FVDSASGKTFPTLDP
Sbjct  17   SSSFRGANYGVVSGMNRFSTATAAVEEPISPPVQINYTKLLINGQFVDSASGKTFPTLDP  76

Query  277  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  456
            RT +VIAHVAEG+ EDINRAV+AARKAFDEGPWPKM AYER+R++L+FADLVEKH DELA
Sbjct  77   RTGEVIAHVAEGDTEDINRAVSAARKAFDEGPWPKMPAYERARVLLRFADLVEKHSDELA  136

Query  457  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  636
             LETWDNGK YEQAA +ELP  VRLFHYYAGWADKIHGLT PADGPHHVQ LHEPIGVAG
Sbjct  137  ALETWDNGKTYEQAATAELPTFVRLFHYYAGWADKIHGLTAPADGPHHVQILHEPIGVAG  196

Query  637  QIIPWNFPLAMFAW  678
            QIIPWNFPL MFAW
Sbjct  197  QIIPWNFPLLMFAW  210



>ref|XP_004236119.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=535

 Score =   333 bits (853),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = +1

Query  94   PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  273
            PS SA LG  +GV   I RFSTAAAVEE+++P V++ +T+ +ING+FVDSASGKTFPTLD
Sbjct  17   PSVSASLGRSHGVARHINRFSTAAAVEEIITPPVQINHTKLLINGQFVDSASGKTFPTLD  76

Query  274  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  453
            PRT +VIA+VAEG+ ED+NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH DE+
Sbjct  77   PRTGEVIANVAEGDLEDVNRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHNDEI  136

Query  454  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  633
            A LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQ LHEPIGVA
Sbjct  137  AALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQILHEPIGVA  196

Query  634  GQIIPWNFPLAMFAW  678
            GQIIPWNFPL M AW
Sbjct  197  GQIIPWNFPLLMMAW  211



>ref|XP_010028184.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW83434.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=534

 Score =   332 bits (852),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  115  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  294
            G  +GV S I R+STAAAVEEL+SP V++ YTQH+ING FVD+ASG+TFPT DPRT DV+
Sbjct  23   GRNHGVGSSISRYSTAAAVEELISPPVQISYTQHLINGHFVDAASGRTFPTYDPRTGDVL  82

Query  295  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  474
            AHVAEG+A+DI+RAVAAARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+
Sbjct  83   AHVAEGDAKDIDRAVAAARKAFDEGPWPKMTAYERSRILLRFADLVEKHNDELAALETWN  142

Query  475  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  654
             GKPYEQ+AKSELPM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  143  CGKPYEQSAKSELPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  202

Query  655  FPLAMFAW  678
            FPL MFAW
Sbjct  203  FPLIMFAW  210



>ref|XP_011071828.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Sesamum indicum]
Length=536

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = +1

Query  91   FPSASAFLGWKYGV-ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  267
             P++ A L  KYG+   G+QR++TA  +EE ++P V+V YT+ +ING+FVDSASGKTFPT
Sbjct  16   LPTSPASLARKYGLWGRGMQRYTTATVLEEPITPPVQVNYTKLLINGQFVDSASGKTFPT  75

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRT +VIAHVAEG+ ED+NRAV+AARKAFDEGPWPKMSAYERSRI+L+FADLVEKHM 
Sbjct  76   LDPRTGEVIAHVAEGDVEDVNRAVSAARKAFDEGPWPKMSAYERSRIILRFADLVEKHMQ  135

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            ELA LETWDNGKPYEQA  +ELP+ VRLFHYYAGWADKIHGLTVPADGPHHVQ LHEPIG
Sbjct  136  ELAQLETWDNGKPYEQALTAELPLFVRLFHYYAGWADKIHGLTVPADGPHHVQVLHEPIG  195

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL M+AW
Sbjct  196  VAGQIIPWNFPLLMYAW  212



>gb|KJB53132.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=451

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  145  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLIMFAW  217



>gb|AFK41217.1| unknown [Lotus japonicus]
Length=543

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 169/188 (90%), Gaps = 3/188 (2%)
 Frame = +1

Query  115  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  294
            GW+    S   R+STAA VEEL++P V + YTQH+INGKFVD+ASGKTFP  DPRT DVI
Sbjct  35   GWR---NSNSHRYSTAAEVEELITPQVSINYTQHLINGKFVDAASGKTFPAYDPRTGDVI  91

Query  295  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  474
            AHVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADLVEKH DE+A LETW+
Sbjct  92   AHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLVEKHNDEIAALETWN  151

Query  475  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  654
            NGKPYEQAAK+E+PM+VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  152  NGKPYEQAAKAEVPMLVRLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  211

Query  655  FPLAMFAW  678
            FPL MFAW
Sbjct  212  FPLIMFAW  219



>gb|AFW86313.1| restorer of fertility2 [Zea mays]
Length=459

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AW
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAW  225



>gb|KJB53133.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=530

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  145  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLIMFAW  217



>gb|KHN18468.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=542

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 169/188 (90%), Gaps = 5/188 (3%)
 Frame = +1

Query  115  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  294
            GW+      I RFSTAAAVEEL++P V ++YTQ++ING+FVD+ASGKTFPT DPR+ +VI
Sbjct  36   GWR-----NINRFSTAAAVEELITPQVSIRYTQNLINGQFVDAASGKTFPTYDPRSGEVI  90

Query  295  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  474
            A VAEG+ EDINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+
Sbjct  91   AKVAEGDVEDINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWN  150

Query  475  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  654
            NGK YEQAAK+ELPM VRLFHYYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  151  NGKTYEQAAKTELPMFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPWN  210

Query  655  FPLAMFAW  678
            FPL MFAW
Sbjct  211  FPLVMFAW  218



>gb|KJB53131.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=541

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  145  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLIMFAW  217



>gb|AHM26656.1| aldehyde dehydrogenase 2-1 [Zea mays subsp. mays]
Length=549

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMFAW  225



>ref|XP_007155410.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27404.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=535

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I RFSTAAAVE+L++P V ++YTQH+ING+FVD+ASGKTFP  DPR+ +VIA+VAEG+ E
Sbjct  33   INRFSTAAAVEDLITPQVPIRYTQHLINGQFVDAASGKTFPAYDPRSGEVIANVAEGDVE  92

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+NGKP+EQAA
Sbjct  93   DINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWNNGKPFEQAA  152

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            KSELP+ VRLFHYYAGWADKIHGLTVPADG +HVQTLHEP+GVAGQIIPWNFPL MFAW
Sbjct  153  KSELPLFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPVGVAGQIIPWNFPLIMFAW  211



>ref|XP_007155411.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27405.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=536

 Score =   325 bits (834),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I RFSTAAAVE+L++P V ++YTQH+ING+FVD+ASGKTFP  DPR+ +VIA+VAEG+ E
Sbjct  34   INRFSTAAAVEDLITPQVPIRYTQHLINGQFVDAASGKTFPAYDPRSGEVIANVAEGDVE  93

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+NGKP+EQAA
Sbjct  94   DINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWNNGKPFEQAA  153

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            KSELP+ VRLFHYYAGWADKIHGLTVPADG +HVQTLHEP+GVAGQIIPWNFPL MFAW
Sbjct  154  KSELPLFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPVGVAGQIIPWNFPLIMFAW  212



>dbj|BAB92019.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=547

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAAAVEE ++P+V+V YT+ +ING FVD+ASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  45   LQRFSTAAAVEEPITPSVQVNYTKLLINGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAE  104

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  105  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  164

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  165  HIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQILHEPIGVAGQIIPWNFPLLMFAW  223



>gb|AAK58370.1|AF269064_1 T-cytoplasm male sterility restorer factor 2 [Zea mays]
Length=549

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AW
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAW  225



>ref|NP_001105891.1| mitochondrial aldehyde dehydrogenase 2 [Zea mays]
 gb|AAG43988.1|AF215823_1 T cytoplasm male sterility restorer factor 2 [Zea mays]
 gb|AAC49371.1| RF2 [Zea mays]
 gb|ACG38026.1| aldehyde dehydrogenase [Zea mays]
 gb|ACN28554.1| unknown [Zea mays]
 gb|AFW86312.1| restorer of fertility2 [Zea mays]
Length=549

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AW
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAW  225



>gb|AAO72532.1| aldehyde dehydrogenase 1 precursor [Lotus corniculatus]
Length=542

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +1

Query  115  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  294
            GW+    +   R+STAA VEEL++P V + YTQH+INGKFVD+ASGKTFP  DPRT DVI
Sbjct  35   GWR----NSNNRYSTAAVVEELITPQVSINYTQHLINGKFVDAASGKTFPAYDPRTGDVI  90

Query  295  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  474
            AHVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADLVEKH DE+A LETW+
Sbjct  91   AHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLVEKHNDEIAALETWN  150

Query  475  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  654
            NGKPYEQAAK+E+P  VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  151  NGKPYEQAAKAEVPTFVRLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  210

Query  655  FPLAMFAW  678
            FPL MFAW
Sbjct  211  FPLLMFAW  218



>gb|KDP26565.1| hypothetical protein JCGZ_17723 [Jatropha curcas]
Length=537

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 170/196 (87%), Gaps = 2/196 (1%)
 Frame = +1

Query  97   SASAFL--GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  270
            S SA    G    +  GI R+STAAAVEE + P+V V +TQ +ING+FVD+ASGKTFPTL
Sbjct  18   SGSALFSRGSNSSLARGISRYSTAAAVEEPIVPSVSVSHTQLLINGQFVDAASGKTFPTL  77

Query  271  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  450
            DPRT +VIAHVAEG+ EDINRAV+AARKAFDEGPWPKM+AYERSRIML+FADL+E H DE
Sbjct  78   DPRTGEVIAHVAEGDVEDINRAVSAARKAFDEGPWPKMTAYERSRIMLRFADLLEMHNDE  137

Query  451  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  630
            +A LETWDNGKPYEQAAK+E+PM+ RLF YYAGWADKIHGLTVPADG HHVQTLHEPIGV
Sbjct  138  IAALETWDNGKPYEQAAKAEIPMVARLFRYYAGWADKIHGLTVPADGQHHVQTLHEPIGV  197

Query  631  AGQIIPWNFPLAMFAW  678
            AGQIIPWNFPL M+AW
Sbjct  198  AGQIIPWNFPLLMYAW  213



>ref|XP_007210569.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
 gb|EMJ11768.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
Length=543

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + RFSTAAA EEL+ P V++ +TQH+ING+FVD+ASGKTFPT DPRT +VIAHVAEG+AE
Sbjct  41   VNRFSTAAATEELIIPPVQISHTQHLINGQFVDAASGKTFPTYDPRTGEVIAHVAEGDAE  100

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKPYEQA 
Sbjct  101  DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPYEQAL  160

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             +E+PM+ RLFHYYAGWADKIHGLTVPADG +H+QTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  161  HAEIPMLARLFHYYAGWADKIHGLTVPADGKYHIQTLHEPIGVAGQIIPWNFPLLMFAW  219



>ref|XP_010101190.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB87864.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=546

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  136  SGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  315
            + I RFST+ A EE + P VE+ YT+H+ING FVD+ASGKTFPT DPRTE+VIAHVAEG+
Sbjct  42   NSITRFSTSVAAEEAIIPPVEIAYTKHLINGHFVDAASGKTFPTYDPRTEEVIAHVAEGD  101

Query  316  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  495
            AEDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADLVEKH DE+A LETW+NGKPYEQ
Sbjct  102  AEDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHNDEIAALETWNNGKPYEQ  161

Query  496  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
            AA SE+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGV GQIIPWNFPL MFA
Sbjct  162  AATSEVPMLARLFRYYAGWADKIHGLTVPADGKYHVQTLHEPIGVTGQIIPWNFPLLMFA  221

Query  676  W  678
            W
Sbjct  222  W  222



>ref|XP_009363534.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   322 bits (826),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 173/197 (88%), Gaps = 1/197 (1%)
 Frame = +1

Query  91   FPSASAFL-GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            F SAS F  G    V  GI ++ST A++E  +SP+V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASMFSKGRSSSVVRGIGKYSTDASIESPISPSVKVNYTQLLINGQFVDSASGKTFPT  73

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++L+FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLLRFADLIEKHND  133

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            E+A LETWDNGKP+EQAAK E+PM+VR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMVVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL +FAW
Sbjct  194  VAGQIIPWNFPLLLFAW  210



>gb|AES91175.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=544

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  145  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
             RFSTAAAV+EL++P V + YTQH+INGKFVD+ASGKTFPTLDPRT +VIAHVAEG+AED
Sbjct  43   NRFSTAAAVQELITPQVSINYTQHLINGKFVDAASGKTFPTLDPRTGEVIAHVAEGDAED  102

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            INRAV+AAR+AFD GPWPKMSAYER RI+L+FADLVEKH DE+A LE W+NGK YEQAAK
Sbjct  103  INRAVSAAREAFDNGPWPKMSAYERCRILLRFADLVEKHNDEIAALEAWNNGKLYEQAAK  162

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            +E+PM VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  163  AEVPMFVRLFRYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPWNFPLLMFAW  220



>ref|XP_003608978.1| Mitochondrial aldehyde dehydrogenase [Medicago truncatula]
Length=544

 Score =   322 bits (826),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  145  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
             RFSTAAAV+EL++P V + YTQH+INGKFVD+ASGKTFPTLDPRT +VIAHVAEG+AED
Sbjct  43   NRFSTAAAVQELITPQVSINYTQHLINGKFVDAASGKTFPTLDPRTGEVIAHVAEGDAED  102

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            INRAV+AAR+AFD GPWPKMSAYER RI+L+FADLVEKH DE+A LE W+NGK YEQAAK
Sbjct  103  INRAVSAAREAFDNGPWPKMSAYERCRILLRFADLVEKHNDEIAALEAWNNGKLYEQAAK  162

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            +E+PM VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  163  AEVPMFVRLFRYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPWNFPLLMFAW  220



>ref|XP_008374451.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Malus domestica]
Length=539

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + RFSTAAA EEL+ P V++ +TQH+INGKFVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  37   VSRFSTAAATEELIIPPVQISHTQHLINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  96

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEK+ +ELA LETW+NGK YEQA 
Sbjct  97   DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKNSEELAALETWNNGKTYEQAL  156

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             +ELPM+ RLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  157  TAELPMLARLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  215



>ref|XP_008239742.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Prunus mume]
Length=537

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + RFSTAAA EEL+ P V++ +TQH+ING+FVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  35   VNRFSTAAATEELIIPPVQISHTQHLINGQFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  94

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKPYEQA 
Sbjct  95   DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPYEQAL  154

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             +ELPM+ RLFHYYAGWADKIHGLTVPADG +H+QTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  HAELPMLARLFHYYAGWADKIHGLTVPADGKYHIQTLHEPIGVAGQIIPWNFPLLMFAW  213



>gb|AAZ79355.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=537

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTED  288
            LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPRT +
Sbjct  24   LGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTGE  83

Query  289  VIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLET  468
            VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LET
Sbjct  84   VIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALET  143

Query  469  WDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIP  648
            W+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQIIP
Sbjct  144  WNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQIIP  203

Query  649  WNFPLAMFAW  678
            WNFPL MFAW
Sbjct  204  WNFPLMMFAW  213



>ref|XP_002283132.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI15054.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  285
            LG  +     I RFSTAAA  VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPRT 
Sbjct  24   LGKNFNRGKSIHRFSTAAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTG  83

Query  286  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  465
            +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LE
Sbjct  84   EVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALE  143

Query  466  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  645
            TW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQII
Sbjct  144  TWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQII  203

Query  646  PWNFPLAMFAW  678
            PWNFPL MFAW
Sbjct  204  PWNFPLMMFAW  214



>emb|CAN63005.1| hypothetical protein VITISV_013710 [Vitis vinifera]
Length=538

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  285
            LG  +     I RFSTAAA  VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPRT 
Sbjct  24   LGKNFNRGKSIHRFSTAAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTG  83

Query  286  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  465
            +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LE
Sbjct  84   EVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALE  143

Query  466  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  645
            TW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQII
Sbjct  144  TWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQII  203

Query  646  PWNFPLAMFAW  678
            PWNFPL MFAW
Sbjct  204  PWNFPLMMFAW  214



>gb|KHG08400.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=540

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  145  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  39   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  98

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQAAK
Sbjct  99   IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQAAK  158

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            SELPM +RLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  159  SELPMFIRLFHYYAGWADKIHGLTVPADGHHHVQILHEPIGVAGQIIPWNFPLLMFAW  216



>ref|XP_008221788.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Prunus mume]
Length=534

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 172/197 (87%), Gaps = 1/197 (1%)
 Frame = +1

Query  91   FPSASAF-LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            F SAS F  G    V  GI ++ST A+ E  + P+V+V YTQ +ING+FVD+ASGKTFPT
Sbjct  14   FTSASLFSAGRSSSVARGIGKYSTDASFEAPIIPSVKVNYTQLLINGQFVDAASGKTFPT  73

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRT +VIAHVAEG++EDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADLVEKH D
Sbjct  74   LDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLVEKHND  133

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            E+ATLETWDNGKP+EQAAK+E+PMIVR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIATLETWDNGKPFEQAAKTEVPMIVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL MFAW
Sbjct  194  VAGQIIPWNFPLLMFAW  210



>ref|XP_010678738.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=534

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + RFST +A+E+ + P V++K+TQ +ING FVD+ASGKTFPT DPRT DVI HVAEG+AE
Sbjct  32   LSRFSTTSALEDPIIPNVDIKHTQLLINGNFVDAASGKTFPTYDPRTGDVITHVAEGDAE  91

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKM+AYER+RI+L+FADLVE+H +ELA LETWDNGKP++QA+
Sbjct  92   DINRAVAAARKAFDEGPWPKMTAYERARIILRFADLVEQHSEELAALETWDNGKPFQQAS  151

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            KSELP+ VRLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  152  KSELPLFVRLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLIMFAW  210



>ref|XP_010251301.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=534

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG       GI RFSTA A EE+++P V+V++TQ +ING+FVD+ASG+TFPTLDPRT +V
Sbjct  22   LGRNSSWSRGIYRFSTATATEEVITPPVQVEHTQLLINGQFVDAASGRTFPTLDPRTGEV  81

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IAHVAEGE EDINRAV+AARKAFDEGPWPKM+AYERSRI+ +FADL+EKH DE+A +ETW
Sbjct  82   IAHVAEGEDEDINRAVSAARKAFDEGPWPKMTAYERSRIIYRFADLLEKHNDEIAAIETW  141

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            DNGKPYEQ+AK E+PM+ RLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPW
Sbjct  142  DNGKPYEQSAKVEIPMLTRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPW  201

Query  652  NFPLAMFAW  678
            NFPL M+AW
Sbjct  202  NFPLLMYAW  210



>ref|XP_004138115.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
 gb|KGN63591.1| hypothetical protein Csa_1G005520 [Cucumis sativus]
Length=548

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 170/193 (88%), Gaps = 8/193 (4%)
 Frame = +1

Query  103  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  279
            S FLG  YG       FST+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  39   SRFLGRGYG-------FSTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  91

Query  280  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  459
            T +VIAHVAEG+AED+NRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  92   TGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHTPELSA  151

Query  460  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  639
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  152  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  211

Query  640  IIPWNFPLAMFAW  678
            IIPWNFPL MFAW
Sbjct  212  IIPWNFPLIMFAW  224



>ref|XP_004155012.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=549

 Score =   320 bits (820),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 170/193 (88%), Gaps = 8/193 (4%)
 Frame = +1

Query  103  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  279
            S FLG  YG       FST+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  39   SRFLGRGYG-------FSTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  91

Query  280  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  459
            T +VIAHVAEG+AED+NRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  92   TGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHTPELSA  151

Query  460  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  639
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  152  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  211

Query  640  IIPWNFPLAMFAW  678
            IIPWNFPL MFAW
Sbjct  212  IIPWNFPLIMFAW  224



>ref|XP_004965205.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Setaria italica]
Length=549

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAA  EE +SP V+V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D+NRAVAAARKAFD GPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DVNRAVAAARKAFDVGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  167  HIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  225



>ref|XP_010682576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  115  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  294
            G    V  G+QR+STAAA++E ++P VEV YT+ +ING+FVD+ASGKTF T+DPRT +VI
Sbjct  23   GRSSCVRRGLQRYSTAAAIDEPITPPVEVNYTKLLINGQFVDAASGKTFHTVDPRTGNVI  82

Query  295  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  474
            A VAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSRI+L+ ADL+EKH D +A LETWD
Sbjct  83   ADVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRILLRGADLIEKHNDVIAALETWD  142

Query  475  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  654
            NGKPYEQ+AK E+PM+VRLF YYAGWADKIHGLT PADGP+HVQTLHEPIGVAGQIIPWN
Sbjct  143  NGKPYEQSAKVEIPMLVRLFRYYAGWADKIHGLTCPADGPYHVQTLHEPIGVAGQIIPWN  202

Query  655  FPLAMFAW  678
            FPL MFAW
Sbjct  203  FPLLMFAW  210



>ref|XP_010914166.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=571

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTA AVEE ++P V+V +TQ +ING+FVD+ASGKTFPTLDPRT ++IAHVAEG+ E
Sbjct  69   LQRFSTAVAVEEPITPPVQVHHTQLLINGQFVDAASGKTFPTLDPRTGEMIAHVAEGDVE  128

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D+NRAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DE+A LETWDNGKPYEQAA
Sbjct  129  DVNRAVAAARKAFDEGPWPKMTGYERSRILLRFADLVEKHNDEIAALETWDNGKPYEQAA  188

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  189  NVEVPMLVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  247



>emb|CDP00179.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 170/194 (88%), Gaps = 1/194 (1%)
 Frame = +1

Query  100  ASAFLGWKYGVES-GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  276
            AS   G K   ++  I R+STAAA+EE + P V V+YT+ +ING+FVD+ASGKTFPTLDP
Sbjct  21   ASRLTGGKSACQARAISRYSTAAALEEPIKPPVNVEYTKLLINGQFVDAASGKTFPTLDP  80

Query  277  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  456
            RT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPK++AY+R RI+L+FADLVEKH DE+A
Sbjct  81   RTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKLTAYDRQRILLRFADLVEKHNDEIA  140

Query  457  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  636
             LETWDNGKPYEQAAK E+PM VRL  YYAGWADKIHG+TVPADGP+HVQTLHEPIGVAG
Sbjct  141  ALETWDNGKPYEQAAKIEVPMFVRLMRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVAG  200

Query  637  QIIPWNFPLAMFAW  678
            QIIPWNFPL M+AW
Sbjct  201  QIIPWNFPLLMYAW  214



>ref|XP_007036177.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
 gb|EOY20678.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
Length=567

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I+R ST+ A+EEL+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT +VIAHVAEG+AE
Sbjct  38   IKRLSTSTALEELIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGEVIAHVAEGDAE  97

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D+NRAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DELA LETW+NGK +EQAA
Sbjct  98   DVNRAVAAARKAFDEGPWPKMTPYERSRILLRFADLVEKHSDELAALETWNNGKLHEQAA  157

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K+ELP+++RLFHYYAGWADKIHGLTVPADG HHVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  158  KAELPLLIRLFHYYAGWADKIHGLTVPADGNHHVQTLHEPIGVAGQIIPWNFPLLMFAW  216



>ref|XP_009363532.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 170/197 (86%), Gaps = 1/197 (1%)
 Frame = +1

Query  91   FPSASAFL-GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            F SAS F  G    V  GI ++ST A++E  +SP V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASLFSKGRTSSVVRGIGKYSTDASIESPISPTVKVNYTQLLINGQFVDSASGKTFPT  73

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHND  133

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            E+A LETWDNGKP+EQAAK E+PM+ R F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMLARFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL MFAW
Sbjct  194  VAGQIIPWNFPLLMFAW  210



>ref|XP_010546022.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Tarenaya hassleriana]
Length=539

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = +1

Query  154  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  333
            +TAAAVEE+++P V+V YTQH+ING FVDSASGKTFPTLDPRT +VIAHVAEG+AEDI+R
Sbjct  41   TTAAAVEEIINPPVQVSYTQHLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDIDR  100

Query  334  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  513
            AV AARKAFDEGPWPKM AYERSRI+L+FADLVEK+ +ELA LETWDNGKPYEQ++KSE+
Sbjct  101  AVKAARKAFDEGPWPKMPAYERSRILLRFADLVEKNSEELAILETWDNGKPYEQSSKSEI  160

Query  514  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  161  PMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAW  215



>gb|AAF73828.1|AF162665_1 aldehyde dehydrogenase [Oryza sativa]
Length=549

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  225



>ref|XP_004297642.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=535

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = +1

Query  91   FPSASAFLGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFP  264
            F SAS+F   +  V  GI ++STAAA  VE+ ++P V+V +T+ +ING FVD+ASGKTFP
Sbjct  14   FTSASSFSKGRSSVSRGIGKYSTAAAAAVEDPITPPVKVGHTKLLINGHFVDAASGKTFP  73

Query  265  TLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHM  444
            TLDPRT DVIAHVAEG+AED++RAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EKH 
Sbjct  74   TLDPRTGDVIAHVAEGDAEDVDRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHN  133

Query  445  DELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPI  624
            DELA LETWDNGKP+EQ+AK E+PM+ R F YYAG+ADKIHGLTVPADGP+HVQTLHEPI
Sbjct  134  DELAALETWDNGKPFEQSAKIEIPMVARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPI  193

Query  625  GVAGQIIPWNFPLAMFAW  678
            GVAGQIIPWNFPL MFAW
Sbjct  194  GVAGQIIPWNFPLVMFAW  211



>ref|XP_007221800.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
 gb|EMJ22999.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
Length=534

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 172/197 (87%), Gaps = 1/197 (1%)
 Frame = +1

Query  91   FPSASAF-LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            F SAS F  G    V  GI ++ST A+ E  + P+V+V YT+ +ING+FVD+ASGKTFPT
Sbjct  14   FTSASLFSAGRSSSVARGIGKYSTDASFEAPIIPSVKVNYTRLLINGQFVDAASGKTFPT  73

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRT +VIAHVAEG++EDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADLVEKH D
Sbjct  74   LDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLVEKHND  133

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            E+ATLETWDNGKP+EQAAK+E+PMIVR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIATLETWDNGKPFEQAAKTEVPMIVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL MFAW
Sbjct  194  VAGQIIPWNFPLLMFAW  210



>ref|NP_001057358.1| Os06g0270900 [Oryza sativa Japonica Group]
 dbj|BAB19052.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAD54414.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAF19272.1| Os06g0270900 [Oryza sativa Japonica Group]
 gb|EAZ36586.1| hypothetical protein OsJ_20928 [Oryza sativa Japonica Group]
 dbj|BAG93278.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94020.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99957.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98432.1| aldehyde dehydrogenase, partial [Oryza sativa]
Length=549

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  225



>gb|EAZ00462.1| hypothetical protein OsI_22484 [Oryza sativa Indica Group]
Length=549

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  225



>ref|XP_010503421.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAW  213



>ref|XP_008389628.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Malus domestica]
Length=534

 Score =   317 bits (813),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 171/197 (87%), Gaps = 1/197 (1%)
 Frame = +1

Query  91   FPSASAFLGWKYG-VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            F SAS F   +   V  GI ++ST A++E  +SP+V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASMFSKXRSSSVVRGIGKYSTDASIESPISPSVKVNYTQLLINGQFVDSASGKTFPT  73

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHND  133

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            E+A LETWDNGKP+EQAAK E+PM+ R F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMVARFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL MFAW
Sbjct  194  VAGQIIPWNFPLLMFAW  210



>ref|XP_010426271.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   317 bits (813),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAW  213



>ref|XP_002877590.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53849.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   317 bits (813),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RF T++A EE+++P+V+V +TQ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEEIINPSVQVSHTQLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  TVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAW  213



>ref|XP_010928601.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RFSTAAAVEE ++P V+V++TQ +ING+FVD+ASGKTFPTLDPRT DVIA VAEG+AE
Sbjct  41   LRRFSTAAAVEEHITPPVDVQHTQLLINGQFVDAASGKTFPTLDPRTGDVIACVAEGDAE  100

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  101  DINRAVAAARKAFDEGPWPRMTAYERSRILLRFADLMEKHNDEIAALETWDNGKPYEQSA  160

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM++RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL MF W
Sbjct  161  NIEVPMLIRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMFGW  219



>ref|XP_010913576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RFSTA AVEE ++P V+V +TQ +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ E
Sbjct  41   LRRFSTAVAVEEPITPPVQVHHTQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVE  100

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D+N AVAAARKAFDEGPWPKM+ YERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  101  DVNHAVAAARKAFDEGPWPKMTGYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  160

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             +E+PM+VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  161  NAEVPMLVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  219



>ref|XP_010515110.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Camelina sativa]
Length=537

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASG+TFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGQTFPTLDPRTGEVIAHVAEGDAE  94

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAW  213



>ref|XP_009391259.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 171/197 (87%), Gaps = 1/197 (1%)
 Frame = +1

Query  91   FPSASAFLGWKYGVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            F S +A L  K G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPT
Sbjct  12   FRSLAAPLFRKDGSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPT  71

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPR+ +VIA VAEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH D
Sbjct  72   LDPRSGEVIAQVAEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHND  131

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            E+A LETWDNGKP+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIG
Sbjct  132  EIAALETWDNGKPFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIG  191

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL M+AW
Sbjct  192  VAGQIIPWNFPLLMYAW  208



>ref|XP_008793883.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=540

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RFSTA AVEE ++P V+V+ TQ +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  38   LRRFSTAVAVEEPIAPPVQVQCTQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAE  97

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D+NRAVAAAR+AFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  98   DVNRAVAAAREAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  157

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YY GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MF W
Sbjct  158  NLEVPMLTRLMRYYGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFGW  216



>ref|XP_010682575.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  115  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  294
            G    V  G+QR+STAAA++E ++P VEV YT+ +ING+FVD+ASGKTF T+DPRT +VI
Sbjct  23   GRSSCVRRGLQRYSTAAAIDEPITPPVEVNYTKLLINGQFVDAASGKTFHTVDPRTGNVI  82

Query  295  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  474
            A VAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSRI+L+ ADL+EKH D +A LETWD
Sbjct  83   ADVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRILLRGADLIEKHNDVIAALETWD  142

Query  475  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  654
            NGKPYEQ+AK E+PM+VRLF YYAGWADKIHGLT PADGP+HVQTLHEPIGVAGQIIPWN
Sbjct  143  NGKPYEQSAKVEIPMLVRLFRYYAGWADKIHGLTCPADGPYHVQTLHEPIGVAGQIIPWN  202

Query  655  FPLAMFAW  678
            FPL MFAW
Sbjct  203  FPLLMFAW  210



>ref|XP_004508853.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=536

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  145  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
             RFSTAAAVEEL++P V + YTQH+ING+FVD+ASGKTFPT DPRT +VIA VAEG+AED
Sbjct  35   NRFSTAAAVEELITPQVSINYTQHLINGQFVDAASGKTFPTYDPRTGEVIARVAEGDAED  94

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            INRAV+AARKAFD+GPWPKM+AYER RI+L+FADL+EKH DE+A LE+W+NGK YEQAAK
Sbjct  95   INRAVSAARKAFDDGPWPKMTAYERCRILLRFADLIEKHNDEIAALESWNNGKLYEQAAK  154

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             ELPM+VRLF YYAGW DKIHG+TVPADG +H+QTLHEPIGV GQIIPWNFPL MFAW
Sbjct  155  IELPMVVRLFRYYAGWTDKIHGMTVPADGDYHIQTLHEPIGVVGQIIPWNFPLLMFAW  212



>ref|XP_004298932.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=532

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFS-TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            + RFS TAAA EEL++P V +++T+ +ING+FVDSASGKTFPT DPRT +VIAHVAEG+A
Sbjct  29   VSRFSSTAAASEELITPPVHIEHTKLLINGQFVDSASGKTFPTYDPRTGEVIAHVAEGDA  88

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            EDINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKP+ QA
Sbjct  89   EDINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPFVQA  148

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            +++ELPM+VRL HYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MF W
Sbjct  149  SQAELPMVVRLLHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFVW  208



>ref|XP_007153639.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
 gb|ESW25633.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
Length=535

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + ++STAAA+EE + PAV+V+YTQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +E
Sbjct  33   LCKYSTAAAIEEPIKPAVQVEYTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSE  92

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+RAVAAARKAFD GPWP+M+AYER RI+L+ ADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  93   DIDRAVAAARKAFDHGPWPRMTAYERQRILLRAADLIEKHNDEIAALETWDNGKPYEQSA  152

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  153  KIEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAW  211



>ref|XP_008367527.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Malus domestica]
Length=541

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFS-TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            + RFS TA A EEL+ P V++ +TQH+INGKFVD+ASGK FPT DPRT +VIAHVAEG+A
Sbjct  38   VSRFSSTAVATEELIIPPVQISHTQHLINGKFVDAASGKKFPTYDPRTGEVIAHVAEGDA  97

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            EDINRAVAAARKAFDEGPWPKM AYERSRI+L+FADLVEK+ +ELA LETW+NGKPYEQA
Sbjct  98   EDINRAVAAARKAFDEGPWPKMGAYERSRILLRFADLVEKNSEELAALETWNNGKPYEQA  157

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              +E+PM+ RLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  158  LTAEVPMLARLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  217



>gb|EYU42550.1| hypothetical protein MIMGU_mgv1a004919mg [Erythranthe guttata]
Length=504

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRF-STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            +QRF S+AA ++E + P +++ YT+ +ING+FVDSASGKTFPTLDPRT +VIAHVAEG+A
Sbjct  1    MQRFTSSAAVIDEPIIPPLQINYTKLLINGQFVDSASGKTFPTLDPRTGEVIAHVAEGDA  60

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            EDINRAV+AARKAFDEGPWP+M+AYERSRIML+FADL EKH  ELA LETWDNGKPYEQA
Sbjct  61   EDINRAVSAARKAFDEGPWPRMTAYERSRIMLRFADLAEKHTQELAQLETWDNGKPYEQA  120

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              +ELP+ VRLFHYYAGWADKIHGLTVPADGPHHVQ LHEPIGVAGQIIPWNFPL M AW
Sbjct  121  LTAELPLFVRLFHYYAGWADKIHGLTVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMLAW  180



>ref|XP_002511424.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF52026.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=534

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I RFSTAA  EE ++P V++ YTQH ING+FVD+ASGKTFP  DPRT  VIA VAEG+AE
Sbjct  32   IYRFSTAAVAEEPITPPVQISYTQHFINGQFVDAASGKTFPAYDPRTGQVIAQVAEGDAE  91

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FA+LVEK+ DELA LETW+NGKPYEQ+A
Sbjct  92   DINRAVAAARKAFDEGPWPKMTAYERSRIILRFAELVEKNNDELAALETWNNGKPYEQSA  151

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            KSELP++ RLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQIIPWNFPL +FAW
Sbjct  152  KSELPLLSRLFHYYAGWADKIHGLTVPADGNHHVQILHEPIGVAGQIIPWNFPLILFAW  210



>gb|AGV54428.1| mitochondrial aldehyde dehydrogenase [Phaseolus vulgaris]
Length=535

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + ++STAAA+EE + PAV+V+YTQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +E
Sbjct  33   LCKYSTAAAIEEPIKPAVQVEYTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSE  92

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+RAVAAARKAFD GPWP+M+AYER RI+L+ ADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  93   DIDRAVAAARKAFDHGPWPRMTAYERQRILLRAADLIEKHNDEIAALETWDNGKPYEQSA  152

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  153  KIEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAW  211



>emb|CDY36910.1| BnaA06g16950D [Brassica napus]
Length=539

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 173/201 (86%), Gaps = 5/201 (2%)
 Frame = +1

Query  91   FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  255
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  15   FSASSPFLSRSQGKNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  74

Query  256  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  435
            TFPTLDPRT +VIAHVAEG+AEDINRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  75   TFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  134

Query  436  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  615
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  135  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  194

Query  616  EPIGVAGQIIPWNFPLAMFAW  678
            EPIGVAGQIIPWNFPL MFAW
Sbjct  195  EPIGVAGQIIPWNFPLLMFAW  215



>ref|XP_008453101.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis melo]
Length=554

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 168/193 (87%), Gaps = 8/193 (4%)
 Frame = +1

Query  103  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  279
            S FLG   G       F T+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  45   SRFLGRGNG-------FGTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  97

Query  280  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  459
            T +VIAHVAEG+AEDINRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  98   TGEVIAHVAEGDAEDINRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHAPELSA  157

Query  460  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  639
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  158  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  217

Query  640  IIPWNFPLAMFAW  678
            IIPWNFPL MFAW
Sbjct  218  IIPWNFPLIMFAW  230



>ref|XP_009149853.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Brassica rapa]
Length=539

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 173/201 (86%), Gaps = 5/201 (2%)
 Frame = +1

Query  91   FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  255
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  15   FSASSPFLSRSQGRNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  74

Query  256  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  435
            TFPTLDPRT +VIAHVAEG+AEDINRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  75   TFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  134

Query  436  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  615
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  135  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  194

Query  616  EPIGVAGQIIPWNFPLAMFAW  678
            EPIGVAGQIIPWNFPL MFAW
Sbjct  195  EPIGVAGQIIPWNFPLLMFAW  215



>emb|CDY44985.1| BnaCnng12150D [Brassica napus]
Length=538

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 173/201 (86%), Gaps = 5/201 (2%)
 Frame = +1

Query  91   FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  255
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  14   FSASSPFLSRSQGRNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  73

Query  256  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  435
            TFPTLDPRT +VIAHVAEG+AED+NRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  74   TFPTLDPRTGEVIAHVAEGDAEDVNRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  133

Query  436  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  615
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  134  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  193

Query  616  EPIGVAGQIIPWNFPLAMFAW  678
            EPIGVAGQIIPWNFPL MFAW
Sbjct  194  EPIGVAGQIIPWNFPLLMFAW  214



>gb|KDO69715.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=394

 Score =   310 bits (795),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 169/200 (85%), Gaps = 4/200 (2%)
 Frame = +1

Query  91   FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  258
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  259  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  438
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  439  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  618
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  619  PIGVAGQIIPWNFPLAMFAW  678
            PIGVAGQI+PWNFPL +F W
Sbjct  195  PIGVAGQIVPWNFPLLLFTW  214



>gb|KDO69714.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=393

 Score =   310 bits (794),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 169/200 (85%), Gaps = 4/200 (2%)
 Frame = +1

Query  91   FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  258
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  259  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  438
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  439  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  618
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  619  PIGVAGQIIPWNFPLAMFAW  678
            PIGVAGQI+PWNFPL +F W
Sbjct  195  PIGVAGQIVPWNFPLLLFTW  214



>ref|XP_007031424.1| Aldehyde dehydrogenase 2B4 isoform 2, partial [Theobroma cacao]
 gb|EOY02350.1| Aldehyde dehydrogenase 2B4 isoform 2, partial [Theobroma cacao]
Length=405

 Score =   310 bits (795),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +1

Query  139  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            GI  FST+AA++E +SP++ + +TQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEG+A
Sbjct  11   GINSFSTSAAIDEPISPSILIDHTQLLINGQFVDAASGKTFPTLDPRTGDVIAHVAEGDA  70

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED+NRAVAAARKAFDEGPWPK++AYERSRIM +FADL+EKH +E+ATLETWDNGKPYEQA
Sbjct  71   EDVNRAVAAARKAFDEGPWPKLTAYERSRIMFRFADLLEKHTEEVATLETWDNGKPYEQA  130

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK E+P +VR+F YYAGWADKIHGLTVPADG HHVQTLHEP GV G IIPWNFPL +++W
Sbjct  131  AKIEIPKVVRMFRYYAGWADKIHGLTVPADGQHHVQTLHEPYGVTGLIIPWNFPLLLYSW  190



>ref|XP_003527026.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN19318.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=540

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG   G      RFSTAAAVE+L++P V + YT+H+ING+FVD+ASGKTFPT DPRT +V
Sbjct  28   LGRNSGKWGNFNRFSTAAAVEDLITPQVPITYTKHLINGQFVDAASGKTFPTYDPRTGEV  87

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IA VAEG+AEDINRAV+AARKAFDEGPWPK++AYER +I+L+FADLVEKH DELA LETW
Sbjct  88   IAQVAEGDAEDINRAVSAARKAFDEGPWPKLTAYERCKIILRFADLVEKHGDELAALETW  147

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            +NGKPYEQ+A +ELP  VRLF YYAGWADKIHGLTVPADG +HV+TLHEPIGVAGQIIPW
Sbjct  148  NNGKPYEQSATAELPTFVRLFRYYAGWADKIHGLTVPADGNYHVETLHEPIGVAGQIIPW  207

Query  652  NFPLAMFAW  678
            NFPL MFAW
Sbjct  208  NFPLLMFAW  216



>ref|XP_006404308.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
 dbj|BAJ34644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45761.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
Length=538

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  145  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            +RF T++A EE++SP+V+V +TQ +I+G FVD+ASGKTFPTLDPRT +VIAHVAEG+AED
Sbjct  37   RRFGTSSAAEEIISPSVQVSHTQLLIDGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAED  96

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            INRAV AARKAFDEGPWPKM+AYERSRIML+FADLVEKH ++LA+LE+WDNGK YEQA  
Sbjct  97   INRAVKAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHSEQLASLESWDNGKTYEQAKT  156

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            SE+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  157  SEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAW  214



>ref|XP_008781996.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Phoenix dactylifera]
Length=543

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + RFSTA AVEE ++P V+V+YTQ +ING+FVD+ASG+TFPTLDPRT +VIAHVAEG+ E
Sbjct  41   LHRFSTAVAVEEPITPPVQVQYTQLLINGQFVDAASGRTFPTLDPRTGEVIAHVAEGDVE  100

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D+NRAVAAARKAFD+GPWP+M+ YERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  101  DVNRAVAAARKAFDQGPWPRMTGYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  160

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM  RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AW
Sbjct  161  NVEIPMFARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMYAW  219



>gb|KDO69713.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=456

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 169/200 (85%), Gaps = 4/200 (2%)
 Frame = +1

Query  91   FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  258
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  259  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  438
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  439  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  618
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  619  PIGVAGQIIPWNFPLAMFAW  678
            PIGVAGQI+PWNFPL +F W
Sbjct  195  PIGVAGQIVPWNFPLLLFTW  214



>gb|KDP31120.1| hypothetical protein JCGZ_11496 [Jatropha curcas]
Length=541

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I RFSTA+  EE ++P V+++YTQ++INGKFVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  39   ICRFSTASVAEEPITPPVQIRYTQNLINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  98

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+RAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DELA LETW+NGKPYEQ+A
Sbjct  99   DIDRAVAAARKAFDEGPWPKMTPYERSRILLRFADLVEKHNDELAALETWNNGKPYEQSA  158

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            KSELPM+ RLF YYAGWADKIHGLTVP D  HH+Q LHEPIGVAGQIIPWNFPL +FAW
Sbjct  159  KSELPMLARLFRYYAGWADKIHGLTVPGDSNHHIQVLHEPIGVAGQIIPWNFPLILFAW  217



>ref|XP_009612265.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=536

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  36   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  95

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            NRAVAAARKAFDEGPWPKM+AYERS+I+L+ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  96   NRAVAAARKAFDEGPWPKMNAYERSKILLRLADLIEKHNDQIATLETWDTGKPYEQAAKI  155

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+W
Sbjct  156  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSW  212



>gb|EPS72983.1| mitochondrial benzaldehyde dehydrogenase, partial [Genlisea aurea]
Length=512

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  136  SGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  315
            +GI R+STAA +E+ + P V V+Y + +ING+FVD+ASGKTFPTLDPRT +VIAHVAEGE
Sbjct  8    NGIYRYSTAAVLEDPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGE  67

Query  316  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  495
            AEDINRAVA+ARKAFDEGPWP+++AYER RI+L+FADLVEK  DE+A LETWD+GKPYEQ
Sbjct  68   AEDINRAVASARKAFDEGPWPRLTAYERQRILLRFADLVEKSNDEIAALETWDSGKPYEQ  127

Query  496  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
            AA+ E+PM VRLF YYAGWADKIHG+T+PADGPHHVQTLHEPIGVAGQIIPWNFPL MFA
Sbjct  128  AAQIEVPMFVRLFRYYAGWADKIHGMTLPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFA  187

Query  676  W  678
            W
Sbjct  188  W  188



>ref|XP_011028588.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 168/199 (84%), Gaps = 4/199 (2%)
 Frame = +1

Query  94   PSASAFLGWKYG----VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTF  261
            PSAS  L    G       G+ RFS AAA+EE ++P V++ YT+ +ING+FVD+ASGKTF
Sbjct  17   PSASTPLLLSRGKNPITGRGVYRFSNAAALEETITPPVQISYTKLLINGQFVDAASGKTF  76

Query  262  PTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH  441
            PT DPRT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH
Sbjct  77   PTHDPRTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKH  136

Query  442  MDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEP  621
              ELA LE+W++GKPYEQ+AKSELP   RLF YYAGWADKIHGLTVPADG HHVQTLHEP
Sbjct  137  RGELAALESWNSGKPYEQSAKSELPSFARLFRYYAGWADKIHGLTVPADGNHHVQTLHEP  196

Query  622  IGVAGQIIPWNFPLAMFAW  678
            IGVAGQIIPWNFPL MFAW
Sbjct  197  IGVAGQIIPWNFPLIMFAW  215



>ref|XP_009391258.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA V
Sbjct  26   GSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIAQV  85

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            AEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDNGK  145

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            P+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPL  205

Query  664  AMFAW  678
             M+AW
Sbjct  206  LMYAW  210



>ref|XP_009391257.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +1

Query  121  KYGVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  297
            K G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA
Sbjct  29   KDGSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIA  88

Query  298  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  477
             VAEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDN
Sbjct  89   QVAEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDN  148

Query  478  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  657
            GKP+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  149  GKPFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  208

Query  658  PLAMFAW  678
            PL M+AW
Sbjct  209  PLLMYAW  215



>ref|XP_009759823.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=542

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  42   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  101

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            NRAVAAARKAFDEGPWPKM+AYERS+I+L+ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  102  NRAVAAARKAFDEGPWPKMNAYERSKILLRLADLIEKHNDQIATLETWDTGKPYEQAAKI  161

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+W
Sbjct  162  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSW  218



>ref|XP_009391256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   313 bits (801),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA V
Sbjct  33   GSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIAQV  92

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            AEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  93   AEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDNGK  152

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            P+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL
Sbjct  153  PFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPL  212

Query  664  AMFAW  678
             M+AW
Sbjct  213  LMYAW  217



>ref|XP_006290873.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
 gb|EOA23771.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
Length=537

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RF T++A EE+++P+V+V +TQ +I+G FVD+ASGKTFPTLDPRT +VIA VAEG+AE
Sbjct  35   LRRFGTSSAAEEIINPSVQVSHTQLLIDGNFVDAASGKTFPTLDPRTGEVIAQVAEGDAE  94

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAW  213



>ref|XP_010477684.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   312 bits (799),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G+  GIQR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGIQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERS+I+ + ADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRLADLIEKHNDEIAALETWDNGK  145

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            P+EQ+AK E+PMIVR+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQSAKIEVPMIVRVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  664  AMFAW  678
             M +W
Sbjct  206  LMLSW  210



>ref|XP_010460154.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Camelina sativa]
Length=534

 Score =   311 bits (798),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G+  G+QR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGVQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDEIAALETWDNGK  145

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            P+EQAA+ E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQAAQIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  664  AMFAW  678
             M +W
Sbjct  206  LMLSW  210



>ref|XP_007031423.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
 gb|EOY02349.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
Length=511

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +1

Query  139  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            GI  FST+AA++E +SP++ + +TQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEG+A
Sbjct  8    GINSFSTSAAIDEPISPSILIDHTQLLINGQFVDAASGKTFPTLDPRTGDVIAHVAEGDA  67

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED+NRAVAAARKAFDEGPWPK++AYERSRIM +FADL+EKH +E+ATLETWDNGKPYEQA
Sbjct  68   EDVNRAVAAARKAFDEGPWPKLTAYERSRIMFRFADLLEKHTEEVATLETWDNGKPYEQA  127

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK E+P +VR+F YYAGWADKIHGLTVPADG HHVQTLHEP GV G IIPWNFPL +++W
Sbjct  128  AKIEIPKVVRMFRYYAGWADKIHGLTVPADGQHHVQTLHEPYGVTGLIIPWNFPLLLYSW  187



>ref|XP_006844236.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
 gb|ERN05911.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
Length=501

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +1

Query  151  FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN  330
            FS+A A EE ++P V+V+YTQ +I GK+VDSASGKTFPTLDPRT +VIAHVAEG+AEDIN
Sbjct  2    FSSAVAAEEPITPPVQVEYTQLLIGGKYVDSASGKTFPTLDPRTGEVIAHVAEGDAEDIN  61

Query  331  RAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE  510
            RAV+AARKAFD+GPWP+M+AYERSRI+ +FADLVEKH DELA LETWDNGKPYEQA+ +E
Sbjct  62   RAVSAARKAFDDGPWPRMTAYERSRILYRFADLVEKHNDELAALETWDNGKPYEQASLAE  121

Query  511  LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            +PM VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AW
Sbjct  122  IPMFVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMYAW  177



>emb|CAA71003.1| aldehyde dehydrogenase (NAD+) [Nicotiana tabacum]
Length=542

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  42   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  101

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            NRAVAAARKAFDEGPWPKM+AYERS+I ++ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  102  NRAVAAARKAFDEGPWPKMNAYERSKIFVRLADLIEKHNDQIATLETWDTGKPYEQAAKI  161

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+W
Sbjct  162  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSW  218



>ref|XP_004238676.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=529

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            ++STAAA EE V P V V +T+ +ING+FVDSASGKTFPTLDPRT +VIAH+AEG+AEDI
Sbjct  29   KYSTAAAFEEPVKPTVNVDHTKLLINGQFVDSASGKTFPTLDPRTGEVIAHIAEGDAEDI  88

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            NRAVAAARKAFDEGPWP+M+AYERS+I+L+ ADL+EKH D++ATLETWD GKPY QAAK 
Sbjct  89   NRAVAAARKAFDEGPWPRMTAYERSKILLRLADLIEKHNDQIATLETWDTGKPYAQAAKI  148

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+W
Sbjct  149  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSW  205



>ref|XP_006439784.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53024.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=538

 Score =   310 bits (795),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 169/200 (85%), Gaps = 4/200 (2%)
 Frame = +1

Query  91   FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  258
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  259  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  438
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  439  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  618
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  619  PIGVAGQIIPWNFPLAMFAW  678
            PIGVAGQI+PWNFPL +F W
Sbjct  195  PIGVAGQIVPWNFPLLLFTW  214



>ref|XP_006656871.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=549

 Score =   310 bits (795),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRFSTAAA EE +SP  +V+  Q +I GKFVDSASGKTF TLDPRT +VIAHV+EG+AE
Sbjct  47   LQRFSTAAAAEEPISPPFQVQDKQLLIGGKFVDSASGKTFSTLDPRTGEVIAHVSEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV+AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DELA LETWDNGKPY QAA
Sbjct  107  DINRAVSAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYAQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  225



>gb|KHG27537.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +1

Query  151  FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN  330
            ++TAAA+E+  +P+++V YT+ +ING FVDSASGKTFPT DPRT DVIAHVAEG+AEDIN
Sbjct  32   YTTAAALEKPFTPSIKVNYTKLLINGNFVDSASGKTFPTYDPRTGDVIAHVAEGDAEDIN  91

Query  331  RAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE  510
            RAV+AARKAFDEGPWPKM+AYERSRI+ +FADL+++H +ELATLETWDNGKPYEQAAK E
Sbjct  92   RAVSAARKAFDEGPWPKMTAYERSRILFRFADLIDQHTEELATLETWDNGKPYEQAAKIE  151

Query  511  LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            LPMI RL  YYAGWADKIHGLTVPAD PH VQT+HEPIGVAGQIIPWNFPL MFAW
Sbjct  152  LPMISRLIRYYAGWADKIHGLTVPADSPHLVQTIHEPIGVAGQIIPWNFPLLMFAW  207



>ref|XP_011463376.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=531

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = +1

Query  109  FLGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  285
             LG    V  GI ++STAAA VE+ ++P V V +T+ +ING+FVD+ASGKTFPTLDPRT 
Sbjct  17   LLGRSSSVSRGIGKYSTAAAAVEDPITPPVIVGHTKLLINGQFVDAASGKTFPTLDPRTG  76

Query  286  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  465
            DVIAHVAEG+AED+NRAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EK  DELA LE
Sbjct  77   DVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKQNDELAALE  136

Query  466  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  645
            TWDNGKP+EQ+AK E+PM  R F YYAG+ADKIHGLTVPADGP+HVQTLHEPIGVAGQII
Sbjct  137  TWDNGKPFEQSAKIEVPMFARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPIGVAGQII  196

Query  646  PWNFPLAMFAW  678
            PWNFPL MFAW
Sbjct  197  PWNFPLLMFAW  207



>gb|KJB50197.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=531

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = +1

Query  133  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  312
             S +  ++TAAA+E+ ++P++ V YT+ +ING FVDSASGKTFPT DPRT DVIAHVAEG
Sbjct  26   RSVVCSYTTAAALEKPITPSINVNYTKLLINGNFVDSASGKTFPTYDPRTGDVIAHVAEG  85

Query  313  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  492
            +AEDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+++H +ELATLETWDNGKPYE
Sbjct  86   DAEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIDQHTEELATLETWDNGKPYE  145

Query  493  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  672
            QAAK ELPMI RL  YYAGWADKIHGLTVPAD PH VQT+HEPIGVAGQIIPWNFP+ MF
Sbjct  146  QAAKIELPMISRLIRYYAGWADKIHGLTVPADSPHLVQTIHEPIGVAGQIIPWNFPVLMF  205

Query  673  AW  678
            AW
Sbjct  206  AW  207



>gb|ABK92547.1| unknown [Populus trichocarpa]
Length=432

 Score =   306 bits (785),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ E
Sbjct  34   IYRFITAKALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDNE  93

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+A
Sbjct  94   DVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQSA  153

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            KSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNFPL M AW
Sbjct  154  KSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNFPLIMLAW  212



>ref|XP_003517756.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN12100.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=538

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            +FSTAAA+EE + P V+V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  38   KFSTAAAIEEPIKPPVKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  97

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH DELA LETWDNGKPYEQ+A+ 
Sbjct  98   DRAVAAARKAFDHGPWPKMTAYERQRILLRAADLFEKHNDELAALETWDNGKPYEQSAQI  157

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  158  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAW  214



>ref|XP_011044320.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=538

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = +1

Query  139  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            GI RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ 
Sbjct  35   GIYRFITATALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDT  94

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+
Sbjct  95   EDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQS  154

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AKSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNFPL M AW
Sbjct  155  AKSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNFPLIMLAW  214



>ref|XP_006355977.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=529

 Score =   309 bits (792),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            ++STAAA+EE + P V V +T+  ING+FVDSASGKTFPTLDPRT +VIAH+AEG+AEDI
Sbjct  29   KYSTAAALEEPIKPTVNVDHTKLFINGQFVDSASGKTFPTLDPRTGEVIAHIAEGDAEDI  88

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            NRAVAAARKAFDEGPWP+M+AYERS+I+L+ ADL+EKH D++ATLETWD GKPY QAAK 
Sbjct  89   NRAVAAARKAFDEGPWPRMTAYERSKILLRLADLIEKHNDQIATLETWDTGKPYAQAAKI  148

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+W
Sbjct  149  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSW  205



>gb|KCW86739.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I+ +STAAA+EE ++P V V +TQ  ING++VDSASGKTFPT DPRT +VIAHVAEGEAE
Sbjct  42   IKSYSTAAAIEEPINPGVTVNHTQLFINGQYVDSASGKTFPTFDPRTGEVIAHVAEGEAE  101

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWP+M+AYER+ ++ +FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  102  DINRAVAAARKAFDEGPWPRMTAYERANVLFRFADLLEKHNDEIAALETWDNGKPYEQAA  161

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K ELPMIVR   YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL M+AW
Sbjct  162  KIELPMIVRQIRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNFPLLMYAW  220



>ref|XP_010044646.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW86738.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I+ +STAAA+EE ++P V V +TQ  ING++VDSASGKTFPT DPRT +VIAHVAEGEAE
Sbjct  42   IKSYSTAAAIEEPINPGVTVNHTQLFINGQYVDSASGKTFPTFDPRTGEVIAHVAEGEAE  101

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAVAAARKAFDEGPWP+M+AYER+ ++ +FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  102  DINRAVAAARKAFDEGPWPRMTAYERANVLFRFADLLEKHNDEIAALETWDNGKPYEQAA  161

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K ELPMIVR   YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL M+AW
Sbjct  162  KIELPMIVRQIRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNFPLLMYAW  220



>ref|XP_002301540.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE80813.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
Length=540

 Score =   309 bits (792),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            I R++T  AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ 
Sbjct  37   ISRYNTTLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDV  96

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED+NRAV+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKPYEQ+
Sbjct  97   EDVNRAVSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPYEQS  156

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK E+PM VR+F YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFP+ MF+W
Sbjct  157  AKIEIPMTVRIFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPMLMFSW  216



>ref|XP_010498885.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G+  G+QR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGVQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWD GK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDEIAALETWDCGK  145

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            P+EQ+AK E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQSAKIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  664  AMFAW  678
             M +W
Sbjct  206  LMLSW  210



>gb|ACM89738.1| mitochondrial benzaldehyde dehydrogenase [Antirrhinum majus]
Length=534

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 160/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  139  GIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  312
            G+ R+ TAAA  +EE + P V V+Y + +ING+FVD+ASGKTFPTLDPR+ +VIAHVAEG
Sbjct  29   GVYRYGTAAAAALEEPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRSGEVIAHVAEG  88

Query  313  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  492
            +AEDINRAVAAARKAFDEGPWPKM AYER +IML+FADLVEKH DE+A LE WD+GKPYE
Sbjct  89   DAEDINRAVAAARKAFDEGPWPKMPAYERQKIMLRFADLVEKHNDEVAALEAWDSGKPYE  148

Query  493  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  672
            Q A+ E+PM VRLF YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNFPL MF
Sbjct  149  QCAQVEIPMFVRLFRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNFPLVMF  208

Query  673  AW  678
             W
Sbjct  209  GW  210



>ref|XP_006476755.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Citrus sinensis]
Length=538

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 169/200 (85%), Gaps = 4/200 (2%)
 Frame = +1

Query  91   FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  258
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  259  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  438
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  439  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  618
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  619  PIGVAGQIIPWNFPLAMFAW  678
            PIGVAGQI+PWNFP+ +F W
Sbjct  195  PIGVAGQIVPWNFPVLLFTW  214



>ref|XP_004297641.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=535

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 164/184 (89%), Gaps = 1/184 (1%)
 Frame = +1

Query  130  VESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            V  GI ++STAAA VE+ ++P V V +T+ +ING+FVD+ASGKTFPTLDPRT DVIAHVA
Sbjct  28   VSRGIGKYSTAAAAVEDPITPPVIVGHTKLLINGQFVDAASGKTFPTLDPRTGDVIAHVA  87

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  486
            EG+AED+NRAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EK  DELA LETWDNGKP
Sbjct  88   EGDAEDVNRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKQNDELAALETWDNGKP  147

Query  487  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  666
            +EQ+AK E+PM  R F YYAG+ADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL 
Sbjct  148  FEQSAKIEVPMFARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLL  207

Query  667  MFAW  678
            MFAW
Sbjct  208  MFAW  211



>gb|KHN00347.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=539

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            +FSTAAA+EE + P ++V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  39   KFSTAAAIEEPIKPPIKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  98

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH D+LA LETWDNGKPYEQ+A+ 
Sbjct  99   DRAVAAARKAFDRGPWPKMTAYERQRILLRAADLFEKHNDDLAALETWDNGKPYEQSAQI  158

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  159  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAW  215



>gb|AFK49345.1| unknown [Medicago truncatula]
Length=272

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = +1

Query  148  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  217



>ref|XP_010551563.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=540

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 168/199 (84%), Gaps = 4/199 (2%)
 Frame = +1

Query  94   PSASAFLGWKYGVESGIQRFSTAAA----VEELVSPAVEVKYTQHIINGKFVDSASGKTF  261
            PS  +  G    V  G+ R+STAAA    +E  +SP V+V+ TQ +I+GKFVDSASGKTF
Sbjct  18   PSLLSLGGKSPHVSRGVHRYSTAAAAAAALEVPISPPVKVELTQLLIDGKFVDSASGKTF  77

Query  262  PTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH  441
            PTLDPRT DVIAHVAEG+ ED+NRAV+AAR AFDEGPWP+M+AYERS+I+L+ ADLVEKH
Sbjct  78   PTLDPRTGDVIAHVAEGDVEDVNRAVSAARMAFDEGPWPRMTAYERSKILLRCADLVEKH  137

Query  442  MDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEP  621
             DE+A LETWDNGKPY+QAAK E+PM+ RLF YYAGWADKIHGLTVPADGPHHVQTLHEP
Sbjct  138  NDEIAALETWDNGKPYDQAAKVEVPMLTRLFRYYAGWADKIHGLTVPADGPHHVQTLHEP  197

Query  622  IGVAGQIIPWNFPLAMFAW  678
            IGVAGQIIPWNFPL M AW
Sbjct  198  IGVAGQIIPWNFPLLMLAW  216



>ref|XP_010653335.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI32132.3| unnamed protein product [Vitis vinifera]
 gb|AFY12671.1| mitochondrial aldehyde dehydrogenase 2B8 [Vitis quinquangularis]
Length=538

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            +G       GI R+STAA VEE ++P+V V YTQ +ING+FVD+A+GKTF TLDPRT +V
Sbjct  26   IGRNSSRRGGIFRYSTAAVVEEPINPSVNVNYTQLLINGQFVDAATGKTFETLDPRTGNV  85

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IA VAEG+AED+NRAV+AARKAFDEGPWP+MS YERS+I+L+FADL+EKH DE+A LETW
Sbjct  86   IASVAEGDAEDVNRAVSAARKAFDEGPWPRMSPYERSKILLRFADLLEKHNDEIAALETW  145

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            DNGKP+EQAAK+E+P+++RL  YYAGWADKIHGLTVPADG H VQTLHEPIGVAGQIIPW
Sbjct  146  DNGKPFEQAAKAEVPLVIRLMRYYAGWADKIHGLTVPADGLHQVQTLHEPIGVAGQIIPW  205

Query  652  NFPLAMFAW  678
            NFPL M+AW
Sbjct  206  NFPLLMYAW  214



>ref|XP_010029207.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            +G   G   GI  +S+++ V+E V+P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DV
Sbjct  20   IGRSRGWTRGIGSYSSSSVVDEPVTPSVKITDTQLLINGKFVDAASGKTFPTLDPRTGDV  79

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            I HVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH+D+LA +ETW
Sbjct  80   ITHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLLEKHIDDLAAIETW  139

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            DNGKPY+QAA+ E+P  +RL  YYAGWADKIHGLTVP DG +HVQTLHEPIGVAGQIIPW
Sbjct  140  DNGKPYKQAAEDEIPGFIRLMRYYAGWADKIHGLTVPVDGKYHVQTLHEPIGVAGQIIPW  199

Query  652  NFPLAMFAW  678
            NFPL MFAW
Sbjct  200  NFPLLMFAW  208



>gb|KFK34098.1| hypothetical protein AALP_AA5G101700 [Arabis alpina]
Length=540

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 162/181 (90%), Gaps = 2/181 (1%)
 Frame = +1

Query  142  IQRF--STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  315
            ++RF  S++A  EE++SP+V+V YT+ +I+G FVDSASGKTFPTLDPRT +VIA VAEG+
Sbjct  36   VRRFGSSSSAVAEEIISPSVQVSYTKLLIDGNFVDSASGKTFPTLDPRTGEVIADVAEGD  95

Query  316  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  495
            AEDINRAV AARKAFDEGPWP+MSAYERSRIML+FADLVEKH +ELA+LE+WDNGKPY Q
Sbjct  96   AEDINRAVKAARKAFDEGPWPRMSAYERSRIMLRFADLVEKHSEELASLESWDNGKPYSQ  155

Query  496  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
            +  +E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFA
Sbjct  156  SKGTEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFA  215

Query  676  W  678
            W
Sbjct  216  W  216



>ref|XP_003519638.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
Length=539

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            +FSTAAA+EE + P ++V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  39   KFSTAAAIEEPIKPPLKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  98

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH D+LA LETWDNGKPYEQ+A+ 
Sbjct  99   DRAVAAARKAFDRGPWPKMTAYERQRILLRAADLFEKHNDDLAALETWDNGKPYEQSAQI  158

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  159  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAW  215



>gb|KCW56067.1| hypothetical protein EUGRSUZ_I01824, partial [Eucalyptus grandis]
Length=511

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 165/188 (88%), Gaps = 4/188 (2%)
 Frame = +1

Query  115  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  294
            GW  G+ S    +S+++ V+E V+P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DVI
Sbjct  4    GWTRGIGS----YSSSSVVDEPVTPSVKITDTQLLINGKFVDAASGKTFPTLDPRTGDVI  59

Query  295  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  474
             HVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH+D+LA +ETWD
Sbjct  60   THVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLLEKHIDDLAAIETWD  119

Query  475  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  654
            NGKPY+QAA+ E+P  +RL  YYAGWADKIHGLTVP DG +HVQTLHEPIGVAGQIIPWN
Sbjct  120  NGKPYKQAAEDEIPGFIRLMRYYAGWADKIHGLTVPVDGKYHVQTLHEPIGVAGQIIPWN  179

Query  655  FPLAMFAW  678
            FPL MFAW
Sbjct  180  FPLLMFAW  187



>ref|XP_002274863.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Vitis vinifera]
 emb|CBI34947.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = +1

Query  139  GIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  315
            G  RFSTA A EE  ++P V++ YTQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEGE
Sbjct  31   GSSRFSTAVATEEEPITPPVQIDYTQLLINGRFVDAASGKTFPTLDPRTGDVIAHVAEGE  90

Query  316  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  495
            AEDINRAV+AARKAFDEGPWPKM+ YERS I+ +FADL+EKH  E+A LE+WDNGKPYEQ
Sbjct  91   AEDINRAVSAARKAFDEGPWPKMTPYERSCILFRFADLLEKHCSEIAALESWDNGKPYEQ  150

Query  496  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
            AA  E+PM++R+F YYAGWADKIHGLTVPADG HHVQTLHEPIGVAGQIIPWNFPL ++ 
Sbjct  151  AANVEIPMVIRVFRYYAGWADKIHGLTVPADGLHHVQTLHEPIGVAGQIIPWNFPLLLYG  210

Query  676  W  678
            W
Sbjct  211  W  211



>gb|KDO82494.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=392

 Score =   302 bits (774),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  172  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  222



>ref|XP_011086550.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Sesamum indicum]
Length=532

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = +1

Query  130  VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  309
            V  GI R+STAAA E+ + P V V+Y + +ING+FVD+ASGKTFPTLDPRT +VIAHVAE
Sbjct  26   VGRGIYRYSTAAAHEDPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRTGEVIAHVAE  85

Query  310  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  489
            G+AEDINRAVAAARKAFDEGPWPKM+AYER RI+L+FADLVEKH D++A LETWD+GK Y
Sbjct  86   GDAEDINRAVAAARKAFDEGPWPKMTAYERQRILLRFADLVEKHNDDIAALETWDSGKLY  145

Query  490  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAM  669
            EQ A+ E+PM VRLF YYAGWADKIHGLT+PADG  HVQTLHEPIGVAGQIIPWNFPL M
Sbjct  146  EQCAQIEVPMFVRLFRYYAGWADKIHGLTIPADGALHVQTLHEPIGVAGQIIPWNFPLVM  205

Query  670  FAW  678
            FAW
Sbjct  206  FAW  208



>dbj|BAB62757.1| mitochondrial aldehyde dehydrogenase ALDH2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ90704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPTLDPRT +VIA V+EG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTLDPRTGEVIARVSEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D++RAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  107  DVDRAVVAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ W
Sbjct  167  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGW  225



>ref|XP_002318034.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEE96254.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=536

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ E
Sbjct  34   IYRFITAKALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDNE  93

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+A
Sbjct  94   DVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQSA  153

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            KSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNFPL M AW
Sbjct  154  KSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNFPLIMLAW  212



>ref|XP_004509834.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=539

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            + ++STAAAVEE  + P V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG A
Sbjct  36   LSKYSTAAAVEEQPIKPTVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHA  95

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED++RAVAAAR+AFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKP+EQ+
Sbjct  96   EDVDRAVAAARQAFDHGPWPKMTAYERQRILLRAADLIEKHNDELAALETWDNGKPFEQS  155

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK+E+PM+VRL  YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNFPL MF W
Sbjct  156  AKTEVPMLVRLIRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFGW  215



>ref|XP_004509835.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=538

 Score =   307 bits (786),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            + ++STAAAVEE  + P V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG A
Sbjct  35   LSKYSTAAAVEEQPIKPTVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHA  94

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED++RAVAAAR+AFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKP+EQ+
Sbjct  95   EDVDRAVAAARQAFDHGPWPKMTAYERQRILLRAADLIEKHNDELAALETWDNGKPFEQS  154

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK+E+PM+VRL  YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNFPL MF W
Sbjct  155  AKTEVPMLVRLIRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFGW  214



>gb|AAL77004.1| aldehyde dehydrogenase [Allium cepa]
Length=282

 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = +1

Query  136  SGIQRF-STAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  309
            S IQ F STAAAVEE  ++P V+V+YTQ +INGK+VDSASGKTFP+LDPRT +VIAHV+E
Sbjct  30   SRIQNFGSTAAAVEEQPITPPVKVEYTQLLINGKYVDSASGKTFPSLDPRTGEVIAHVSE  89

Query  310  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  489
            G+AEDI+RAVAAARKAFDEGPW KM+AYERS I+L+FADL+EKH D +A LETWDNGKPY
Sbjct  90   GDAEDIDRAVAAARKAFDEGPWLKMTAYERSNILLRFADLIEKHNDHIAALETWDNGKPY  149

Query  490  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAM  669
            EQAA  E+PM+VRL  YYAGW DKIHGL  PADGPHHVQ L+EPIGVAGQIIPWNFPL M
Sbjct  150  EQAALVEIPMLVRLMRYYAGWTDKIHGLIXPADGPHHVQVLYEPIGVAGQIIPWNFPLLM  209

Query  670  FAW  678
            FAW
Sbjct  210  FAW  212



>ref|NP_190383.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
 sp|Q9SU63.1|AL2B4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B4, mitochondrial; 
Short=ALDH2a; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG42016.1|AF327426_1 putative (NAD+) aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAK15569.1|AF349522_1 putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAK49627.1|AF372911_1 AT3g48000/T17F15_130 [Arabidopsis thaliana]
 emb|CAB41139.1| aldehyde dehydrogenase (NAD+)-like protein [Arabidopsis thaliana]
 dbj|BAA96792.1| aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAL91287.1| AT3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AAM27003.1| aldehyde dehydrogenase ALDH2a [Arabidopsis thaliana]
 gb|AAN31892.1| putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAP21179.1| At3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AEE78355.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
Length=538

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            ++RF T+ AA EE+++P+V+V +TQ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+A
Sbjct  35   LRRFGTSSAAAEEIINPSVQVSHTQLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDA  94

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            EDINRAV AAR AFDEGPWPKMSAYERSR++L+FADLVEKH +ELA+LETWDNGKPY+Q+
Sbjct  95   EDINRAVKAARTAFDEGPWPKMSAYERSRVLLRFADLVEKHSEELASLETWDNGKPYQQS  154

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              +E+PM  RLF YYAGWADKIHGLT+PADG + V TLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  LTAEIPMFARLFRYYAGWADKIHGLTIPADGNYQVHTLHEPIGVAGQIIPWNFPLLMFAW  214



>ref|XP_009399660.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=542

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 165/196 (84%), Gaps = 2/196 (1%)
 Frame = +1

Query  97   SASAFLGWK-YGVESGIQR-FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  270
            S S F G + +G  SG+ R FSTA A+EE + P V+V +TQ +ING+FVDSASG+TFPTL
Sbjct  23   SRSVFGGDRIHGSASGVLRGFSTATAIEEPIQPPVQVNHTQLLINGQFVDSASGRTFPTL  82

Query  271  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  450
            DPRT ++IAHVAEG+ ED+NRAV AARKAFDEGPWPKM+ Y+RS I+ +FADL+EKH DE
Sbjct  83   DPRTGELIAHVAEGDVEDVNRAVVAARKAFDEGPWPKMTGYQRSCILYRFADLIEKHNDE  142

Query  451  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  630
            +A LETWDNGKPYEQAAK+E+P + RL  YYAGWADKIHGL VPAD PHHVQ LHEPIGV
Sbjct  143  IAALETWDNGKPYEQAAKAEIPTLARLMRYYAGWADKIHGLIVPADSPHHVQVLHEPIGV  202

Query  631  AGQIIPWNFPLAMFAW  678
            AGQIIPWNFPL MFAW
Sbjct  203  AGQIIPWNFPLLMFAW  218



>ref|XP_010552639.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=533

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            I R+STAAA + E + P V+V+YT  +I+GKFVD+ASGKTF TLDPRT +VI+HVAEG++
Sbjct  30   ISRYSTAAAALGEPIPPPVKVEYTHLLIDGKFVDAASGKTFTTLDPRTGEVISHVAEGDS  89

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADL+EKH DE+A LETWDNGKPYEQ+
Sbjct  90   EDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLIEKHNDEIAALETWDNGKPYEQS  149

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK E+PM+ RLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL M AW
Sbjct  150  AKIEVPMLARLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLLMLAW  209



>ref|XP_010477682.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G+  GIQR+S  AA +E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGIQRYSNFAADLENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            AEG+ ED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DELA LE+WD GK
Sbjct  86   AEGDVEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDELAALESWDCGK  145

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            P+EQ+AK E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQSAKIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  664  AMFAW  678
             M +W
Sbjct  206  LMLSW  210



>ref|XP_003552014.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN39739.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 169/195 (87%), Gaps = 7/195 (4%)
 Frame = +1

Query  97   SASAFLGWKYGVESGIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLD  273
              + FLG ++       ++ST++A+EE  V P+V+V++TQ +I+GKFVD+ASGKTFPTLD
Sbjct  24   GGNGFLGSRH------CKYSTSSAIEEEPVKPSVQVEHTQLLIDGKFVDAASGKTFPTLD  77

Query  274  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  453
            PRT +VIAHVAEG +ED++RAVAAARKAFD GPWPKM+AYER RI+L+ ADL+EKH DEL
Sbjct  78   PRTGEVIAHVAEGHSEDVDRAVAAARKAFDHGPWPKMTAYERQRILLRAADLLEKHNDEL  137

Query  454  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  633
            A LETWDNGKPYEQAAK E+PM+VRL  YYAGWADKIHGLTVPADGP+HVQTLHEPIGVA
Sbjct  138  AALETWDNGKPYEQAAKIEVPMLVRLIRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVA  197

Query  634  GQIIPWNFPLAMFAW  678
            GQIIPWNFPL MFAW
Sbjct  198  GQIIPWNFPLLMFAW  212



>gb|KJB31274.1| hypothetical protein B456_005G183300 [Gossypium raimondii]
Length=509

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  127  GVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            GV   +  +ST+A +E  ++P+++V  TQ +ING FVDSASGKTFPT DPRT +VIAHVA
Sbjct  27   GVGRVVSGYSTSAGIENPINPSIKVHCTQLLINGNFVDSASGKTFPTYDPRTGNVIAHVA  86

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  486
            EG+AEDI+RAV AARKAFDEGPWPKM+AYERS+++ +FADL++KH++ELATLETWDNGKP
Sbjct  87   EGDAEDIDRAVCAARKAFDEGPWPKMTAYERSKVLFRFADLLDKHIEELATLETWDNGKP  146

Query  487  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  666
            YEQ+AK ELPMI R+  YYAGWADKIHGLT+PADGPH VQT+HEPIGVAGQIIPWNFPL 
Sbjct  147  YEQSAKIELPMISRIIRYYAGWADKIHGLTIPADGPHLVQTIHEPIGVAGQIIPWNFPLL  206

Query  667  MFAW  678
            MFAW
Sbjct  207  MFAW  210



>gb|KDO82493.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=459

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  172  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  222



>ref|XP_010682577.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + ++ST AA+EE + P V+VKY+Q +INGKFVDSASGK F T DPRT +VIA V+EG+AE
Sbjct  33   VCKYSTTAAIEEPIIPPVKVKYSQLLINGKFVDSASGKKFKTCDPRTGNVIAEVSEGDAE  92

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+RAVAAARKAFDEGPWPKM+AYERS+I+LKFADL+E+H DE+A LETWDNGKPYEQAA
Sbjct  93   DIDRAVAAARKAFDEGPWPKMTAYERSQILLKFADLLEQHTDEIAALETWDNGKPYEQAA  152

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K ELPM VR+  YYAGW+DKIHGLT PADGP HVQTLHEPIGVAGQIIPWNFPL MF W
Sbjct  153  KIELPMCVRIMRYYAGWSDKIHGLTAPADGPFHVQTLHEPIGVAGQIIPWNFPLLMFVW  211



>gb|KDO82492.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=456

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  172  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  222



>gb|EYU31278.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
 gb|EYU31279.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
Length=533

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = +1

Query  139  GIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  315
            GI R++TAAA +EE + P V VKY + +ING+FVD+ASGKTFPTLDPRT +VI HV EG+
Sbjct  29   GIFRYTTAAAALEEPIKPPVNVKYDKLLINGQFVDAASGKTFPTLDPRTGEVITHVPEGD  88

Query  316  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  495
            AEDINRAV+AARKAFDEGPWPKM+AYER RI+L+FADLVEKH DE+A LETWD+GK +EQ
Sbjct  89   AEDINRAVSAARKAFDEGPWPKMTAYERQRILLRFADLVEKHNDEIAALETWDSGKLFEQ  148

Query  496  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
             AK E+PM VRLF YYAGW DKIHG+T+P DGPHHVQTLHEPIGV GQIIPWNFPL MFA
Sbjct  149  CAKIEVPMFVRLFRYYAGWTDKIHGMTIPGDGPHHVQTLHEPIGVCGQIIPWNFPLVMFA  208

Query  676  W  678
            W
Sbjct  209  W  209



>dbj|BAB92017.1| mitochondrial aldehyde dehydrogenase [Secale cereale]
Length=549

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPTLDPRT +VIA V+EG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVSETQLLINGKFVDAASGKTFPTLDPRTGEVIARVSEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D++RAV AARKAFD GPWPKM+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  107  DVDRAVIAARKAFDHGPWPKMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            + E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ W
Sbjct  167  QIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGW  225



>gb|KEH35052.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=431

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  652  NFPLAMFAW  678
            NFP+ +FAW
Sbjct  210  NFPILLFAW  218



>gb|EMT04899.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=549

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPT+DPRT +VIA VAEG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTVDPRTGEVIARVAEGDAE  106

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D++RAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  107  DVDRAVVAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  166

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ W
Sbjct  167  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGW  225



>ref|XP_011003158.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Populus euphratica]
Length=540

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRF-STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            I R+ S  AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ 
Sbjct  37   ICRYNSNLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDV  96

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED+NRAV+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKP+EQA
Sbjct  97   EDVNRAVSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPFEQA  156

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK E+PM VR+F YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFP+ MF+W
Sbjct  157  AKIEIPMTVRIFRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNFPMLMFSW  216



>gb|KEH35053.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=446

 Score =   301 bits (772),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  652  NFPLAMFAW  678
            NFP+ +FAW
Sbjct  210  NFPILLFAW  218



>gb|EMS51754.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Triticum 
urartu]
Length=550

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPT+DPRT +VIA VAEG+AE
Sbjct  48   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTVDPRTGEVIARVAEGDAE  107

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D++RAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  108  DVDRAVVAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  167

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ W
Sbjct  168  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGW  226



>gb|ABK24267.1| unknown [Picea sitchensis]
Length=544

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = +1

Query  139  GIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  315
            GI+R  TAA A+EE ++P V+VK+TQ +I+G+FV++ASGKTFPT DPRT DVIA+VAEG+
Sbjct  40   GIRRLGTAASALEEPIAPPVQVKHTQLLIDGQFVNAASGKTFPTFDPRTGDVIANVAEGD  99

Query  316  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  495
            A D+NRAV AARKAFD GPWPKM+AYERS IML+FADL+EKH DE+A LETWDNGKPYEQ
Sbjct  100  APDVNRAVKAARKAFDVGPWPKMTAYERSCIMLRFADLLEKHNDEIAALETWDNGKPYEQ  159

Query  496  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
            A+  E+PM VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFA
Sbjct  160  ASLVEVPMAVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFA  219

Query  676  W  678
            W
Sbjct  220  W  220



>gb|KEH35051.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=456

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  652  NFPLAMFAW  678
            NFP+ +FAW
Sbjct  210  NFPILLFAW  218



>ref|XP_003532011.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN10599.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 167/195 (86%), Gaps = 7/195 (4%)
 Frame = +1

Query  97   SASAFLGWKYGVESGIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLD  273
              + FLG +        +FST+AA+EE  + P+++V++TQ +I+GKFVD+ASGKTF TLD
Sbjct  24   GGNGFLGSRQ------SKFSTSAAIEEEPIKPSIQVEHTQLLIDGKFVDAASGKTFQTLD  77

Query  274  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  453
            PRT +VIAHVAEG +ED++RAV+AARKAFD GPWPKM+AYER RI+L+ ADL+EKH DEL
Sbjct  78   PRTGEVIAHVAEGHSEDVDRAVSAARKAFDHGPWPKMTAYERQRILLRVADLIEKHNDEL  137

Query  454  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  633
            A LETWDNGKPYEQAAK E+PM+VRL  YYAGWADKIHGLTVPADGP+HVQTLHEPIGVA
Sbjct  138  AALETWDNGKPYEQAAKIEVPMLVRLIRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVA  197

Query  634  GQIIPWNFPLAMFAW  678
            GQIIPWNFPL MFAW
Sbjct  198  GQIIPWNFPLLMFAW  212



>gb|KJB11462.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=374

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            I  FSTAAA ++E + P++++ +TQ +ING+F+D+ASG+TFPT+DPRT DVIA VAEG+ 
Sbjct  27   INSFSTAAAAIDEPIHPSIQIDHTQLLINGQFIDAASGRTFPTIDPRTGDVIARVAEGDL  86

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            EDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH  E+A LETWDNGKPYEQA
Sbjct  87   EDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTGEVAKLETWDNGKPYEQA  146

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNFPL +++W
Sbjct  147  AKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNFPLLLYSW  206



>ref|NP_564204.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
 sp|Q8S528.2|AL2B7_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B7, mitochondrial; 
Short=ALDH2b; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59643.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM44960.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE30433.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
Length=534

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G+  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            +EG+AED+NRAVAAARKAFDEGPWPKM+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   SEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            PYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  664  AMFAW  678
             M +W
Sbjct  206  LMLSW  210



>gb|AAL99612.1|AF348416_1 mitochondrial aldehyde dehydrogenase [Arabidopsis thaliana]
Length=534

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G+  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            +EG+AED+NRAVAAARKAFDEGPWPKM+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   SEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            PYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  664  AMFAW  678
             M +W
Sbjct  206  LMLSW  210



>ref|XP_006438422.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
 ref|XP_006483828.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Citrus sinensis]
 gb|ESR51662.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
Length=546

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  172  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  222



>gb|KDO82485.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=546

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  172  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  222



>gb|KEH19981.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=509

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = +1

Query  148  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  217



>ref|XP_002893307.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69566.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   302 bits (773),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +1

Query  127  GVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            G+  G QR+S AAA VE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNAAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
            PYEQ+ + E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PYEQSVQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  664  AMFAW  678
             M +W
Sbjct  206  LMLSW  210



>ref|XP_006307216.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
 gb|EOA40114.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
Length=532

 Score =   302 bits (773),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 161/184 (88%), Gaps = 1/184 (1%)
 Frame = +1

Query  127  GVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            G+  G+QR+S  A VE  ++P V+V++TQ +I GKFVD+ASGKTFPTLDPR  +VIA VA
Sbjct  26   GMNRGVQRYSNHA-VENTITPPVKVEHTQLLIGGKFVDAASGKTFPTLDPRNGEVIAQVA  84

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  486
            EG+ ED+NRAVAAARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  85   EGDVEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  144

Query  487  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  666
            +EQAAK E+PM+ R+F YYAGWADKIHG+TVP DGP+HVQTLHEPIGVAGQIIPWNFPL 
Sbjct  145  FEQAAKIEVPMLARVFRYYAGWADKIHGMTVPGDGPYHVQTLHEPIGVAGQIIPWNFPLL  204

Query  667  MFAW  678
            M +W
Sbjct  205  MLSW  208



>ref|XP_009761724.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=540

 Score =   302 bits (773),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +1

Query  133  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  312
            ++GI+ FS+A   EE ++P VEVKY Q +ING+FVD+ASGK FPT DPRT DVI  VAE 
Sbjct  36   KNGIRSFSSAVVHEEPITPPVEVKYKQLLINGQFVDAASGKMFPTYDPRTGDVITMVAEA  95

Query  313  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  492
            + ED+NRAV+AARKAFDEGPWPKMSAYERS IML+FAD +EKH DELA LETWDNGKPYE
Sbjct  96   DTEDVNRAVSAARKAFDEGPWPKMSAYERSCIMLRFADFLEKHGDELAALETWDNGKPYE  155

Query  493  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  672
            QAA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQ LHEPIGVAGQIIPWNFPL MF
Sbjct  156  QAANEEIPMLIRLFRYYAGWADKIHGLTAPADSLHHVQILHEPIGVAGQIIPWNFPLLMF  215

Query  673  AW  678
            AW
Sbjct  216  AW  217



>ref|XP_007157468.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
 gb|ESW29462.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
Length=538

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            +FSTAAA EE + P V V++TQ +I+GKFVD+ SGKTFPTLDPRT DVIA VAEG+ ED+
Sbjct  38   KFSTAAATEEPIKPPVRVEHTQLLIDGKFVDATSGKTFPTLDPRTGDVIALVAEGDHEDV  97

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            ++AV+ ARKAFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKPYEQ+A+ 
Sbjct  98   DQAVSVARKAFDHGPWPKMTAYERQRILLRAADLLEKHNDELAALETWDNGKPYEQSAQI  157

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+P++VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  158  EVPIVVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFAW  214



>ref|XP_010029206.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            +G  +G   GI   S+++ V+EL++P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DV
Sbjct  20   IGRSHGWVRGIGSSSSSSVVDELITPSVKIADTQLLINGKFVDAASGKTFPTLDPRTGDV  79

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            I HVAEG+AED++RAVAAARKAFDEGPWP+M+AYERS I+L+FADL+EKH+D+LA +ETW
Sbjct  80   ITHVAEGDAEDVDRAVAAARKAFDEGPWPRMTAYERSCILLRFADLLEKHIDDLAAIETW  139

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            DNGKPYEQAA+ E+P ++RL  YYAGWADKIHGLT+PADG +HVQTLHEPIGVAGQI+PW
Sbjct  140  DNGKPYEQAAEDEVPDVIRLMRYYAGWADKIHGLTIPADGEYHVQTLHEPIGVAGQIVPW  199

Query  652  NFPLAMFAW  678
            NFPL MFAW
Sbjct  200  NFPLRMFAW  208



>gb|KEH19980.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=541

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = +1

Query  148  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  217



>ref|XP_004139235.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=538

 Score =   301 bits (772),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  36   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  95

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  96   DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  155

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  156  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNFPLVMFAW  214



>ref|XP_004156463.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=540

 Score =   301 bits (772),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  38   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  97

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  98   DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  157

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  158  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNFPLVMFAW  216



>ref|XP_009115500.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=536

 Score =   301 bits (772),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = +1

Query  94   PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  273
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLD
Sbjct  18   PSLFALRGKHHNMNRGVYGYSNVAAGEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLD  77

Query  274  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  453
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADLV+KH DE+
Sbjct  78   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLVDKHNDEI  137

Query  454  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  633
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  138  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  197

Query  634  GQIIPWNFPLAMFAW  678
            GQIIPWNFPL M +W
Sbjct  198  GQIIPWNFPLLMLSW  212



>gb|KFK44454.1| hypothetical protein AALP_AA1G258900 [Arabis alpina]
Length=524

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = +1

Query  139  GIQRFST----AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            G  R+S     AAA+E  ++P V+V++TQ +INGKFVD+ASGKTFPTLDPRT +VIA VA
Sbjct  17   GAYRYSNVSAAAAALENTITPPVKVEHTQLLINGKFVDAASGKTFPTLDPRTGEVIAQVA  76

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  486
            EG+ ED+NRAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DE+A LETWDNGKP
Sbjct  77   EGDKEDVNRAVLAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDEIAALETWDNGKP  136

Query  487  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  666
            YEQ+A+ E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNFPL 
Sbjct  137  YEQSAQLEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNFPLL  196

Query  667  MFAW  678
            M +W
Sbjct  197  MLSW  200



>gb|KEH35050.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=542

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  652  NFPLAMFAW  678
            NFP+ +FAW
Sbjct  210  NFPILLFAW  218



>ref|XP_008456004.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Cucumis melo]
Length=537

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPR+ +VIA+VAEG+A 
Sbjct  35   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRSGEVIANVAEGDAR  94

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D++ AV+AARKAFDEGPWPKM+AYERS+I+L+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  95   DVDIAVSAARKAFDEGPWPKMTAYERSKIILRFADLVEKHAEEVAALETWDNGKTYEQSL  154

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K E+PM VRLF YY GWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  KIEVPMFVRLFRYYGGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  213



>emb|CDY47634.1| BnaC05g18900D [Brassica napus]
Length=544

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = +1

Query  94   PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  273
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLD
Sbjct  18   PSLFALRGKHHNMNRGVYGYSNVAAAEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLD  77

Query  274  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  453
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M AYERS+I+L+FADLV+KH DE+
Sbjct  78   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMIAYERSKILLRFADLVDKHNDEI  137

Query  454  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  633
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  138  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  197

Query  634  GQIIPWNFPLAMFAW  678
            GQIIPWNFPL M +W
Sbjct  198  GQIIPWNFPLLMLSW  212



>ref|XP_011044321.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +1

Query  139  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            GI RF TA A+EE ++P V++ YTQH INGKFVD+ASGK FP  DPRT +VIAHVAEG+ 
Sbjct  36   GIYRFITATALEEPITPPVQISYTQHFINGKFVDAASGKIFPAYDPRTGEVIAHVAEGDT  95

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            ED+NRAVAAA KAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+
Sbjct  96   EDVNRAVAAACKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQS  155

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AKSELP   RLF YYAGW DKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNF L M AW
Sbjct  156  AKSELPSFARLFRYYAGWTDKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNFALIMLAW  215



>ref|XP_009150211.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Brassica rapa]
Length=538

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++RF T++A E+++SP+V+V  TQ +I+G FVD+ SGKTF TLDPRT +VIA VAEG+AE
Sbjct  36   VRRFGTSSAAEKIISPSVQVSCTQLLIDGNFVDATSGKTFQTLDPRTGEVIADVAEGDAE  95

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+RAV AARKAFD+GPWP+M+AYERSRIML+FADLVEKH +ELA LETWDNGK Y+QA 
Sbjct  96   DIDRAVKAARKAFDKGPWPRMTAYERSRIMLRFADLVEKHSEELAALETWDNGKTYQQAK  155

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  156  TAEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAW  214



>ref|XP_011071082.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Sesamum indicum]
Length=525

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 162/186 (87%), Gaps = 3/186 (2%)
 Frame = +1

Query  121  KYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAH  300
            +YG   GI R+ T +A +E + P V V+Y + +ING+FVD+ASGKTFPTLDPR+ +VIAH
Sbjct  19   RYG--RGIYRYGTTSA-QEPIKPPVTVEYDKLLINGQFVDAASGKTFPTLDPRSGEVIAH  75

Query  301  VAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNG  480
            VAEG+ EDINRAVAAARKAFDEGPWPKM+AYER RIML+FADLVEKH DE+A LETWDNG
Sbjct  76   VAEGDTEDINRAVAAARKAFDEGPWPKMTAYERCRIMLRFADLVEKHNDEIAALETWDNG  135

Query  481  KPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFP  660
            K YEQ+A  E+PM+VRLF YYAGWADKIHGLT+ ADGP++VQ+LHEPIGVAGQIIPWNFP
Sbjct  136  KVYEQSAHIEIPMLVRLFRYYAGWADKIHGLTIRADGPYNVQSLHEPIGVAGQIIPWNFP  195

Query  661  LAMFAW  678
            L MFAW
Sbjct  196  LVMFAW  201



>gb|KJB11461.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=530

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            I  FSTAAA ++E + P++++ +TQ +ING+F+D+ASG+TFPT+DPRT DVIA VAEG+ 
Sbjct  27   INSFSTAAAAIDEPIHPSIQIDHTQLLINGQFIDAASGRTFPTIDPRTGDVIARVAEGDL  86

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            EDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH  E+A LETWDNGKPYEQA
Sbjct  87   EDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTGEVAKLETWDNGKPYEQA  146

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            AK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNFPL +++W
Sbjct  147  AKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNFPLLLYSW  206



>gb|KGN60807.1| hypothetical protein Csa_2G010420 [Cucumis sativus]
Length=592

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  90   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  149

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  150  DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  209

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  210  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNFPLVMFAW  268



>ref|XP_010682578.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=550

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + R+STA A EE ++P V VKYTQ +ING+FVDSASGK   T DPRT +VI  V+EG+AE
Sbjct  48   VSRYSTATASEEPITPPVTVKYTQLLINGQFVDSASGKKMKTYDPRTGNVITEVSEGDAE  107

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV+AAR AFDEGPWPKM+AYERS+I+ KFADL+E+H DE+A LETWDNGKPYEQA+
Sbjct  108  DINRAVSAARIAFDEGPWPKMTAYERSKILFKFADLLEQHTDEIAALETWDNGKPYEQAS  167

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K ELPM VRL  YYAGWADKIHGLTVPADGP+H+QTLHEPIGVAGQIIPWNFP+ MF W
Sbjct  168  KVELPMCVRLMRYYAGWADKIHGLTVPADGPYHMQTLHEPIGVAGQIIPWNFPILMFVW  226



>gb|KHG06517.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 161/181 (89%), Gaps = 2/181 (1%)
 Frame = +1

Query  142  IQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  315
            I+ FSTAAA  ++E + P++++ +TQ +ING+FVD+ASGK+FPT+DPRT DVIA VAEG+
Sbjct  27   IKSFSTAAAAAIDEPIHPSIQIDHTQLLINGQFVDAASGKSFPTVDPRTGDVIARVAEGD  86

Query  316  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  495
             ED+NRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH +E+A LETWDNGKPYEQ
Sbjct  87   LEDVNRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTEEVAKLETWDNGKPYEQ  146

Query  496  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
            AAK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNFPL +++
Sbjct  147  AAKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNFPLLLYS  206

Query  676  W  678
            W
Sbjct  207  W  207



>ref|XP_009110081.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=537

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 161/184 (88%), Gaps = 1/184 (1%)
 Frame = +1

Query  130  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            +  G +R+S  AA++E+ ++P V+V++TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   LNRGARRYSNLAASLEDTITPPVKVEHTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  486
            EG+ ED+NRAV AARKAFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDQGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  487  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  666
            YEQ+A  E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNFPL 
Sbjct  150  YEQSANIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNFPLL  209

Query  667  MFAW  678
            M +W
Sbjct  210  MLSW  213



>emb|CDY57318.1| BnaA08g20300D [Brassica napus]
Length=537

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 161/184 (88%), Gaps = 1/184 (1%)
 Frame = +1

Query  130  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            +  G +R+S  AA++E+ ++P V+V++TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   LNRGARRYSNLAASLEDTITPPVKVEHTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  486
            EG+ ED+NRAV AARKAFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDQGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  487  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  666
            YEQ+A  E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNFPL 
Sbjct  150  YEQSANIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNFPLL  209

Query  667  MFAW  678
            M +W
Sbjct  210  MLSW  213



>ref|XP_003563967.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Brachypodium distachyon]
Length=548

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +QRF TAA  EE +SP V+V  T+ +INGKFVD+ SGKTFPTLDPRT +VIAHVAEG+A+
Sbjct  46   LQRFGTAAVAEEPISPPVKVGETKLLINGKFVDAVSGKTFPTLDPRTGEVIAHVAEGDAK  105

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DI+ AVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D+LA LETWDNGK +EQAA
Sbjct  106  DIDLAVAAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDLAALETWDNGKTFEQAA  165

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              ELPMI RL  YYAGW+DKIHGL VPAD PHHVQ L+EPIGVAGQIIPWNFPL MFAW
Sbjct  166  HIELPMIARLMRYYAGWSDKIHGLVVPADSPHHVQVLYEPIGVAGQIIPWNFPLLMFAW  224



>gb|EYU22484.1| hypothetical protein MIMGU_mgv1a004342mg [Erythranthe guttata]
Length=532

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = +1

Query  130  VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  309
            +  GI  +S +A+++  + P V V+Y + +ING+FV++ASGKTFPTLDPR+ +VIAHV+E
Sbjct  26   LSRGIYHYSKSASLDNPIKPPVTVQYDKLLINGQFVEAASGKTFPTLDPRSGEVIAHVSE  85

Query  310  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  489
            G+ ED+NRAVA+ARKAFDEGPWPKM+AYERS+IM +FADL+EKH DE+A LETWDNGKP+
Sbjct  86   GDLEDVNRAVASARKAFDEGPWPKMTAYERSKIMFRFADLIEKHNDEIAALETWDNGKPF  145

Query  490  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAM  669
            EQ+AK E+PM+ RLF YY GWADKIHGLT+  DGPHHVQTLHEPIGVAGQIIPWNFPL M
Sbjct  146  EQSAKIEVPMLARLFRYYGGWADKIHGLTIRGDGPHHVQTLHEPIGVAGQIIPWNFPLLM  205

Query  670  FAW  678
            FAW
Sbjct  206  FAW  208



>emb|CDY61548.1| BnaA09g29890D, partial [Brassica napus]
Length=555

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = +1

Query  94   PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  273
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGK FPTLD
Sbjct  37   PSLFALRGKHHNMYRGVYGYSNVAAAEDTITPPVKVEHTQLLIGGKFVDAASGKAFPTLD  96

Query  274  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  453
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADLV+KH DE+
Sbjct  97   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLVDKHNDEI  156

Query  454  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  633
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  157  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  216

Query  634  GQIIPWNFPLAMFAW  678
            GQIIPWNFPL M +W
Sbjct  217  GQIIPWNFPLLMLSW  231



>emb|CDX77883.1| BnaC03g53360D [Brassica napus]
Length=572

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +1

Query  124  YGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  303
            Y     ++RF  ++A E+++ P+V+V YTQ +I+G FVD+ASGKTFPT+DPRT +VIA V
Sbjct  30   YNASRVVRRFGISSAAEKIIRPSVQVSYTQLLIDGNFVDAASGKTFPTIDPRTGEVIADV  89

Query  304  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  483
            AEG+AEDI+ AV AARKAFDEGPWPKM+AYERSRIML+FADLVEKH ++LA LETWDNGK
Sbjct  90   AEGDAEDIDWAVKAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHSEDLAALETWDNGK  149

Query  484  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  663
             Y+QA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQI PWNFPL
Sbjct  150  TYQQAKTAEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQINPWNFPL  209

Query  664  AMFAW  678
             MFAW
Sbjct  210  LMFAW  214



>ref|XP_009600000.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=544

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +1

Query  133  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  312
            ++GI+ FS+A   EE ++P VEVKY Q +ING+FVD+ASGK FPT DPRT DVI  VAE 
Sbjct  40   KNGIRSFSSAVVHEEPITPPVEVKYKQLLINGQFVDAASGKMFPTYDPRTGDVITMVAEA  99

Query  313  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  492
            + ED+NRAV+AARKAFDEGPWPKMSAYERS IML+FADL+EKH DELA LET+DNGKPYE
Sbjct  100  DTEDVNRAVSAARKAFDEGPWPKMSAYERSCIMLRFADLLEKHSDELAELETYDNGKPYE  159

Query  493  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  672
            QAA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQ LHEPIGVAGQIIPWNF L MF
Sbjct  160  QAANEEIPMLLRLFRYYAGWADKIHGLTAPADSLHHVQILHEPIGVAGQIIPWNFSLLMF  219

Query  673  AW  678
            AW
Sbjct  220  AW  221



>emb|CDX91724.1| BnaC08g06430D [Brassica napus]
Length=537

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = +1

Query  130  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            +  G +R+S  AA++E+ ++P V+V+ TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   MNRGARRYSNLAASLEDTITPPVKVEQTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  486
            EG+ ED+NRAV AARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  487  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  666
            YEQ+AK E+PM+ R+F YYAGWADKIHG+TV  DG HHVQTLHEPIGVAGQIIPWNFPL 
Sbjct  150  YEQSAKIEVPMLARVFRYYAGWADKIHGMTVRGDGSHHVQTLHEPIGVAGQIIPWNFPLL  209

Query  667  MFAW  678
            M +W
Sbjct  210  MLSW  213



>ref|XP_010271955.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Nelumbo nucifera]
Length=534

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG K      I  F TA  +EE  +P ++V++TQ +ING+FVD+ASG+TFPTLDP  E+V
Sbjct  22   LGRKSSWGRDIYCFCTANTIEEPSTPPIQVEHTQLLINGQFVDAASGRTFPTLDPSKEEV  81

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IAHV+EG+AEDINRAV+AARKAFDEGPWP+M+AYER++IM +FADL+EK+ DE+A LE+ 
Sbjct  82   IAHVSEGDAEDINRAVSAARKAFDEGPWPRMTAYERAKIMYRFADLLEKYNDEIAALESL  141

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  651
            D+GKPYEQAAK E+P + RLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW
Sbjct  142  DSGKPYEQAAKVEIPTVTRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  201

Query  652  NFPLAMFAW  678
            NFPL M+AW
Sbjct  202  NFPLLMYAW  210



>ref|XP_004245256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=534

 Score =   296 bits (759),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +1

Query  148  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  327
            R++TAA  ++ + P+V V+YT+  ING+FVDSASGKTFPTLDPRT +VIAHVAEG+ EDI
Sbjct  36   RYTTAA--QDPIKPSVNVEYTKLFINGQFVDSASGKTFPTLDPRTGEVIAHVAEGDVEDI  93

Query  328  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  507
            NRAV AAR AFDEGPWPKMSAYERS+I+ + ADL+EKH DE+ATLETWD+GK Y+Q A  
Sbjct  94   NRAVVAARNAFDEGPWPKMSAYERSKILFRIADLIEKHNDEIATLETWDSGKLYQQVATI  153

Query  508  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            E+PMIVRL  YYAGWADKIHG+TVPADGP+HVQTLHEPIGV GQIIPWNFPL MFAW
Sbjct  154  EIPMIVRLLRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVVGQIIPWNFPLLMFAW  210



>ref|XP_010037573.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW49300.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
 gb|KCW49301.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
Length=542

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +1

Query  127  GVESGIQRFSTAAA---VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  297
            G+   I RFSTAAA   +EELV P V+V +TQ +ING+FVDSASGKTFP  DPRT +VIA
Sbjct  32   GLRRSIPRFSTAAAAAALEELVIPPVQVCHTQLLINGQFVDSASGKTFPAYDPRTAEVIA  91

Query  298  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  477
            HVAEG+ ED++RAVAAARKAFDEGPWPKM+ YER RI+L+FADLVEKH +ELA LETW+N
Sbjct  92   HVAEGDGEDVDRAVAAARKAFDEGPWPKMTPYERCRILLRFADLVEKHSEELAALETWNN  151

Query  478  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  657
            GKPYEQA  SE+P + RLF YYAGWADKIHG+TVPADG +H+QTLHEPIGVAGQIIPWNF
Sbjct  152  GKPYEQALHSEIPSMARLFRYYAGWADKIHGMTVPADGNYHMQTLHEPIGVAGQIIPWNF  211

Query  658  PLAMFAW  678
            PL +F+W
Sbjct  212  PLVLFSW  218



>ref|XP_006356663.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=537

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = +1

Query  148  RFSTAAAV-EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  324
            R++TAA + ++ + P+V V+YT+  ING+FVDS SGKTFPTLDPRT +VIAHVAEG+ ED
Sbjct  36   RYTTAAPIAQDPIKPSVNVEYTKLFINGQFVDSTSGKTFPTLDPRTGEVIAHVAEGDVED  95

Query  325  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  504
            INRAV AAR AFDEGPWPKMSAYERS+++ + ADL+EKH DE+ATLETWD+GK Y+Q A 
Sbjct  96   INRAVVAARNAFDEGPWPKMSAYERSKVLFRIADLIEKHNDEIATLETWDSGKLYQQVAT  155

Query  505  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             E+PMIVR+  YYAGWADKIHG+TVPADGP+HVQTLHEPIGV GQIIPWNFPL MFAW
Sbjct  156  IEIPMIVRILRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVVGQIIPWNFPLLMFAW  213



>ref|XP_010316283.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=528

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = +1

Query  139  GIQRFSTAAAV-EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  315
            GI+RF ++A V EE ++P VEVKY Q +ING+FVD+ASGKTFPT DPRT + I  VAE +
Sbjct  25   GIRRFCSSAVVHEEPITPPVEVKYNQLLINGQFVDAASGKTFPTFDPRTGEAITTVAEAD  84

Query  316  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  495
             ED+NRAV AARKAFDEGPWPKM+  ERS IML+FADL+E+H DELA LETWD GKPYEQ
Sbjct  85   TEDVNRAVFAARKAFDEGPWPKMTCAERSCIMLQFADLLERHSDELAALETWDKGKPYEQ  144

Query  496  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
            AA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQTLHEPIGVAGQIIPWNFPL MFA
Sbjct  145  AANEEIPMLIRLFRYYAGWADKIHGLTAPADSLHHVQTLHEPIGVAGQIIPWNFPLLMFA  204

Query  676  W  678
            W
Sbjct  205  W  205



>gb|AAC98035.1| Strong similarity to gb|Y09876 aldehyde dehydrogenase (NAD+) 
from Nicotiana tabacum and a member of the aldehyde dehydrogenase 
family PF|00171. ESTs gb|F15117, gb|R83958 and gb|586262 
come from this gene [Arabidopsis thaliana]
Length=519

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 161/195 (83%), Gaps = 12/195 (6%)
 Frame = +1

Query  130  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            +  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V+
Sbjct  1    MNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQVS  60

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAY-----------ERSRIMLKFADLVEKHMDEL  453
            EG+AED+NRAVAAARKAFDEGPWPKM+AY           ERS+I+ +FADL+EKH DE+
Sbjct  61   EGDAEDVNRAVAAARKAFDEGPWPKMTAYVYNKVVLCLSSERSKILFRFADLIEKHNDEI  120

Query  454  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  633
            A LETWDNGKPYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVA
Sbjct  121  AALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVA  180

Query  634  GQIIPWNFPLAMFAW  678
            GQIIPWNFPL M +W
Sbjct  181  GQIIPWNFPLLMLSW  195



>ref|XP_006416054.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
 gb|ESQ34407.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
Length=541

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 161/187 (86%), Gaps = 4/187 (2%)
 Frame = +1

Query  130  VESGIQRFST----AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  297
            +  G +R+S     AAA+E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLDPRT +VIA
Sbjct  31   MNRGARRYSNLAAAAAALEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLDPRTGEVIA  90

Query  298  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  477
             VAEG+ ED+NRAV AARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDN
Sbjct  91   QVAEGDVEDVNRAVLAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDN  150

Query  478  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  657
            GKPYEQ+AK E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNF
Sbjct  151  GKPYEQSAKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNF  210

Query  658  PLAMFAW  678
            PL M +W
Sbjct  211  PLLMLSW  217



>ref|XP_007044551.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
 gb|EOY00383.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
Length=538

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            + R+ T  A  E  +  V+V +TQ +ING FVDSASGKTFPT DPRT DVIA+VAEG+ E
Sbjct  36   VSRYGTTCASVENPNIPVKVNHTQLLINGNFVDSASGKTFPTYDPRTGDVIAYVAEGDTE  95

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV+AARKAFDEGPWPKM+AYERS ++ +FADL++KH +ELA LETWDNGK YEQAA
Sbjct  96   DINRAVSAARKAFDEGPWPKMTAYERSMVLFRFADLIDKHTEELAILETWDNGKTYEQAA  155

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            K ELPMI RL  YYAGWADKIHGLTVPAD  HHVQT+HEPIGVAGQIIPWNFPL MFAW
Sbjct  156  KIELPMISRLIRYYAGWADKIHGLTVPADSSHHVQTIHEPIGVAGQIIPWNFPLLMFAW  214



>ref|XP_008793866.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=538

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            ++ FS AA   E ++P V+V +TQ +I+GKFVDSASG+TFPTLDPRT +VIAHVAEG+ E
Sbjct  39   LRMFSIAA---EPITPPVQVHHTQLLIDGKFVDSASGRTFPTLDPRTGEVIAHVAEGDLE  95

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            DINRAV+AARKAFDEGPWPKMS YERS I+ +FADL+EKH DE+A LETWD GKPYE  A
Sbjct  96   DINRAVSAARKAFDEGPWPKMSGYERSHILYRFADLIEKHNDEIAALETWDGGKPYEHTA  155

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MF W
Sbjct  156  QKEIPMVTRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFGW  214



>ref|XP_002525343.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF36981.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=385

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  229  KFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRI  408
            KFVD+ASG+TFPTLDPRT +VIAHVAEG+AEDINRAV+AARKAFDEG WPKM+AYERSRI
Sbjct  14   KFVDAASGRTFPTLDPRTGEVIAHVAEGDAEDINRAVSAARKAFDEGSWPKMTAYERSRI  73

Query  409  MLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPAD  588
            ML+FADL+EKH DELA LETWDNGKPYEQAAK E+PM+ RLF YYAGWADKIHGLTVPAD
Sbjct  74   MLRFADLIEKHNDELAALETWDNGKPYEQAAKGEIPMVARLFRYYAGWADKIHGLTVPAD  133

Query  589  GPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            G HHVQTLHEPIGVAGQIIPWNFPL M+AW
Sbjct  134  GQHHVQTLHEPIGVAGQIIPWNFPLLMYAW  163



>ref|XP_006594290.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Glycine max]
Length=537

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = +1

Query  154  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  333
            S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED+NR
Sbjct  40   SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIANVAEGDAEDVNR  98

Query  334  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  513
            AV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+GK YEQAA  E+
Sbjct  99   AVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDSGKTYEQAANVEI  158

Query  514  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNFPL +F+W
Sbjct  159  PMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNFPLLIFSW  213



>gb|KHN47185.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=538

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = +1

Query  154  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  333
            S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED+NR
Sbjct  43   SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIANVAEGDAEDVNR  101

Query  334  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  513
            AV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+GK YEQAA  E+
Sbjct  102  AVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDSGKTYEQAANVEI  161

Query  514  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNFPL +F+W
Sbjct  162  PMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNFPLLIFSW  216



>ref|XP_003542700.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Glycine max]
Length=540

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = +1

Query  154  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  333
            S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED+NR
Sbjct  43   SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIANVAEGDAEDVNR  101

Query  334  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  513
            AV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+GK YEQAA  E+
Sbjct  102  AVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDSGKTYEQAANVEI  161

Query  514  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNFPL +F+W
Sbjct  162  PMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNFPLLIFSW  216



>gb|AAZ79358.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=524

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 156/190 (82%), Gaps = 14/190 (7%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTED  288
            LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+AS             
Sbjct  24   LGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAAS-------------  70

Query  289  VIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLET  468
            VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LET
Sbjct  71   VIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALET  130

Query  469  WDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIP  648
            W+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQIIP
Sbjct  131  WNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQIIP  190

Query  649  WNFPLAMFAW  678
            WNFPL MFAW
Sbjct  191  WNFPLMMFAW  200



>gb|AEV54528.1| aldehyde dehydrogenase ALDH2B4_V3 [Vitis vinifera]
Length=524

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 156/190 (82%), Gaps = 14/190 (7%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTED  288
            LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+AS             
Sbjct  24   LGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAAS-------------  70

Query  289  VIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLET  468
            VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LET
Sbjct  71   VIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALET  130

Query  469  WDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIP  648
            W+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQIIP
Sbjct  131  WNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQIIP  190

Query  649  WNFPLAMFAW  678
            WNFPL MFAW
Sbjct  191  WNFPLMMFAW  200



>ref|XP_010100483.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB82617.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=537

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  142  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  321
            +  + TAAA+EE + P+V +++T+ +ING+FVDS SGKTFPT DPRT +VI HVAEG  E
Sbjct  35   VANYGTAAAIEEPIKPSVSIEHTKLLINGQFVDSVSGKTFPTFDPRTGEVITHVAEGGKE  94

Query  322  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  501
            D++ AVA ARKAFDEGPWPKM+AYERS ++L+FADL+EKH +ELA LETWDNGKPYEQA 
Sbjct  95   DVDLAVAVARKAFDEGPWPKMTAYERSLVLLRFADLLEKHTEELAKLETWDNGKPYEQAL  154

Query  502  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              ELP+ VRL  YYAGWADKIHGLT  ADGPHHVQTLHEPIGV GQIIPWNFPL MF W
Sbjct  155  NVELPICVRLIRYYAGWADKIHGLTAQADGPHHVQTLHEPIGVCGQIIPWNFPLLMFVW  213



>ref|XP_010265814.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=539

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = +1

Query  142  IQRFSTAAAVEE-LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  318
            I RFSTAA  EE ++ P V+V++TQ +ING+FVD+ASG+TFPT DPR+ D+I HVAEG+ 
Sbjct  36   ISRFSTAALTEEEVIIPPVQVEHTQLLINGQFVDAASGRTFPTFDPRSGDLITHVAEGDE  95

Query  319  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  498
            EDINRAV AAR+AFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWD+GKPYE  
Sbjct  96   EDINRAVFAAREAFDDGPWPRMTAYERSKIIYRFADLLEKHNDEIAALETWDSGKPYEHT  155

Query  499  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            A  E+P + RLF Y+AGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL M+AW
Sbjct  156  ANVEIPKMTRLFRYFAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLMMYAW  215



>gb|KHN23562.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=510

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = +1

Query  154  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  333
            S AA VE  ++P V++ ++Q +I+G+FVD+ASGKTFPT DPRT DVIA+VAEG+ ED+NR
Sbjct  30   SAAADVEPSIAP-VQIDHSQLLIDGQFVDAASGKTFPTFDPRTGDVIANVAEGDTEDVNR  88

Query  334  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  513
            AV AARKAFDEGPWPKM+AYERSRI+L FA L+EKH DE+A +ETWD+GK YEQAAK E+
Sbjct  89   AVRAARKAFDEGPWPKMTAYERSRIILHFAGLLEKHNDEVAAIETWDSGKTYEQAAKVEI  148

Query  514  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            PM+VRLF YYAGW DKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNFPL +F+W
Sbjct  149  PMVVRLFRYYAGWVDKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNFPLLIFSW  203



>ref|XP_004953799.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Setaria italica]
Length=548

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  172  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            EE + PAVE+K+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR
Sbjct  56   EEPIQPAVEIKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAAR  115

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAFDEGPWP+M+AYER R++L+FADL+E+H DE+A LETWDNGK   Q+A +E+PM+ R 
Sbjct  116  KAFDEGPWPRMTAYERCRVLLRFADLIERHADEIAALETWDNGKTLAQSAGAEVPMLARC  175

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              YYAGWADKIHGL VPADG HHVQ LHEP+GVAGQIIPWNFPL MFAW
Sbjct  176  MRYYAGWADKIHGLVVPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAW  224



>ref|XP_010928603.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=538

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 162/195 (83%), Gaps = 3/195 (2%)
 Frame = +1

Query  97   SASAFLGWK-YGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  273
            S+S F G + + +  G+ R  + AA  E ++P VEV +TQ +I+GKFVDSASGKTFPTLD
Sbjct  22   SSSLFPGARTHDLAFGVLRMFSMAA--EPITPPVEVHHTQLLIDGKFVDSASGKTFPTLD  79

Query  274  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  453
            PRT +VIAHVAE + ED+NRAV+AARKAFDEGPWPKM+ YERS I+ +FADL+EKH DE+
Sbjct  80   PRTGEVIAHVAEADLEDVNRAVSAARKAFDEGPWPKMTGYERSHILYRFADLIEKHNDEI  139

Query  454  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  633
            A LETW++GKPYE  ++ E+P++ RL  YYAGWADKIHGLTVPADGP+HVQ LHEPIGVA
Sbjct  140  AALETWNSGKPYEHTSQKEVPLVTRLMRYYAGWADKIHGLTVPADGPYHVQVLHEPIGVA  199

Query  634  GQIIPWNFPLAMFAW  678
            GQIIPWNFPL MFAW
Sbjct  200  GQIIPWNFPLMMFAW  214



>ref|XP_004953798.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Setaria italica]
Length=555

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  172  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            EE + PAVE+K+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR
Sbjct  63   EEPIQPAVEIKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAAR  122

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAFDEGPWP+M+AYER R++L+FADL+E+H DE+A LETWDNGK   Q+A +E+PM+ R 
Sbjct  123  KAFDEGPWPRMTAYERCRVLLRFADLIERHADEIAALETWDNGKTLAQSAGAEVPMLARC  182

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
              YYAGWADKIHGL VPADG HHVQ LHEP+GVAGQIIPWNFPL MFAW
Sbjct  183  MRYYAGWADKIHGLVVPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAW  231



>gb|ACU18804.1| unknown [Glycine max]
Length=199

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG   G      RFSTAAAVE+L++P V + YT+H+ING+FVD+ASGKTFPT DPRT +V
Sbjct  28   LGRNSGKWGNFNRFSTAAAVEDLITPQVPITYTKHLINGQFVDAASGKTFPTYDPRTGEV  87

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IA VAEG+AEDINRAV+AARKAFDEGPWPK++AYER +I+L+FADLVEKH DELA LETW
Sbjct  88   IAQVAEGDAEDINRAVSAARKAFDEGPWPKLTAYERCKIILRFADLVEKHGDELAALETW  147

Query  472  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPI  624
            +NGKPYEQ+A +ELP  VRLF YYAGWADKIHGLTVPADG +HV+TLHEP+
Sbjct  148  NNGKPYEQSATAELPTFVRLFRYYAGWADKIHGLTVPADGNYHVETLHEPM  198



>ref|XP_007151102.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
 gb|ESW23096.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
Length=522

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  187  PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE  366
            P V++++ Q +I+G FVD+ASGKTFPT DPRT D IA+VAE + ED+NRAV AARKAFDE
Sbjct  42   PPVQIEHNQLLIDGLFVDAASGKTFPTNDPRTGDTIANVAEADVEDVNRAVRAARKAFDE  101

Query  367  GPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYA  546
            GPWPKM+AYERSRI+L+ AD++EKH DE+A +ETWD+GKPYEQAA  E+PM+VRLF YYA
Sbjct  102  GPWPKMTAYERSRIILRCADILEKHNDEVAAIETWDSGKPYEQAANVEIPMVVRLFRYYA  161

Query  547  GWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            GWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNFPL +F+W
Sbjct  162  GWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNFPLLIFSW  205



>emb|CDY21806.1| BnaA06g20750D [Brassica napus]
Length=496

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  205  YTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKM  384
            YTQ +I+G FVD+ASGKTF TLDPRT +VIA VAEG+AEDI+RAV AARKAFDEG WP+M
Sbjct  15   YTQLLIDGNFVDAASGKTFQTLDPRTGEVIADVAEGDAEDIDRAVKAARKAFDEGSWPRM  74

Query  385  SAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKI  564
            +AYERSRIML+FADLVEKH +ELA LETWDNGK Y+QA  +E+PM+ RLF YYAGWADKI
Sbjct  75   TAYERSRIMLRFADLVEKHSEELAALETWDNGKTYQQAKTAEIPMLARLFRYYAGWADKI  134

Query  565  HGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            HGLTVPADG +HVQTLHEPIG AGQIIPWNFPL MFAW
Sbjct  135  HGLTVPADGNYHVQTLHEPIGAAGQIIPWNFPLLMFAW  172



>gb|AAW50842.1| aldehyde dehydrogenase [Aegiceras corniculatum]
Length=186

 Score =   263 bits (671),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  235  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  414
            VDSASG+TFPT DPRT +VIAH+AEG+ EDINRAV AARKAFDEGPWP+M+AYERSRI+L
Sbjct  1    VDSASGRTFPTYDPRTGEVIAHLAEGDEEDINRAVNAARKAFDEGPWPRMTAYERSRILL  60

Query  415  KFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGP  594
            + ADLVEKH +ELA LETW+NGKPYEQAA++ELP+ VRLFHYYAGWADKIHGLTV +DGP
Sbjct  61   RCADLVEKHSEELAALETWNNGKPYEQAAEAELPLFVRLFHYYAGWADKIHGLTVQSDGP  120

Query  595  HHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            +H Q LHEPIGVA QIIPWNFPL MFAW
Sbjct  121  YHTQVLHEPIGVARQIIPWNFPLLMFAW  148



>gb|KDO82484.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=493

 Score =   272 bits (695),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  172  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  636
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAG
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAG  208



>gb|AAZ79356.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=477

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  247  SGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFAD  426
            +GKTFPT DPRT +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FAD
Sbjct  10   TGKTFPTFDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFAD  69

Query  427  LVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQ  606
            L EKH DELA LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ
Sbjct  70   LAEKHNDELAALETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQ  129

Query  607  TLHEPIGVAGQIIPWNFPLAMFAW  678
             LHEPIGVAGQIIPWNFPL MFAW
Sbjct  130  ILHEPIGVAGQIIPWNFPLMMFAW  153



>gb|AEV54527.1| aldehyde dehydrogenase ALDH2B4_V2 [Vitis vinifera]
Length=477

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  247  SGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFAD  426
            +GKTFPT DPRT +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FAD
Sbjct  10   TGKTFPTFDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFAD  69

Query  427  LVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQ  606
            L EKH DELA LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ
Sbjct  70   LAEKHNDELAALETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQ  129

Query  607  TLHEPIGVAGQIIPWNFPLAMFAW  678
             LHEPIGVAGQIIPWNFPL MFAW
Sbjct  130  ILHEPIGVAGQIIPWNFPLMMFAW  153



>gb|KJB50198.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=492

 Score =   269 bits (688),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  235  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  414
            ++ + GKTFPT DPRT DVIAHVAEG+AEDINRAV+AARKAFDEGPWPKM+AYERSR++ 
Sbjct  21   LNQSHGKTFPTYDPRTGDVIAHVAEGDAEDINRAVSAARKAFDEGPWPKMTAYERSRVLF  80

Query  415  KFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGP  594
            +FADL+++H +ELATLETWDNGKPYEQAAK ELPMI RL  YYAGWADKIHGLTVPAD P
Sbjct  81   RFADLIDQHTEELATLETWDNGKPYEQAAKIELPMISRLIRYYAGWADKIHGLTVPADSP  140

Query  595  HHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            H VQT+HEPIGVAGQIIPWNFP+ MFAW
Sbjct  141  HLVQTIHEPIGVAGQIIPWNFPVLMFAW  168



>gb|AFW63787.1| hypothetical protein ZEAMMB73_379378 [Zea mays]
Length=401

 Score =   264 bits (675),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  181  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  360
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  361  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  540
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  541  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFPL MFAW
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAW  226



>ref|XP_002321583.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEF05710.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=497

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  244  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  423
            + GKTFPT DPRT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPKMSAYERS IML+FA
Sbjct  29   SRGKTFPTHDPRTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFA  88

Query  424  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  603
            DLV+KH  ELA LE+W++GKPYEQ+AKSELP   RLF YYAGWADKIHGLTVPADG HHV
Sbjct  89   DLVDKHRGELAALESWNSGKPYEQSAKSELPSFARLFRYYAGWADKIHGLTVPADGNHHV  148

Query  604  QTLHEPIGVAGQIIPWNFPLAMFAW  678
            QTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  149  QTLHEPIGVAGQIIPWNFPLIMFAW  173



>ref|XP_006647839.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=551

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 152/184 (83%), Gaps = 5/184 (3%)
 Frame = +1

Query  142  IQRFSTAAAVE-----ELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  306
            I RFS A A       E + P VEVKYT+ +ING FVD+ASG+TFPT+DPRT +VIA VA
Sbjct  44   IHRFSAAPAAAGGARGEPIQPPVEVKYTKLLINGNFVDAASGRTFPTVDPRTGEVIARVA  103

Query  307  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  486
            EG+AEDINRAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H +E+ATLETWD GK 
Sbjct  104  EGDAEDINRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLIEQHAEEIATLETWDGGKT  163

Query  487  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  666
             EQ +  E+PM+ R   YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQ+IPWNFPL 
Sbjct  164  LEQTSGKEVPMVARSMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQVIPWNFPLL  223

Query  667  MFAW  678
            MFAW
Sbjct  224  MFAW  227



>gb|AFW63788.1| hypothetical protein ZEAMMB73_379378 [Zea mays]
Length=468

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  181  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  360
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  361  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  540
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  541  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFPL MFAW
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAW  226



>gb|ACG32898.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 157/197 (80%), Gaps = 8/197 (4%)
 Frame = +1

Query  103  SAFLGWKYGVESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            SA LG      + + RFSTA A         + PAVEVK+TQ +ING FVD+ASGKTFPT
Sbjct  33   SALLGSG---AAALHRFSTAPASAAAAAEEPIQPAVEVKHTQLLINGNFVDAASGKTFPT  89

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRT +VIA VAEG++EDI+RAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H +
Sbjct  90   LDPRTGEVIARVAEGDSEDIDRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLIERHAE  149

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            E+A LETWDNGK   QAA +E+PM+ R   YYAGWADKIHGL  PADG HHVQ LHEP+G
Sbjct  150  EVAALETWDNGKTLAQAAGAEVPMVARCVRYYAGWADKIHGLVAPADGAHHVQVLHEPVG  209

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL MFAW
Sbjct  210  VAGQIIPWNFPLLMFAW  226



>dbj|BAB92018.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=551

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  181  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  360
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  62   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  121

Query  361  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  540
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  122  DEGPWPRMTAYERCRVLLRFADLIERHAEEIAALETWDNGKTLAQAAGAEVPMVARCIRY  181

Query  541  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            YAGWADKIHGL VP DG HHVQ LHEP+GVAGQIIPWNFPL MFAW
Sbjct  182  YAGWADKIHGLVVPGDGAHHVQVLHEPVGVAGQIIPWNFPLLMFAW  227



>gb|EEC73936.1| hypothetical protein OsI_08800 [Oryza sativa Indica Group]
Length=553

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  181  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  360
            + P V+VKYT+ +ING FVD+ASGKTF T+DPRT DVIA VAEG+AED+NRAVAAAR+AF
Sbjct  64   IQPPVDVKYTKLLINGNFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNRAVAAARRAF  123

Query  361  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  540
            DEGPWP+M+AYER R++L+FADL+E+H DE+A LETWD GK  EQ   +E+PM+ R   Y
Sbjct  124  DEGPWPRMTAYERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARYMRY  183

Query  541  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            Y GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  184  YGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  229



>gb|KHN05814.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=403

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 147/190 (77%), Gaps = 18/190 (9%)
 Frame = +1

Query  115  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDS--ASGKTFPTLDPRTED  288
            G   G    + RFSTAAAVEEL+ P V + YT+H+ING+FVD+  ASGKTFPT DPRT +
Sbjct  19   GRNSGKWGNVNRFSTAAAVEELIIPQVPITYTKHLINGQFVDADAASGKTFPTYDPRTGE  78

Query  289  VIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLET  468
            VIA VAEG+AEDINRAV+AARKAFDEGPWPKM+AY              KH DELA L+T
Sbjct  79   VIARVAEGDAEDINRAVSAARKAFDEGPWPKMTAY--------------KHSDELAALKT  124

Query  469  WDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIP  648
            W+NGKPYEQ A SELP  VRLF YYA  ADKIHGLTVPADG +HV+TLHE IGVAGQIIP
Sbjct  125  WNNGKPYEQWATSELPTFVRLFRYYA--ADKIHGLTVPADGNYHVETLHELIGVAGQIIP  182

Query  649  WNFPLAMFAW  678
            WNFPL MFAW
Sbjct  183  WNFPLLMFAW  192



>ref|NP_001048010.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAA96793.1| mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa Japonica 
Group]
 dbj|BAD15919.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16358.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAF09924.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAH00573.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57740.1| hypothetical protein OsJ_08254 [Oryza sativa Japonica Group]
Length=553

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  181  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  360
            + P V+VKYT+ +ING FVD+ASGKTF T+DPRT DVIA VAEG+AED+NRAVAAAR+AF
Sbjct  64   IQPPVDVKYTKLLINGNFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNRAVAAARRAF  123

Query  361  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  540
            DEGPWP+M+AYER R++L+FADL+E+H DE+A LETWD GK  EQ   +E+PM+ R   Y
Sbjct  124  DEGPWPRMTAYERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARYMRY  183

Query  541  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            Y GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAW
Sbjct  184  YGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAW  229



>ref|NP_001105576.1| aldehyde dehydrogenase2 [Zea mays]
 gb|AAL99613.1|AF348417_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
Length=550

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 157/197 (80%), Gaps = 8/197 (4%)
 Frame = +1

Query  103  SAFLGWKYGVESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPT  267
            SA LG      + + RFSTA A         + PAVEVK+TQ +ING FVD+ASGKTFPT
Sbjct  33   SALLGSG---AAALHRFSTAPASAAAAAEEPIQPAVEVKHTQLLINGNFVDAASGKTFPT  89

Query  268  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  447
            LDPRT +VIA VAEG++EDI+RAVAAAR+AFDEGPWP+M+AY+R R++L+FADL+E+H +
Sbjct  90   LDPRTGEVIARVAEGDSEDIDRAVAAARRAFDEGPWPRMTAYDRCRVLLRFADLIERHAE  149

Query  448  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  627
            E+A LETWDNGK   QAA +E+PM+ R   YYAGWADKIHGL  PADG HHVQ LHEP+G
Sbjct  150  EVAALETWDNGKTLAQAAGAEVPMVARCVRYYAGWADKIHGLVAPADGAHHVQVLHEPVG  209

Query  628  VAGQIIPWNFPLAMFAW  678
            VAGQIIPWNFPL MFAW
Sbjct  210  VAGQIIPWNFPLLMFAW  226



>gb|AAL99614.2|AF348418_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
 gb|AFW63789.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  181  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  360
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  361  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  540
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  541  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFPL MFAW
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAW  226



>gb|AHM26657.1| aldehyde dehydrogenase 2-2 [Zea mays subsp. mays]
Length=550

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  181  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  360
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  361  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  540
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  541  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFPL MFAW
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAW  226



>gb|ABD35815.1| putative mitochondrial aldehyde dehydrogenase [Populus x canadensis]
Length=149

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRA  336
            T AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ ED+NRA
Sbjct  1    TLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVEDVNRA  60

Query  337  VAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELP  516
            V+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKPYEQ+AK E+P
Sbjct  61   VSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPYEQSAKIEIP  120

Query  517  MIVRLFHYYAGWADKIHGLTVPADGPHHV  603
            M VR+F YYAGWADKIHGLTVPADGP+HV
Sbjct  121  MTVRIFRYYAGWADKIHGLTVPADGPYHV  149



>gb|EMT22926.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=678

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = +1

Query  142  IQRFSTAAAV---EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  312
            + RFSTA A    EE + P VEVKYTQ +ING FVD+ASG+TFPT+DPRT +VIA VAEG
Sbjct  40   VYRFSTAPAATADEEPIKPPVEVKYTQLLINGNFVDAASGRTFPTVDPRTGEVIARVAEG  99

Query  313  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  492
            +AEDI+RAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H DE+A  E+WD GKP E
Sbjct  100  DAEDIDRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLMERHNDEIAARESWDGGKPLE  159

Query  493  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  672
            Q+A  E+P   R    YAGWADKIHG+ VPADGPHHVQ L EPIGVAGQIIPWN PL MF
Sbjct  160  QSAGGEVPRAARCMRSYAGWADKIHGMVVPADGPHHVQVLREPIGVAGQIIPWNVPLLMF  219

Query  673  AW  678
            AW
Sbjct  220  AW  221



>ref|XP_006439785.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53025.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=478

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  244  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  423
            A GKTFP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ A
Sbjct  10   ALGKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAA  69

Query  424  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  603
            DL+EK+M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+
Sbjct  70   DLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHI  129

Query  604  QTLHEPIGVAGQIIPWNFPLAMFAW  678
            QTLHEPIGVAGQI+PWNFPL +F W
Sbjct  130  QTLHEPIGVAGQIVPWNFPLLLFTW  154



>ref|XP_001785650.1| predicted protein [Physcomitrella patens]
 gb|EDQ49530.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            VEVK T+ +I+G+FVD+ASGKTFPT+DPR+E VIAHVAEG+ ED+NRAV AARKAFD GP
Sbjct  45   VEVKLTKLLIDGEFVDAASGKTFPTIDPRSEQVIAHVAEGDVEDVNRAVRAARKAFDHGP  104

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            WPKM  ++R RI+LK+ADL+++H DELA LET D+GKPYEQA  +ELP++ R F Y+AGW
Sbjct  105  WPKMPPFQRQRILLKYADLLDQHADELAALETMDSGKPYEQARYAELPLMSRQFRYFAGW  164

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKI G T P+DG H VQTLHEPIGV GQIIPWNFPL M+ W
Sbjct  165  ADKIFGTTGPSDGIHAVQTLHEPIGVVGQIIPWNFPLVMYCW  206



>gb|AAK57987.1| T cytoplasm male sterility restorer factor 2, partial [Zea mays]
Length=129

 Score =   229 bits (585),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  277  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  456
            RT +VIAHVAEG+AEDINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA
Sbjct  1    RTGEVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELA  60

Query  457  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  636
             LETWDNGKPYEQAA+ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAG
Sbjct  61   ALETWDNGKPYEQAAQIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAG  120

Query  637  QIIPWNF  657
            QIIP  F
Sbjct  121  QIIPGTF  127



>emb|CDY49384.1| BnaA03g50730D [Brassica napus]
Length=257

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = +1

Query  181  VSPA--VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARK  354
            VSP   ++  YTQ   NG FV +ASGKTFP LD RT++VIA+VAEG+AEDINRA+ AARK
Sbjct  91   VSPTFFIQFSYTQFPNNGNFVGAASGKTFPALDTRTKEVIANVAEGDAEDINRAMKAARK  150

Query  355  AFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLF  534
            + DEG WPKM AYE S+I+L+F  LVEKH +ELA L+T  NG  Y+QA  +E+ MI  LF
Sbjct  151  SIDEGAWPKMIAYENSKIVLRFTYLVEKHSEELAALDTCGNGNTYDQAKTAEIAMIAGLF  210

Query  535  HYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  675
               AG ADKIHGLT+PA+G +HVQTLHEPI VAGQIIPWNFPL MFA
Sbjct  211  CNDAGGADKIHGLTIPANGNYHVQTLHEPICVAGQIIPWNFPLLMFA  257



>ref|XP_002978501.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
 gb|EFJ20487.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
Length=497

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +1

Query  235  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  414
            + +  G+TFPT+DPRTE+V+A VA+ + EDINRAV AARKAFD GPWP+M+AYERS+I+L
Sbjct  25   IGACPGETFPTVDPRTEEVLADVAKADVEDINRAVKAARKAFDHGPWPRMTAYERSKILL  84

Query  415  KFADLVEKHMDELATLETWDNGKPYEQAAKSELP-MIVRLFHYYAGWADKIHGLTVPADG  591
            K+ADL+EKH DELATL++ D+GK Y Q+   E+P  + RLF YYAGWADKIHG T+PADG
Sbjct  85   KYADLLEKHNDELATLDSLDSGKLYSQSQGVEIPHFVTRLFRYYAGWADKIHGKTLPADG  144

Query  592  PHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            PH V T HEPIGV GQIIPWNFP+ MFAW
Sbjct  145  PHQVLTFHEPIGVVGQIIPWNFPMVMFAW  173



>ref|XP_002970420.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
 gb|EFJ28550.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
Length=488

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  253  KTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLV  432
            +TFPT+DPRTE+V+A VA+ + EDINRAV AARKAFD GPWP+M+AYERS+I+LK+ADL+
Sbjct  22   ETFPTVDPRTEEVLADVAKADVEDINRAVKAARKAFDHGPWPRMTAYERSKILLKYADLL  81

Query  433  EKHMDELATLETWDNGKPYEQAAKSELP-MIVRLFHYYAGWADKIHGLTVPADGPHHVQT  609
            EKH DELATL++ D+GK Y Q+   E+P  + RLF YYAGWADKIHG T+PADGPH V T
Sbjct  82   EKHNDELATLDSLDSGKLYSQSQGVEIPHFVTRLFRYYAGWADKIHGKTLPADGPHQVLT  141

Query  610  LHEPIGVAGQIIPWNFPLAMFAW  678
             HEPIGV GQIIPWNFP+ MFAW
Sbjct  142  FHEPIGVVGQIIPWNFPMVMFAW  164



>ref|XP_002983210.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
 gb|EFJ15552.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
Length=483

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  244  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  423
            A+GKTFPT+DPR+E++IA VAEG+ ED+NRAV AAR AF++GPWP+M+AYERS+I+ ++A
Sbjct  15   ATGKTFPTIDPRSEEIIAQVAEGDEEDVNRAVKAARNAFEKGPWPRMTAYERSKILFRYA  74

Query  424  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  603
            DL+E+H DEL  L+  D+GK  +QA  +E+P ++R F YYAGWADKIHG+T+ AD PHHV
Sbjct  75   DLLEQHSDELVALDVLDSGKTIDQATFAEMPNVIRWFRYYAGWADKIHGMTLQADSPHHV  134

Query  604  QTLHEPIGVAGQIIPWNFPLAMFAW  678
             TLHEP+GV GQI+PWNFP+ MF+W
Sbjct  135  HTLHEPVGVVGQIVPWNFPMIMFSW  159



>ref|WP_036269309.1| betaine-aldehyde dehydrogenase [Methylocaldum szegediense]
Length=492

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 132/169 (78%), Gaps = 1/169 (1%)
 Frame = +1

Query  175  ELVSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  351
            +L++P+ +++  T+ +I+GK+VDSASGKTF T++P T +VIAHVAEG+ ED++RAV AAR
Sbjct  6    KLINPSEIKISQTKMLIDGKWVDSASGKTFETINPATGEVIAHVAEGDREDVDRAVRAAR  65

Query  352  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  531
            KAF+EGPW KMSA ER R + + ADL+EKH DELA LET +NGKP  ++  ++LP+ +  
Sbjct  66   KAFEEGPWRKMSARERGRCLYRLADLIEKHFDELAALETLNNGKPINESRSADLPLTIEC  125

Query  532  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            + YYAGWADKI G T+P +GP    T HEP+GV GQIIPWNFPL M AW
Sbjct  126  YRYYAGWADKIEGKTIPINGPFFTYTRHEPVGVVGQIIPWNFPLLMQAW  174



>ref|XP_002961352.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
 gb|EFJ38891.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
Length=491

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  253  KTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLV  432
            KTFPT+DPR+E++IA VAEG+ ED+NRAV AAR AF++GPWP+M+AYERS+I+ ++ADL+
Sbjct  26   KTFPTIDPRSEEIIAQVAEGDEEDVNRAVKAARNAFEKGPWPRMTAYERSKILFRYADLL  85

Query  433  EKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTL  612
            E+H DEL  L+  DNGK  +QA  +E+P ++R F YYAGWADKIHG+T+ AD PHHV TL
Sbjct  86   EQHSDELVALDVLDNGKTIDQATFAEMPNVIRWFRYYAGWADKIHGMTLQADSPHHVHTL  145

Query  613  HEPIGVAGQIIPWNFPLAMFAW  678
            HEPIGV GQI+PWNFP+ MF+W
Sbjct  146  HEPIGVVGQIVPWNFPIIMFSW  167



>ref|XP_002983288.1| hypothetical protein SELMODRAFT_180171 [Selaginella moellendorffii]
 gb|EFJ15630.1| hypothetical protein SELMODRAFT_180171 [Selaginella moellendorffii]
Length=500

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +1

Query  181  VSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKA  357
            + PA V VKYT+  I+G+FVD+ SG+TF TLDPR  +VI+ VAE + +D++ AV AARKA
Sbjct  11   IGPAPVSVKYTKLFIDGQFVDAVSGRTFETLDPRNGEVISKVAEADKQDVDVAVKAARKA  70

Query  358  FDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFH  537
            FD GPWP++S Y R RI+LKFADL+E H DELA LET DNGKP +     +LPM +RL  
Sbjct  71   FDHGPWPRLSGYARGRILLKFADLLEHHFDELAALETLDNGKPLDLVKYVDLPMALRLLR  130

Query  538  YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  672
             +AG+ADKI G TV  DGP+H  TL EPIGV GQIIPWNFPL MF
Sbjct  131  SFAGFADKICGKTVKIDGPYHAYTLLEPIGVVGQIIPWNFPLIMF  175



>ref|XP_002961274.1| hypothetical protein SELMODRAFT_164447 [Selaginella moellendorffii]
 gb|EFJ38813.1| hypothetical protein SELMODRAFT_164447 [Selaginella moellendorffii]
Length=500

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +1

Query  181  VSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKA  357
            + PA V VKYT+  I+G+FVD+ SG+TF TLDPR  +VI+ VAE + +D++ AV AARKA
Sbjct  11   IGPAPVSVKYTKLFIDGQFVDAVSGRTFETLDPRNGEVISKVAEADKQDVDVAVKAARKA  70

Query  358  FDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFH  537
            FD GPWP++S Y R RI+LKFADL+E H DELA LET DNGKP +     +LPM +RL  
Sbjct  71   FDHGPWPRLSGYARGRILLKFADLLEHHFDELAALETLDNGKPLDLVKYVDLPMALRLLR  130

Query  538  YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  672
             +AG+ADKI G TV  DGP+H  TL EPIGV GQIIPWNFPL MF
Sbjct  131  SFAGFADKICGKTVKIDGPYHAYTLLEPIGVVGQIIPWNFPLIMF  175



>ref|WP_036502729.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
 gb|KFI21710.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
Length=494

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            VEV+ T+ +I+GKF DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGKFCDSLSGKTFATIDPATEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WHRMDARERGRRMLKWADLIEAHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKIHG T+P  GP    T  EP+GV G IIPWNFPLAM AW
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNFPLAMAAW  176



>ref|WP_002814365.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
 gb|ABA59058.1| aldehyde dehydrogenase (acceptor) [Nitrosococcus oceani ATCC 
19707]
 gb|EDZ65209.1| aldehyde dehydrogenase (NAD) family protein [Nitrosococcus oceani 
AFC27]
 gb|KFI18483.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani C-27]
Length=494

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            VEV+ T+ +I+GKF DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGKFCDSLSGKTFATIDPATEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WHRMDARERGRRMLKWADLIEAHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKIHG T+P  GP    T  EP+GV G IIPWNFPLAM AW
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNFPLAMAAW  176



>emb|CDW77748.1| betaine-aldehyde dehydrogenase [Stylonychia lemnae]
Length=502

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            V+ + TQ +I+GKFV+S SGKTF T +P TE+ I  V E +  D+++AV AARKAFDEGP
Sbjct  17   VQPRLTQLLIDGKFVNSVSGKTFDTFNPSTEEKIISVQEADKHDVDKAVNAARKAFDEGP  76

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            W +M+A ER +IM +FADLVEKH DELA LE  DNGKP   A  +++P++V    YYAGW
Sbjct  77   WRRMAASERGKIMYRFADLVEKHTDELANLEALDNGKPAAIAKIADIPLVVNTLRYYAGW  136

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             DKIHG T+P +GP+   T  EP+GV GQIIPWNFP AM AW
Sbjct  137  TDKIHGKTIPVNGPYFAYTKEEPVGVCGQIIPWNFPAAMLAW  178



>gb|ABR16485.1| unknown [Picea sitchensis]
Length=500

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = +1

Query  181  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  360
            V P V VKYT+  ING+FVDS SGKTF TLDPRT + I  V+E + ED++ AV AAR AF
Sbjct  11   VLPPVTVKYTKLFINGEFVDSVSGKTFETLDPRTGEAITRVSEAQKEDVDLAVKAARAAF  70

Query  361  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  540
            D GPWP+MS +ER RI+ K+ADLV +H DELA LET+DNGKP + A   ++P  V +  Y
Sbjct  71   DHGPWPRMSGFERGRILYKYADLVSQHGDELAALETFDNGKPLDMARILDIPYSVEVIRY  130

Query  541  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  672
             AG+ADKIHGLT+   G +   TLHEPIGV GQ+IPWNFP+  F
Sbjct  131  NAGFADKIHGLTLKMSGQYQGYTLHEPIGVVGQMIPWNFPILTF  174



>ref|WP_013034365.1| betaine-aldehyde dehydrogenase [Nitrosococcus halophilus]
 gb|ADE16516.1| Retinal dehydrogenase [Nitrosococcus halophilus Nc 4]
Length=494

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            VEV+ T+ +I+G+F DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGEFRDSLSGKTFATIDPVTEEVIAQVAEGDAEDIDLAVKAARKAFDTGP  74

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WQQMDARERGRRMLKWADLIETHMEELAKLEVLDNGKPINEALGYDIPSAAATIRYFAGW  134

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKIHG T+P  GP    T  EP+GV G IIPWNFPLAM AW
Sbjct  135  ADKIHGKTIPVSGPFFTYTRREPVGVCGLIIPWNFPLAMAAW  176



>gb|EWM25899.1| aldehyde dehydrogenase [Nannochloropsis gaditana]
Length=601

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 129/188 (69%), Gaps = 5/188 (3%)
 Frame = +1

Query  130  VESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  294
            + +  +RF++  AV  L     + P+   + TQ +I+GKF D+ SGKTF T+DPRTE+ I
Sbjct  38   LSTACKRFASFKAVRGLHNAAPIKPSHHPRITQLLIDGKFTDAVSGKTFQTIDPRTEETI  97

Query  295  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  474
              VA  + ED+N AV AARKAF+ GPW KMS  ER +I+ + ADL+E H +ELA LET D
Sbjct  98   VEVAAADKEDVNLAVNAARKAFETGPWRKMSGRERGKILFRLADLMEAHKEELAVLETLD  157

Query  475  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  654
            NGKP   +  S++P+ +  + Y+AGWADKIHG T+P DGP    TL EP+GV GQIIPWN
Sbjct  158  NGKPLSLSRNSDVPLAIDHYRYFAGWADKIHGQTIPVDGPFFAYTLREPVGVVGQIIPWN  217

Query  655  FPLAMFAW  678
            FPL M AW
Sbjct  218  FPLLMQAW  225



>ref|WP_013219586.1| betaine-aldehyde dehydrogenase [Nitrosococcus watsonii]
 gb|ADJ27478.1| Retinal dehydrogenase [Nitrosococcus watsonii C-113]
Length=494

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 118/162 (73%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            V V+ T+ +I+G+F +S SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VAVRQTRLLIDGEFRNSLSGKTFATVDPSTEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WRQMDARERGRRMLKWADLIEDHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKIHG T+P  GP    T  EP+GV G IIPWNFPLAM AW
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNFPLAMAAW  176



>ref|WP_015249427.1| betaine-aldehyde dehydrogenase [Singulisphaera acidiphila]
 gb|AGA30341.1| NAD-dependent aldehyde dehydrogenase [Singulisphaera acidiphila 
DSM 18658]
Length=491

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  208  TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS  387
            T+ +I+GK+ DS SGKTF T++P TE+VIA VAEG+A DI+ AV AARKAFD GPW KM 
Sbjct  17   TKLLIDGKWRDSLSGKTFDTVNPATEEVIAQVAEGDAADIDLAVKAARKAFDSGPWRKMD  76

Query  388  AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH  567
            A +R R+M +FADL+E+++DELA LET DNGKP  ++  ++LP+++  F YYAGWADKI 
Sbjct  77   ARDRGRLMNRFADLIEENVDELAELETLDNGKPIGESRHADLPLVIDCFRYYAGWADKIS  136

Query  568  GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            G TVP  G     T  EPIGVAGQIIPWNFP+ M AW
Sbjct  137  GQTVPIRGNFFCYTKREPIGVAGQIIPWNFPMLMVAW  173



>ref|WP_002643666.1| betaine-aldehyde dehydrogenase [Planctomyces maris]
 gb|EDL62339.1| aldehyde dehydrogenase [Planctomyces maris DSM 8797]
Length=492

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 127/173 (73%), Gaps = 0/173 (0%)
 Frame = +1

Query  160  AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAV  339
            A  + + V+   +++ TQ +I+GK+VD+ SGKTF T++P TE+VIA VAEG+A DI+ AV
Sbjct  2    ATEILDTVANTPQIRQTQLLIDGKWVDAISGKTFATINPATEEVIAEVAEGDAADIDLAV  61

Query  340  AAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPM  519
             AARKAF+ GPW KM A +R R++ + ADL+E++++ELA LE+ DNGKP   +  ++LP+
Sbjct  62   KAARKAFESGPWSKMDARDRGRLIYRLADLIEENIEELAALESLDNGKPIRDSRAADLPL  121

Query  520  IVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ++    YYAGWADKI G T+P  G H   T  EP+GVAGQIIPWNFPL M AW
Sbjct  122  VIDCLRYYAGWADKIEGTTIPIRGNHFCYTRREPLGVAGQIIPWNFPLLMVAW  174



>ref|WP_021832205.1| Aldehyde dehydrogenase [Crocosphaera watsonii]
 emb|CCQ53790.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0005]
Length=356

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  37   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  96

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  97   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  156

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AW
Sbjct  157  ADKIQGKTIPINGPYFCYTSHEPVGVVGQIIPWNFPLLMQAW  198



>ref|XP_003608940.1| Aldehyde dehydrogenase [Medicago truncatula]
Length=282

 Score =   198 bits (504),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  112  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  291
            LG K        RFSTAAAV+EL++P V + YTQH+INGKFVD+ASGKTFPTLDPRT +V
Sbjct  32   LGRKSEGLINTNRFSTAAAVQELITPQVSINYTQHLINGKFVDAASGKTFPTLDPRTGEV  91

Query  292  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  471
            IAHVAEG+AEDINRAV+AAR+AFD GPWPKMSAYER RI+L+FADLVEKH DE+A LE W
Sbjct  92   IAHVAEGDAEDINRAVSAAREAFDNGPWPKMSAYERCRILLRFADLVEKHNDEIAALEAW  151

Query  472  DNGKPYEQA  498
            +NG+  + A
Sbjct  152  NNGRRADDA  160



>gb|EJY82344.1| hypothetical protein OXYTRI_20134 [Oxytricha trifallax]
Length=505

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = +1

Query  154  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  333
            S A A    V+P    K TQ +INGKFV+S SGKTF T +P TE+ IA V E +  D++ 
Sbjct  11   SFATATPAKVTP----KQTQLLINGKFVNSVSGKTFDTFNPATEEKIASVQEADRADVDI  66

Query  334  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  513
            AV AARKAFD G W +M A ER  IML+FADL++KH DELA LE  DNGKPY+ A  +++
Sbjct  67   AVKAARKAFDTGHWRRMDARERGNIMLRFADLIDKHADELAALEALDNGKPYKIAQIADI  126

Query  514  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            P++     YY GWADKIHG T+P  GP+      EP+GV GQIIPWNFP AM AW
Sbjct  127  PLVSNTIRYYGGWADKIHGKTLPISGPYFAYQREEPVGVVGQIIPWNFPAAMLAW  181



>emb|CCQ61589.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0401]
Length=490

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AW
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAW  172



>ref|WP_007307870.1| betaine-aldehyde dehydrogenase [Crocosphaera watsonii]
 gb|EAM48335.1| Aldehyde dehydrogenase (NAD+) [Crocosphaera watsonii WH 8501]
 emb|CCQ51857.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 8502]
Length=490

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AW
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAW  172



>emb|CCQ69085.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0402]
Length=490

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AW
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAW  172



>emb|CDW85535.1| betaine-aldehyde dehydrogenase [Stylonychia lemnae]
Length=315

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD  363
            S  ++ + TQ +INGKFV+SASG+TF T +P TE+ IA V E  AED++RAV AARKAFD
Sbjct  13   STHIKPRVTQLLINGKFVNSASGQTFDTFNPATEEKIASVQEAGAEDVDRAVKAARKAFD  72

Query  364  EGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYY  543
            EGPW +M+A ER +++ K ADL++K+++EL  LE  DNGKP   A + ++P       YY
Sbjct  73   EGPWRRMAASERGKLLCKLADLIDKNVEELGYLEALDNGKPEMIATQGDVPFCAMTLRYY  132

Query  544  AGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAM  669
            AGWADKIHG T+P +GP+   T  EP+GV GQIIPWN+P  M
Sbjct  133  AGWADKIHGKTIPVNGPYFAYTKEEPVGVCGQIIPWNYPTVM  174



>ref|WP_007312907.1| betaine-aldehyde dehydrogenase [Crocosphaera watsonii]
 gb|EHJ10116.1| aldehyde dehydrogenase [Crocosphaera watsonii WH 0003]
Length=490

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +1

Query  193  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  372
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  373  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  552
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  553  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AW
Sbjct  131  ADKIQGKTIPINGPYFCYTSHEPVGVVGQIIPWNFPLLMQAW  172



>ref|WP_008272605.1| betaine-aldehyde dehydrogenase [Cyanothece sp. CCY0110]
 gb|EAZ94265.1| aldehyde dehydrogenase [Cyanothece sp. CCY0110]
Length=490

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  208  TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS  387
            TQ +IN ++++SASGK F T++P T +VI  VAE +AED+++AV AAR AF++G WP +S
Sbjct  16   TQLLINNEWIESASGKRFETINPTTGEVICDVAEADAEDVDKAVKAARNAFNQGDWPNLS  75

Query  388  AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH  567
            A +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGWADKI 
Sbjct  76   ASQRGKLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGWADKIQ  135

Query  568  GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
            G T+P +GP+   T HEP+GV GQIIPWNFPL M AW
Sbjct  136  GKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAW  172



>ref|XP_005642981.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE18437.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=486

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +1

Query  211  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA  390
            Q +INGKF D++ GKTF T+DPRT + +  VAE +AED++RAV AAR+AFD GPWP+MS 
Sbjct  6    QLLINGKFEDASGGKTFETMDPRTGEPLMTVAEAQAEDVDRAVKAARQAFDHGPWPRMSG  65

Query  391  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG  570
             +R  IM K A L+EK+ +ELATLE+ DNGK Y  A   ++PM V    YYAGWADKI+G
Sbjct  66   RQRGNIMHKLATLMEKNTEELATLESLDNGKAYSAAFSIDVPMAVEHLRYYAGWADKIYG  125

Query  571  LTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  678
             T+P DG     TL EP+GV GQIIPWNFP+ M AW
Sbjct  126  QTIPTDGKMQAYTLKEPLGVVGQIIPWNFPILMQAW  161



Lambda      K        H        a         alpha
   0.317    0.132    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240