BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038N05

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073026.1|  PREDICTED: uncharacterized protein LOC105158...    270   5e-81   Sesamum indicum [beniseed]
ref|XP_011073024.1|  PREDICTED: uncharacterized protein LOC105158...    270   6e-81   Sesamum indicum [beniseed]
gb|EYU23118.1|  hypothetical protein MIMGU_mgv1a0011952mg               242   4e-77   Erythranthe guttata [common monkey flower]
ref|XP_010319061.1|  PREDICTED: uncharacterized protein LOC101264...    254   1e-75   
ref|XP_010319059.1|  PREDICTED: uncharacterized protein LOC101264...    254   5e-75   Solanum lycopersicum
ref|XP_010319060.1|  PREDICTED: uncharacterized protein LOC101264...    254   6e-75   Solanum lycopersicum
ref|XP_010319058.1|  PREDICTED: uncharacterized protein LOC101264...    254   6e-75   
ref|XP_006351477.1|  PREDICTED: uncharacterized protein LOC102586834    250   9e-74   Solanum tuberosum [potatoes]
ref|XP_009774848.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    251   9e-74   Nicotiana sylvestris
ref|XP_009595697.1|  PREDICTED: uncharacterized protein LOC104091...    250   1e-73   Nicotiana tomentosiformis
ref|XP_009595689.1|  PREDICTED: uncharacterized protein LOC104091...    250   1e-73   
ref|XP_007037950.1|  RNA-metabolising metallo-beta-lactamase fami...    249   1e-72   
ref|XP_010105237.1|  Ribonuclease J                                     248   1e-72   
gb|KJB19806.1|  hypothetical protein B456_003G119600                    246   3e-72   Gossypium raimondii
ref|XP_010250772.1|  PREDICTED: uncharacterized protein LOC104592...    246   4e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010250771.1|  PREDICTED: uncharacterized protein LOC104592...    246   4e-72   Nelumbo nucifera [Indian lotus]
ref|XP_006477010.1|  PREDICTED: uncharacterized protein LOC102606...    246   4e-72   
ref|XP_006440090.1|  hypothetical protein CICLE_v10018763mg             246   5e-72   Citrus clementina [clementine]
ref|XP_002511207.1|  conserved hypothetical protein                     245   9e-72   
emb|CBI15641.3|  unnamed protein product                                245   3e-70   Vitis vinifera
ref|XP_006827615.1|  hypothetical protein AMTR_s00009p00241540          238   2e-69   Amborella trichopoda
ref|XP_010677898.1|  PREDICTED: uncharacterized protein LOC104893...    239   3e-69   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS67461.1|  hypothetical protein M569_07313                         238   3e-69   Genlisea aurea
ref|XP_002279798.1|  PREDICTED: uncharacterized protein LOC100268...    238   5e-69   Vitis vinifera
ref|XP_002318122.2|  hypothetical protein POPTR_0012s09780g             238   6e-69   Populus trichocarpa [western balsam poplar]
gb|KJB08022.1|  hypothetical protein B456_001G059600                    237   9e-69   Gossypium raimondii
gb|KDP30936.1|  hypothetical protein JCGZ_11312                         236   2e-68   Jatropha curcas
ref|XP_011024044.1|  PREDICTED: uncharacterized protein LOC105125338    236   2e-68   Populus euphratica
gb|AFW66257.2|  hypothetical protein ZEAMMB73_692349                    223   3e-68   
gb|KHG17441.1|  Ribonuclease J                                          235   4e-68   Gossypium arboreum [tree cotton]
emb|CAN81787.1|  hypothetical protein VITISV_026006                     238   5e-68   Vitis vinifera
ref|XP_002321691.2|  hypothetical protein POPTR_0015s10570g             234   7e-68   Populus trichocarpa [western balsam poplar]
gb|KFK28054.1|  hypothetical protein AALP_AA8G465700                    234   7e-68   Arabis alpina [alpine rockcress]
ref|XP_010444239.1|  PREDICTED: uncharacterized protein LOC104726958    234   8e-68   Camelina sativa [gold-of-pleasure]
dbj|BAB08807.1|  unnamed protein product                                228   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044175.1|  PREDICTED: uncharacterized protein LOC105139...    234   1e-67   Populus euphratica
ref|XP_007210498.1|  hypothetical protein PRUPE_ppa001238mg             233   2e-67   
ref|XP_007210499.1|  hypothetical protein PRUPE_ppa001238mg             233   2e-67   
ref|XP_004161356.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease...    233   2e-67   
ref|XP_004138055.1|  PREDICTED: ribonuclease J-like                     233   2e-67   Cucumis sativus [cucumbers]
gb|KGN63492.1|  hypothetical protein Csa_1G002120                       233   2e-67   Cucumis sativus [cucumbers]
ref|XP_008239449.1|  PREDICTED: uncharacterized protein LOC103338047    233   3e-67   Prunus mume [ume]
ref|XP_008464473.1|  PREDICTED: uncharacterized protein LOC103502...    233   3e-67   Cucumis melo [Oriental melon]
ref|XP_008464474.1|  PREDICTED: uncharacterized protein LOC103502...    233   3e-67   Cucumis melo [Oriental melon]
gb|AFW70509.1|  hypothetical protein ZEAMMB73_357548                    216   4e-67   
ref|XP_006394279.1|  hypothetical protein EUTSA_v10003624mg             232   5e-67   Eutrema salsugineum [saltwater cress]
ref|XP_009419382.1|  PREDICTED: uncharacterized protein LOC103999...    231   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP10033.1|  unnamed protein product                                231   2e-66   Coffea canephora [robusta coffee]
ref|NP_201147.2|  RNase J                                               230   3e-66   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44310.1|  putative protein                                       230   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009359453.1|  PREDICTED: uncharacterized protein LOC103950...    229   5e-66   Pyrus x bretschneideri [bai li]
ref|XP_002864846.1|  EMB2746                                            229   6e-66   
ref|XP_010484076.1|  PREDICTED: uncharacterized protein LOC104762480    228   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009375227.1|  PREDICTED: uncharacterized protein LOC103964...    228   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_009346516.1|  PREDICTED: uncharacterized protein LOC103938240    228   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_010519514.1|  PREDICTED: uncharacterized protein LOC104798...    228   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_010519515.1|  PREDICTED: uncharacterized protein LOC104798...    228   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_008811803.1|  PREDICTED: uncharacterized protein LOC103722...    225   3e-65   
ref|XP_008392826.1|  PREDICTED: uncharacterized protein LOC103455...    227   5e-65   
ref|XP_008374252.1|  PREDICTED: uncharacterized protein LOC103437...    226   6e-65   
ref|XP_008645344.1|  PREDICTED: uncharacterized protein LOC103626...    226   6e-65   Zea mays [maize]
ref|XP_008811801.1|  PREDICTED: uncharacterized protein LOC103722...    226   8e-65   Phoenix dactylifera
dbj|BAD28842.1|  putative metallo beta subunit lactamase                220   9e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006279731.1|  hypothetical protein CARUB_v10027519mg             225   2e-64   Capsella rubella
ref|XP_007155529.1|  hypothetical protein PHAVU_003G209600g             223   7e-64   Phaseolus vulgaris [French bean]
ref|XP_002451689.1|  hypothetical protein SORBIDRAFT_04g005900          223   7e-64   Sorghum bicolor [broomcorn]
ref|XP_007155530.1|  hypothetical protein PHAVU_003G209600g             223   7e-64   Phaseolus vulgaris [French bean]
ref|XP_010909137.1|  PREDICTED: uncharacterized protein LOC105035...    223   8e-64   Elaeis guineensis
emb|CDX84407.1|  BnaC03g50930D                                          222   2e-63   
ref|XP_010045503.1|  PREDICTED: uncharacterized protein LOC104434227    222   2e-63   
gb|KCW83176.1|  hypothetical protein EUGRSUZ_B00129                     222   2e-63   Eucalyptus grandis [rose gum]
gb|EEE57142.1|  hypothetical protein OsJ_07047                          222   2e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EMS68688.1|  Ribonuclease J                                          213   2e-63   Triticum urartu
gb|EEC73354.1|  hypothetical protein OsI_07566                          221   3e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_004297533.1|  PREDICTED: uncharacterized protein LOC101299666    221   7e-63   Fragaria vesca subsp. vesca
gb|AES91056.2|  RNA-metabolising metallo-beta-lactamase                 219   9e-63   Medicago truncatula
ref|XP_003608859.1|  Ribonuclease J                                     219   1e-62   
ref|XP_010460357.1|  PREDICTED: uncharacterized protein LOC104741250    219   3e-62   
ref|XP_009150395.1|  PREDICTED: uncharacterized protein LOC103873754    219   3e-62   Brassica rapa
ref|XP_004952679.1|  PREDICTED: uncharacterized protein LOC101761...    218   4e-62   Setaria italica
ref|XP_006578697.1|  PREDICTED: uncharacterized protein LOC100783...    218   4e-62   Glycine max [soybeans]
ref|XP_003522430.1|  PREDICTED: uncharacterized protein LOC100783...    218   4e-62   Glycine max [soybeans]
ref|XP_007137930.1|  hypothetical protein PHAVU_009G167400g             218   4e-62   Phaseolus vulgaris [French bean]
gb|KHN31905.1|  Ribonuclease J                                          218   4e-62   Glycine soja [wild soybean]
emb|CDY41516.1|  BnaA06g22690D                                          220   5e-62   Brassica napus [oilseed rape]
ref|XP_006600800.1|  PREDICTED: uncharacterized protein LOC100814...    217   1e-61   Glycine max [soybeans]
ref|XP_006600801.1|  PREDICTED: uncharacterized protein LOC100814...    217   1e-61   Glycine max [soybeans]
ref|XP_004500652.1|  PREDICTED: ribonuclease J-like isoform X1          216   3e-61   Cicer arietinum [garbanzo]
gb|EMT12329.1|  Ribonuclease J                                          215   6e-61   
ref|XP_006581877.1|  PREDICTED: uncharacterized protein LOC100779...    214   1e-60   Glycine max [soybeans]
ref|XP_006581876.1|  PREDICTED: uncharacterized protein LOC100779...    214   1e-60   Glycine max [soybeans]
gb|KHN23276.1|  Ribonuclease J                                          214   1e-60   Glycine soja [wild soybean]
gb|AES72341.2|  RNA-metabolising metallo-beta-lactamase                 214   2e-60   Medicago truncatula
ref|XP_003602090.1|  Ribonuclease J                                     214   2e-60   
ref|XP_010235506.1|  PREDICTED: uncharacterized protein LOC100825...    211   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_010909140.1|  PREDICTED: uncharacterized protein LOC105035...    205   1e-57   
gb|KHG13818.1|  Ribonuclease J                                          204   2e-57   Gossypium arboreum [tree cotton]
ref|XP_010909138.1|  PREDICTED: uncharacterized protein LOC105035...    205   2e-57   
ref|XP_010909136.1|  PREDICTED: uncharacterized protein LOC105035...    205   3e-57   
ref|XP_002975019.1|  hypothetical protein SELMODRAFT_102611             200   1e-55   
gb|KHN14093.1|  Ribonuclease J                                          199   2e-55   Glycine soja [wild soybean]
ref|XP_002977440.1|  hypothetical protein SELMODRAFT_107166             199   3e-55   
ref|XP_001775526.1|  predicted protein                                  187   7e-52   
ref|XP_001419620.1|  predicted protein                                  145   2e-37   Ostreococcus lucimarinus CCE9901
ref|XP_001692070.1|  hypothetical protein CHLREDRAFT_115745             144   6e-37   Chlamydomonas reinhardtii
ref|XP_007510671.1|  predicted protein                                  147   8e-37   Bathycoccus prasinos
gb|KIZ01083.1|  hypothetical protein MNEG_6877                          137   1e-36   Monoraphidium neglectum
emb|CEF99170.1|  Beta-lactamase-like                                    145   3e-36   Ostreococcus tauri
ref|XP_005846864.1|  hypothetical protein CHLNCDRAFT_35723              146   3e-36   Chlorella variabilis
ref|XP_011400344.1|  Ribonuclease J                                     143   1e-35   Auxenochlorella protothecoides
ref|XP_003057206.1|  predicted protein                                  142   5e-35   Micromonas pusilla CCMP1545
ref|XP_006647352.1|  PREDICTED: uncharacterized protein LOC102710...    141   9e-35   
ref|XP_002949431.1|  hypothetical protein VOLCADRAFT_59321              138   2e-34   Volvox carteri f. nagariensis
gb|ACD36969.1|  chloroplast RNase J variant 1                           140   3e-34   Chlamydomonas reinhardtii
gb|ACD36970.1|  chloroplast RNase J variant 2                           139   4e-34   Chlamydomonas reinhardtii
ref|XP_002505947.1|  predicted protein                                  138   2e-33   Micromonas commoda
gb|KDO52625.1|  hypothetical protein CISIN_1g0392132mg                  119   5e-30   Citrus sinensis [apfelsine]
gb|AIB09652.1|  myb domain-containing regulator of transcription        121   7e-28   Lotharella oceanica
ref|XP_005646511.1|  Metallo-hydrolase/oxidoreductase                   119   3e-27   Coccomyxa subellipsoidea C-169
ref|XP_001712914.1|  regulator of transcription that contains myb...    112   7e-25   Bigelowiella natans
ref|WP_011522894.1|  ribonuclease J                                     102   3e-21   Candidatus Koribacter versatilis
ref|WP_013581330.1|  ribonuclease J                                     101   4e-21   Granulicella tundricola
ref|WP_012731758.1|  ribonuclease J                                     101   6e-21   Corynebacterium kroppenstedtii
gb|ACF24513.1|  myb domain containing transcription regulator           100   7e-21   Gymnochlora stellata
ref|WP_011698454.1|  ribonuclease J                                     100   8e-21   Syntrophobacter fumaroxidans
ref|WP_015752366.1|  ribonuclease J                                     100   9e-21   Desulfohalobium retbaense
ref|WP_020715164.1|  ribonuclease J                                     100   1e-20   Acidobacteriaceae bacterium KBS 89
ref|WP_012934707.1|  ribonuclease J                                     100   1e-20   Conexibacter woesei
ref|WP_007908681.1|  ribonuclease J                                   99.8    2e-20   Ktedonobacter racemifer
ref|WP_031583929.1|  ribonuclease J                                   99.0    3e-20   Selenomonas bovis
ref|WP_035348753.1|  ribonuclease J                                   98.6    4e-20   Edaphobacter aggregans
ref|WP_025779536.1|  ribonuclease J                                   98.6    5e-20   
ref|WP_026388559.1|  ribonuclease J                                   98.2    6e-20   Acidobacteria bacterium KBS 146
ref|WP_043487108.1|  hypothetical protein                             97.8    7e-20   
ref|WP_019541676.1|  ribonuclease J                                   97.8    8e-20   Selenomonas bovis
ref|WP_022258063.1|  hypothetical protein                             98.2    9e-20   
ref|WP_034376707.1|  ribonuclease J                                   97.4    1e-19   Dehalococcoides mccartyi
ref|WP_012984193.1|  ribonuclease J                                   97.4    1e-19   Dehalococcoides mccartyi
ref|WP_011308960.1|  ribonuclease J                                   97.4    1e-19   Dehalococcoides mccartyi
ref|WP_041341370.1|  ribonuclease J                                   97.4    1e-19   Dehalococcoides mccartyi
ref|WP_015407585.1|  beta-lactamase domain-containing protein         97.4    1e-19   Dehalococcoides mccartyi
ref|WP_010936215.1|  ribonuclease J                                   97.4    1e-19   Dehalococcoides
ref|WP_012881709.1|  ribonuclease J                                   97.4    1e-19   Dehalococcoides mccartyi
ref|WP_023651985.1|  metallo-beta-lactamase                           97.4    1e-19   Dehalococcoides mccartyi
ref|WP_015944632.1|  ribonuclease J                                   97.1    1e-19   Desulfitobacterium hafniense
gb|ACD97120.1|  beta-lactamase domain protein                         97.4    1e-19   Geobacter lovleyi SZ
ref|WP_018211211.1|  ribonuclease J                                   97.1    1e-19   Desulfitobacterium hafniense
ref|WP_040598287.1|  ribonuclease J                                   97.1    1e-19   Patulibacter medicamentivorans
ref|WP_026441799.1|  ribonuclease J                                   97.1    1e-19   Acidobacterium ailaaui
gb|EFB89527.1|  hypothetical protein HMPREF7215_0020                  97.4    1e-19   Pyramidobacter piscolens W5455
ref|WP_040397176.1|  ribonuclease J                                   97.1    1e-19   Anaerococcus senegalensis
ref|WP_040551170.1|  ribonuclease J                                   97.1    2e-19   
ref|WP_026446432.1|  ribonuclease J                                   96.7    2e-19   Acidobacteriaceae bacterium URHE0068
ref|WP_019117677.1|  ribonuclease J                                   96.7    2e-19   Anaerococcus obesiensis
ref|WP_022842172.1|  ribonuclease J                                   96.7    2e-19   Acidobacteriaceae bacterium TAA166
ref|WP_044603071.1|  ribonuclease J                                   96.7    2e-19   
ref|WP_021914771.1|  hypothetical protein                             96.7    2e-19   unclassified Firmicutes sensu stricto (miscellaneous)
ref|WP_004813380.1|  ribonuclease J                                   96.7    2e-19   Anaerococcus hydrogenalis
ref|WP_004816729.1|  ribonuclease J                                   96.7    2e-19   Anaerococcus hydrogenalis
gb|ETR72921.1|  ribonuclease J                                        96.7    2e-19   Candidatus Magnetoglobus multicellularis str. Araruama
ref|WP_020708767.1|  ribonuclease J                                   96.3    3e-19   Acidobacteriaceae bacterium KBS 83
ref|WP_033206893.1|  ribonuclease J                                   96.3    3e-19   
ref|WP_029468815.1|  ribonuclease J                                   96.3    3e-19   Blautia coccoides
ref|WP_018598031.1|  hypothetical protein                             96.3    3e-19   Blautia producta
ref|WP_028058567.1|  ribonuclease J                                   96.3    3e-19   Solirubrobacter sp. URHD0082
ref|WP_037977897.1|  ribonuclease J                                   96.3    3e-19   Synergistes jonesii
ref|WP_008539861.1|  MULTISPECIES: ribonuclease J                     96.3    3e-19   Megamonas
ref|WP_040929284.1|  ribonuclease J                                   96.3    3e-19   Nosocomiicoccus massiliensis
ref|WP_014786772.1|  ribonuclease J                                   95.9    4e-19   Terriglobus roseus
gb|EFC90240.1|  beta-lactamase domain protein                         96.3    4e-19   Dethiosulfovibrio peptidovorans DSM 11002
ref|WP_036375186.1|  ribonuclease J                                   95.9    4e-19   Mitsuokella jalaludinii
ref|WP_004827489.1|  ribonuclease J                                   95.9    4e-19   Anaerococcus lactolyticus
ref|WP_022490201.1|  predicted hydrolase of the metallo-beta-lact...  96.3    4e-19   
ref|WP_019115798.1|  ribonuclease J                                   95.9    4e-19   Anaerococcus vaginalis
ref|WP_040382769.1|  ribonuclease J                                   95.9    4e-19   
ref|WP_027369512.1|  ribonuclease J                                   95.5    4e-19   Desulfovermiculus halophilus
ref|WP_015896602.1|  ribonuclease J                                   95.5    5e-19   Acidobacterium capsulatum
ref|WP_022463472.1|  beta-lactamase domain protein                    95.9    5e-19   
ref|WP_015391753.1|  ribonuclease J 1                                 95.5    5e-19   Clostridium saccharoperbutylacetonicum
ref|WP_019879255.1|  ribonuclease J                                   95.5    5e-19   Succinispira mobilis
ref|WP_013175208.1|  ribonuclease J                                   95.5    5e-19   Syntrophothermus lipocalidus
ref|WP_029215441.1|  ribonuclease J                                   95.5    5e-19   bacterium JKG1
ref|WP_040349207.1|  ribonuclease J                                   95.1    6e-19   Anaerococcus tetradius
ref|WP_041970296.1|  ribonuclease J                                   95.1    6e-19   Geobacter sp. OR-1
gb|EEI83558.1|  hypothetical protein HMPREF0077_0287                  95.5    6e-19   Anaerococcus tetradius ATCC 35098
ref|WP_019902763.1|  hypothetical protein                             95.1    7e-19   
ref|WP_020717484.1|  hypothetical protein                             95.1    7e-19   Acidobacteriaceae bacterium KBS 96
ref|WP_013048847.1|  metallo-beta-lactamase                           95.1    7e-19   Aminobacterium colombiense
ref|WP_015777872.1|  ribonuclease J                                   95.1    7e-19   Anaerococcus prevotii
ref|WP_029165798.1|  ribonuclease J                                   95.1    7e-19   Aminiphilus circumscriptus
ref|WP_026911959.1|  ribonuclease J                                   95.1    7e-19   
ref|WP_040590439.1|  ribonuclease                                     95.5    7e-19   Bifidobacteriaceae
ref|WP_015739648.1|  ribonuclease J                                   95.1    7e-19   
ref|WP_026867476.1|  ribonuclease J                                   95.1    8e-19   Jeotgalicoccus marinus
gb|EKD57039.1|  hypothetical protein ACD_58C00017G0005                95.1    9e-19   uncultured bacterium
ref|WP_022118860.1|  metallo-beta-lactamase family protein            94.7    9e-19   
ref|WP_011460280.1|  ribonuclease J                                   94.7    9e-19   Desulfitobacterium hafniense
ref|WP_035213816.1|  ribonuclease J                                   94.7    9e-19   Desulfitobacterium hafniense
ref|WP_018306754.1|  ribonuclease J                                   94.7    9e-19   Desulfitobacterium hafniense
ref|WP_027396918.1|  ribonuclease J                                   94.7    1e-18   Anaerovibrio lipolyticus
ref|WP_021718511.1|  ribonuclease J 1                                 94.7    1e-18   Phascolarctobacterium faecium
ref|WP_039209195.1|  ribonuclease J                                   94.7    1e-18   Anaerovibrio lipolyticus
ref|WP_027405512.1|  ribonuclease J                                   94.7    1e-18   Anaerovibrio sp. RM50
gb|EHL07559.1|  hypothetical protein HMPREF0322_01676                 94.7    1e-18   Desulfitobacterium hafniense DP7
ref|WP_022152842.1|  hypothetical protein                             94.7    1e-18   unclassified Firmicutes sensu stricto (miscellaneous)
ref|WP_027363779.1|  ribonuclease J                                   94.7    1e-18   Desulfallas alcoholivorax
gb|EEU12802.1|  hypothetical protein HMPREF0078_0773                  94.7    1e-18   Anaerococcus vaginalis ATCC 51170
ref|WP_039920503.1|  ribonuclease J                                   94.7    1e-18   Anaerococcus vaginalis
ref|WP_022434989.1|  ribonuclease J 1                                 94.7    1e-18   
ref|WP_018023832.1|  ribonuclease J                                   95.1    1e-18   Corynebacterium ulceribovis
ref|WP_033139463.1|  ribonuclease J                                   94.4    1e-18   Blautia
ref|WP_027426039.1|  ribonuclease J                                   94.4    1e-18   Lachnospiraceae bacterium NC2004
ref|WP_008711909.1|  MULTISPECIES: metallo-beta-lactamase             94.4    1e-18   Synergistaceae
ref|WP_012869230.1|  metallo-beta-lactamase                           94.4    1e-18   Thermanaerovibrio acidaminovorans
ref|WP_044566217.1|  ribonuclease J                                   94.4    1e-18   Anaerococcus provencensis
gb|EFY05518.1|  hypothetical protein HMPREF9443_00479                 94.4    1e-18   Phascolarctobacterium succinatutens YIT 12067
ref|WP_034859832.1|  ribonuclease J [                                 94.4    1e-18   
ref|WP_019138567.1|  ribonuclease J                                   94.4    1e-18   Peptoniphilus timonensis
ref|WP_027889188.1|  ribonuclease J                                   94.4    1e-18   Megamonas hypermegale
ref|WP_041531564.1|  ribonuclease J                                   94.0    1e-18   
ref|WP_021752935.1|  ribonuclease J 1                                 94.0    2e-18   Gemella bergeri
ref|WP_022411946.1|  hypothetical protein                             94.7    2e-18   
ref|WP_022122662.1|  hypothetical protein                             94.0    2e-18   
ref|WP_027434675.1|  ribonuclease J                                   94.0    2e-18   Lachnospiraceae bacterium AB2028
ref|WP_022107384.1|  hypothetical protein                             94.4    2e-18   
gb|EHI58103.1|  hypothetical protein HMPREF9473_03867 [ [             94.0    2e-18   Hungatella hathewayi WAL-18680
ref|WP_002842267.1|  ribonuclease J                                   94.0    2e-18   Finegoldia magna
ref|WP_002845950.1|  MULTISPECIES: ribonuclease J 1                   94.0    2e-18   Peptostreptococcus anaerobius
ref|WP_002838416.1|  ribonuclease J                                   94.0    2e-18   Finegoldia magna
ref|WP_012290528.1|  ribonuclease J                                   94.0    2e-18   Finegoldia magna
ref|WP_021772397.1|  hypothetical protein                             94.0    2e-18   
gb|ABA87904.1|  metal-dependent hydrolase, beta-lactamase superfa...  94.0    2e-18   Pelobacter carbinolicus DSM 2380
ref|WP_042272127.1|  ribonuclease J                                   94.0    2e-18   [Clostridium] dakarense
ref|WP_022165737.1|  uncharacterized protein                          93.6    2e-18   Eubacterium
ref|WP_022077793.1|  hypothetical protein                             94.0    2e-18   
ref|WP_022224813.1|  hypothetical protein                             89.4    2e-18   
ref|WP_043166822.1|  ribonuclease                                     94.0    2e-18   Bifidobacterium callitrichos
gb|EEG56378.1|  hypothetical protein CLOSTASPAR_01541 [ [             94.0    2e-18   [Clostridium] asparagiforme DSM 15981
ref|WP_004822778.1|  ribonuclease J                                   93.6    2e-18   Peptoniphilus indolicus
ref|WP_041537920.1|  ribonuclease J                                   93.6    2e-18   
ref|WP_005509425.1|  ribonuclease J                                   94.0    2e-18   Corynebacterium amycolatum
ref|WP_027190382.1|  ribonuclease J                                   93.6    2e-18   Desulfovibrio putealis
ref|WP_004834450.1|  ribonuclease J                                   93.6    2e-18   Anaerococcus prevotii
gb|EHL14165.1|  hypothetical protein HMPREF9625_00008                 94.0    2e-18   Oribacterium parvum ACB1
ref|WP_006583942.1|  metallo-beta-lactamase                           93.6    2e-18   Thermanaerovibrio velox
ref|WP_014794735.1|  MULTISPECIES: ribonuclease J                     93.6    3e-18   Desulfitobacterium
gb|ABB14068.1|  metallo-beta-lactamase family protein                 93.6    3e-18   Carboxydothermus hydrogenoformans Z-2901
ref|WP_014967490.1|  ribonuclease J                                   93.2    3e-18   Gottschalkia acidurici
ref|WP_016422601.1|  ribonuclease J                                   94.0    3e-18   Corynebacterium
ref|WP_002836243.1|  ribonuclease J                                   93.2    3e-18   Finegoldia magna
ref|WP_038628746.1|  ribonuclease J                                   94.0    3e-18   Corynebacterium
ref|WP_034107548.1|  ribonuclease J                                   93.2    3e-18   
gb|KFI52798.1|  metallo-beta-lactamase domain-containing protein      93.6    3e-18   Bifidobacterium biavatii DSM 23969
ref|WP_033493093.1|  ribonuclease                                     93.6    3e-18   
gb|ERL22292.1|  hypothetical protein HMPREF1986_00677                 93.6    3e-18   Oribacterium sp. oral taxon 078 str. F0263
ref|WP_004512338.1|  ribonuclease J                                   93.2    3e-18   Geobacter metallireducens
ref|WP_005956166.1|  ribonuclease J                                   93.2    3e-18   Peptoniphilus harei
gb|EGF86537.1|  ribonuclease J 1                                      92.8    3e-18   Gemella haemolysans M341
ref|WP_041243548.1|  ribonuclease J                                   93.2    3e-18   
ref|WP_022487813.1|  rNA-metabolising metallo-beta-lactamase          93.2    3e-18   
ref|WP_037349365.1|  MULTISPECIES: ribonuclease J                     93.2    3e-18   Selenomonas
ref|WP_018085723.1|  ribonuclease J                                   93.2    3e-18   Desulfurispora thermophila
ref|WP_012583511.1|  ribonuclease J                                   93.2    3e-18   Dictyoglomus turgidum
ref|WP_013567412.1|  ribonuclease J                                   93.2    3e-18   Terriglobus saanensis
ref|WP_034541882.1|  ribonuclease J                                   93.2    3e-18   
ref|WP_014010148.1|  ribonuclease J                                   93.6    3e-18   Corynebacterium variabile
ref|WP_022312134.1|  hypothetical protein                             93.2    4e-18   Clostridium
gb|EJP33428.1|  hypothetical protein HMPREF1147_0263                  93.2    4e-18   Selenomonas sp. FOBRC9
gb|EUB27574.1|  hypothetical protein HMPREF1504_0881                  93.6    4e-18   Veillonella sp. ICM51a
ref|WP_028129063.1|  ribonuclease J                                   92.8    4e-18   Selenomonas sp. AE3005
ref|WP_036734249.1|  ribonuclease J                                   92.8    4e-18   
ref|WP_012547818.1|  ribonuclease J                                   92.8    4e-18   Dictyoglomus thermophilum
ref|WP_040635276.1|  ribonuclease J                                   92.8    4e-18   
ref|WP_028065082.1|  ribonuclease J                                   92.8    4e-18   
gb|EHN12295.1|  Zn-dependent hydrolase                                92.8    4e-18   Patulibacter medicamentivorans
gb|EPD79064.1|  hypothetical protein HMPREF1477_01418                 93.6    4e-18   Veillonella sp. HPA0037
ref|WP_041220304.1|  ribonuclease J                                   92.8    4e-18   
ref|WP_014424720.1|  ribonuclease J                                   92.8    4e-18   Selenomonas ruminantium
ref|WP_027359324.1|  ribonuclease J                                   92.8    4e-18   Desulforegula conservatrix
ref|WP_012938379.1|  ribonuclease J                                   92.8    4e-18   
gb|EFW30412.1|  hypothetical protein HMPREF9555_00038                 92.8    4e-18   
ref|WP_002844110.1|  ribonuclease J                                   92.8    4e-18   
ref|WP_019125842.1|  ribonuclease J                                   92.8    4e-18   
ref|WP_009251465.1|  MULTISPECIES: beta-lactamase                     92.8    4e-18   
gb|EEX70177.1|  hypothetical protein MITSMUL_03315                    92.8    4e-18   
gb|EKU71684.1|  hypothetical protein HMPREF9161_00369                 92.8    4e-18   
ref|WP_020879371.1|  beta-lactamase domain protein                    92.8    5e-18   
ref|WP_018704435.1|  MULTISPECIES: ribonuclease J                     92.8    5e-18   
ref|WP_012648864.1|  ribonuclease J                                   92.8    5e-18   
ref|WP_038123030.1|  ribonuclease J                                   92.8    5e-18   
ref|WP_038148223.1|  ribonuclease J                                   92.8    5e-18   
ref|WP_021721156.1|  ribonuclease J 1                                 92.8    5e-18   
ref|WP_003145720.1|  ribonuclease J                                   92.8    5e-18   
ref|WP_033171061.1|  ribonuclease J                                   92.8    5e-18   
ref|WP_040564787.1|  ribonuclease J                                   92.4    5e-18   
ref|WP_022200294.1|  hypothetical protein                             93.2    5e-18   
ref|WP_034843718.1|  ribonuclease J [                                 92.4    5e-18   
ref|WP_035120901.1|  ribonuclease J                                   92.8    6e-18   
ref|WP_021716431.1|  ribonuclease J 1                                 92.4    6e-18   
ref|WP_022343974.1|  hypothetical protein                             92.8    6e-18   
ref|WP_015204862.1|  Ribocuclease J                                   92.8    6e-18   
ref|WP_037348540.1|  ribonuclease J                                   92.4    6e-18   
gb|EJZ84276.1|  hypothetical protein HMPREF9451_00585                 92.8    6e-18   
ref|WP_022281425.1|  ribocuclease J                                   92.8    6e-18   
ref|WP_020976441.1|  ribonuclease J                                   92.8    6e-18   
ref|WP_031495012.1|  ribonuclease J                                   92.4    6e-18   
ref|WP_022305202.1|  beta-lactamase domain protein                    92.8    6e-18   
ref|WP_002586223.1|  beta-lactamase                                   92.8    6e-18   
emb|CCL17458.1|  Ribonuclease J family protein                        92.4    6e-18   
ref|WP_015774543.1|  ribonuclease J                                   92.4    6e-18   
ref|WP_014098981.1|  putative metallo-beta-lactamase superfamily ...  92.4    7e-18   
gb|ADZ83857.1|  Ribocuclease J                                        92.4    7e-18   
ref|WP_028075504.1|  ribonuclease J                                   92.4    7e-18   
ref|WP_041746568.1|  ribonuclease J [                                 92.4    7e-18   
ref|WP_003428271.1|  ribonuclease J                                   92.4    7e-18   
ref|WP_038548244.1|  ribonuclease J                                   92.8    7e-18   
gb|EFH06746.1|  hypothetical protein HMPREF0220_2270                  92.4    7e-18   
ref|WP_022615206.1|  Ribonuclease J family protein                    92.4    7e-18   
ref|WP_035768214.1|  ribonuclease J                                   92.0    7e-18   
gb|EFE92806.1|  hypothetical protein GCWU000341_00698                 92.4    7e-18   
ref|WP_006905078.1|  beta-lactamase                                   92.4    7e-18   
ref|WP_021684137.1|  hypothetical protein                             92.4    7e-18   
ref|WP_041713665.1|  ribonuclease J                                   92.0    7e-18   
gb|EUB12431.1|  hypothetical protein HMPREF1508_0153                  92.4    7e-18   
ref|WP_006364380.1|  ribonuclease J                                   92.0    7e-18   
ref|WP_033520901.1|  ribonuclease                                     92.4    7e-18   
ref|WP_015758597.1|  ribonuclease J                                   92.0    8e-18   
ref|WP_026760763.1|  MULTISPECIES: ribonuclease J                     92.0    8e-18   
ref|WP_026900525.1|  ribonuclease J                                   92.0    8e-18   
ref|WP_022408182.1|  hypothetical protein                             92.4    8e-18   
ref|WP_034123084.1|  ribonuclease J                                   92.0    8e-18   
ref|WP_038670747.1|  ribonuclease J                                   92.0    8e-18   
ref|WP_022461719.1|  metallo-beta-lactamase family protein            92.4    8e-18   
ref|WP_022449142.1|  beta-lactamase domain protein                    92.0    8e-18   
ref|WP_020441314.1|  hypothetical protein                             92.4    8e-18   
ref|WP_016282522.1|  ribonuclease J                                   92.0    8e-18   
ref|WP_044663712.1|  ribonuclease J                                   92.0    8e-18   
ref|WP_024866401.1|  ribonuclease J                                   92.0    8e-18   
ref|WP_033521989.1|  ribonuclease                                     92.4    8e-18   
ref|WP_004632272.1|  ribonuclease J                                   92.0    8e-18   
emb|CCY34373.1|  putative uncharacterized protein                     92.0    9e-18   
ref|WP_012122531.1|  ribonuclease J                                   92.0    9e-18   
ref|WP_009267894.1|  MULTISPECIES: beta-lactamase                     92.0    9e-18   
ref|WP_010270905.1|  hypothetical protein                             92.0    9e-18   
ref|WP_019553117.1|  ribonuclease J                                   92.0    9e-18   
gb|ABX42655.1|  beta-lactamase domain protein                         92.0    9e-18   
ref|WP_022326051.1|  hypothetical protein                             92.0    9e-18   
ref|WP_028576826.1|  ribonuclease J                                   91.7    9e-18   
ref|WP_022171300.1|  hypothetical protein                             91.7    9e-18   
ref|WP_027130676.1|  ribonuclease J                                   91.7    9e-18   
ref|WP_011955640.1|  ribonuclease J                                   92.0    9e-18   
ref|WP_025488391.1|  ribonuclease J                                   91.7    9e-18   
ref|WP_019107685.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_035807878.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_026188920.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_040317711.1|  ribonuclease                                     91.7    1e-17   
ref|WP_011792657.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_022028412.1|  hypothetical protein                             92.0    1e-17   
ref|WP_015044656.1|  MULTISPECIES: ribonuclease J                     92.0    1e-17   
gb|ERH17077.1|  hypothetical protein HMPREF0043_01533                 91.7    1e-17   
ref|WP_010938175.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_021167648.1|  ribonuclease J 1                                 91.7    1e-17   
ref|WP_024732760.1|  ribonuclease J                                   91.7    1e-17   
gb|EFB76703.1|  hypothetical protein SUBVAR_05080                     92.0    1e-17   
ref|WP_035797396.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_006716055.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_020376962.1|  hypothetical protein                             91.7    1e-17   
ref|WP_012230796.1|  putative Ribonuclease J 1                        91.7    1e-17   
ref|WP_027007472.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_005950697.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_042681596.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_002563603.1|  MULTISPECIES: hypothetical protein               91.7    1e-17   
ref|WP_026765999.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_031543145.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_007779954.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_021954741.1|  beta-lactamase domain protein                    92.0    1e-17   
gb|EFV01621.1|  hypothetical protein HMP0721_1014                     91.7    1e-17   
gb|EDP13895.1|  hypothetical protein CLOBOL_05776 [ [                 92.0    1e-17   
gb|EUC78394.1|  hypothetical protein HMPREF9092_0058                  91.7    1e-17   
ref|WP_016292132.1|  ribonuclease J                                   91.3    1e-17   
gb|ENZ40826.1|  ribonuclease J [ [                                    92.0    1e-17   
ref|WP_022226304.1|  ribonuclease J 1                                 91.3    1e-17   
ref|WP_015359290.1|  ribonuclease J 1 [                               91.3    1e-17   
ref|WP_036941123.1|  ribonuclease J                                   91.3    1e-17   
ref|WP_011195685.1|  ribonuclease J                                   91.3    1e-17   
ref|WP_044479410.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_034132436.1|  ribonuclease J                                   91.3    1e-17   
ref|WP_020491431.1|  ribonuclease J                                   91.7    1e-17   
ref|WP_014266865.1|  ribonuclease J                                   91.3    1e-17   
ref|WP_022476447.1|  hypothetical protein                             91.7    1e-17   
ref|WP_016477059.1|  ribonuclease J                                   91.3    1e-17   
ref|WP_007956434.1|  ribonuclease J                                   91.3    1e-17   
gb|ENZ39514.1|  ribonuclease J [ [                                    92.0    1e-17   
gb|ENZ16447.1|  ribonuclease J [ [                                    92.0    1e-17   
ref|WP_026524813.1|  ribonuclease J                                   91.3    1e-17   
ref|WP_026852865.1|  hypothetical protein                             91.3    1e-17   
ref|WP_009243254.1|  MULTISPECIES: beta-lactamase                     91.3    1e-17   
ref|WP_022238131.1|  hypothetical protein                             91.7    1e-17   
gb|EEJ50107.1|  hypothetical protein HMPREF6123_2616                  91.7    1e-17   
ref|WP_009616298.1|  ribonuclease J                                   91.3    1e-17   
ref|WP_006965807.1|  RNA-metabolising metallo-beta-lactamase J1       91.3    1e-17   
gb|ABC79872.1|  Beta-lactamase-like protein                           91.3    1e-17   
ref|WP_026504668.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_028264222.1|  beta-lactamase                                   91.3    2e-17   
ref|WP_044276531.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_011640679.1|  ribonuclease J                                   91.3    2e-17   
gb|EFR41243.1|  hypothetical protein HMPREF9162_1487                  91.3    2e-17   
ref|WP_007934256.1|  MULTISPECIES: ribonuclease J                     91.3    2e-17   
ref|WP_009430514.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_018020369.1|  ribonuclease J                                   91.7    2e-17   
ref|WP_025206126.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_019224779.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_034601061.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_003148334.1|  beta-lactamase                                   91.3    2e-17   
ref|WP_012739020.1|  beta-lactamase [                                 91.3    2e-17   
ref|WP_006522497.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_037350190.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_018640668.1|  ribonuclease                                     91.3    2e-17   
ref|WP_040193915.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_028575181.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_004573545.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_022783040.1|  beta-lactamase                                   90.9    2e-17   
ref|WP_013841942.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_015651527.1|  hydrolase of metallo-BETA-lactamase superfam...  91.7    2e-17   
ref|WP_027188104.1|  ribonuclease J                                   90.9    2e-17   
gb|KFI56396.1|  Metal-dependent hydrolase                             91.3    2e-17   
ref|WP_022781151.1|  MULTISPECIES: beta-lactamase                     90.9    2e-17   
ref|WP_027294070.1|  MULTISPECIES: ribonuclease J                     90.9    2e-17   
ref|WP_021850708.1|  hypothetical protein                             90.9    2e-17   
gb|EEX47961.1|  hypothetical protein GCWU000246_01275                 90.9    2e-17   
ref|WP_021871040.1|  hypothetical protein                             91.3    2e-17   
ref|WP_009171986.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_009222377.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_026509588.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_021735558.1|  metallo-beta-lactamase domain protein            88.6    2e-17   
ref|WP_036728480.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_016406125.1|  uncharacterized protein                          91.3    2e-17   
ref|WP_014957152.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_037282241.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_042976595.1|  ribonuclease J                                   87.8    2e-17   
ref|WP_014901954.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_012063596.1|  ribonuclease J                                   90.9    2e-17   
gb|EKY18236.1|  hypothetical protein HMPREF0870_01545                 90.9    2e-17   
ref|WP_014828240.1|  ribonuclease J                                   90.9    2e-17   
gb|ETJ00360.1|  Beta-lactamase protein                                88.2    2e-17   
gb|EFL57500.1|  hypothetical protein HMPREF9684_0310                  91.3    2e-17   
ref|WP_006561401.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_027020021.1|  ribonuclease J                                   91.3    2e-17   
gb|EJO50716.1|  hypothetical protein HMPREF1151_0513                  91.3    2e-17   
ref|WP_022095454.1|  hypothetical protein                             90.9    2e-17   
ref|WP_029675544.1|  ribonuclease                                     90.9    2e-17   
ref|WP_034145695.1|  ribonuclease J                                   90.9    2e-17   
gb|EFL55710.1|  hypothetical protein HMPREF9321_1661                  91.3    2e-17   
gb|ADU22143.1|  RNA-metabolising metallo-beta-lactamase               90.9    2e-17   
ref|WP_034440115.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_019132406.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_008523046.1|  MULTISPECIES: metallo-beta-lactamase             90.9    2e-17   
ref|WP_040967540.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_026656576.1|  MULTISPECIES: ribonuclease J                     90.5    2e-17   
ref|WP_026514413.1|  ribonuclease J                                   90.5    2e-17   
ref|WP_038141083.1|  MULTISPECIES: ribonuclease J                     90.5    2e-17   
ref|WP_011014791.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_027012113.1|  ribonuclease J                                   90.9    2e-17   
ref|WP_033892570.1|  ribonuclease                                     90.1    2e-17   
ref|WP_038149085.1|  ribonuclease J                                   90.5    2e-17   
ref|WP_044030039.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_003857476.1|  MULTISPECIES: ribonuclease J                     91.3    2e-17   
ref|WP_011897391.1|  ribonuclease J                                   91.3    2e-17   
ref|WP_022097852.1|  hypothetical protein                             90.5    3e-17   
ref|WP_027098291.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_039957176.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_029966777.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_006696074.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_003825754.1|  ribonuclease                                     90.9    3e-17   
ref|WP_034577820.1|  MULTISPECIES: ribonuclease J                     90.5    3e-17   
gb|EEQ57771.1|  hypothetical protein CBFG_01481                       90.5    3e-17   
ref|WP_019636742.1|  beta-lactamase                                   90.5    3e-17   
ref|WP_014260796.1|  ribonuclease J                                   90.5    3e-17   
gb|AGA69866.1|  LOW QUALITY PROTEIN: hypothetical protein Desdi_2442  90.5    3e-17   
ref|WP_022182088.1|  hypothetical protein                             90.9    3e-17   
ref|WP_020885762.1|  beta-lactamase domain protein                    90.5    3e-17   
ref|WP_038268157.1|  ribonuclease J [                                 90.5    3e-17   
gb|ERN43162.1|  putative hydrolase of the metallo-beta-lactamase ...  90.5    3e-17   
ref|WP_035068636.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_016300748.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_038282313.1|  ribonuclease J [                                 90.5    3e-17   
gb|EOQ38467.1|  hypothetical protein HMPREF1526_01500                 90.5    3e-17   
ref|WP_038269086.1|  MULTISPECIES: ribonuclease J                     90.5    3e-17   
ref|WP_040571201.1|  ribonuclease J                                   90.5    3e-17   
gb|EJO21392.1|  hypothetical protein HMPREF1148_0529                  90.5    3e-17   
ref|WP_040654583.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_015946546.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_026489000.1|  ribonuclease J                                   90.5    3e-17   
ref|WP_005984064.1|  putative hydrolase of the metallo-beta-lacta...  90.5    3e-17   
ref|WP_038259375.1|  ribonuclease J [                                 90.1    3e-17   
ref|WP_036762920.1|  ribonuclease J                                   90.1    3e-17   
ref|WP_014183517.1|  ribonuclease J                                   90.1    3e-17   
ref|WP_027642268.1|  ribonuclease J [                                 90.1    3e-17   
ref|WP_039315662.1|  ribonuclease J                                   90.1    3e-17   
ref|WP_025656756.1|  ribonuclease J                                   90.1    3e-17   



>ref|XP_011073026.1| PREDICTED: uncharacterized protein LOC105158090 isoform X2 [Sesamum 
indicum]
Length=857

 Score =   270 bits (691),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +1

Query  217  SGVSLCPYKL-WYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            + +S+CP+KL W QP  R+RFISC V TPSVK  RG+K+PR+R+ + EGAGKSMED+V+R
Sbjct  5    NAISVCPHKLFWCQPKPRKRFISCCVSTPSVKGSRGSKVPRRRSGRTEGAGKSMEDSVKR  64

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVG +DRYILIDAGVMFP YDELGV KIIP
Sbjct  65   KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGNFDRYILIDAGVMFPDYDELGVQKIIP  124

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  125  DTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  159



>ref|XP_011073024.1| PREDICTED: uncharacterized protein LOC105158090 isoform X1 [Sesamum 
indicum]
Length=878

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +1

Query  217  SGVSLCPYKL-WYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            + +S+CP+KL W QP  R+RFISC V TPSVK  RG+K+PR+R+ + EGAGKSMED+V+R
Sbjct  5    NAISVCPHKLFWCQPKPRKRFISCCVSTPSVKGSRGSKVPRRRSGRTEGAGKSMEDSVKR  64

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVG +DRYILIDAGVMFP YDELGV KIIP
Sbjct  65   KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGNFDRYILIDAGVMFPDYDELGVQKIIP  124

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  125  DTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  159



>gb|EYU23118.1| hypothetical protein MIMGU_mgv1a0011952mg, partial [Erythranthe 
guttata]
Length=175

 Score =   242 bits (617),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 136/158 (86%), Gaps = 3/158 (2%)
 Frame = +1

Query  214  TSGVSLCPYKLWY--QPLLRRRFISCSVRTPSV-KDIRGAKLPRKRNVKGEGAGKSMEDA  384
            +S +S+CP+KL +  QP  R+ F+SC V  PSV K  + +K+P +R+ + EG GKSMED+
Sbjct  4    SSAISVCPHKLLWCQQPKPRKNFVSCCVSIPSVVKGTQSSKIPNRRSGRSEGPGKSMEDS  63

Query  385  VQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVK  564
            V+RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVG YDRYILIDAG+MFP  ++LGV K
Sbjct  64   VKRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDCEDLGVQK  123

Query  565  IIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            IIPDTTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  124  IIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  161



>ref|XP_010319061.1| PREDICTED: uncharacterized protein LOC101264202 isoform X4 [Solanum 
lycopersicum]
Length=747

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPYKL +Q   R+ FISC   + S   IRG+K PRKR  K EGAG+S++D+VQR+
Sbjct  6    SAISLCPYKLCHQLNPRKHFISCYTPSTSSIGIRGSKGPRKRPDKLEGAGRSIDDSVQRR  65

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFPGYDE GV KIIPD
Sbjct  66   MEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPGYDEPGVQKIIPD  125

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  TTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  159



>ref|XP_010319059.1| PREDICTED: uncharacterized protein LOC101264202 isoform X2 [Solanum 
lycopersicum]
Length=852

 Score =   254 bits (648),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPYKL +Q   R+ FISC   + S   IRG+K PRKR  K EGAG+S++D+VQR+
Sbjct  6    SAISLCPYKLCHQLNPRKHFISCYTPSTSSIGIRGSKGPRKRPDKLEGAGRSIDDSVQRR  65

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFPGYDE GV KIIPD
Sbjct  66   MEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPGYDEPGVQKIIPD  125

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  TTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  159



>ref|XP_010319060.1| PREDICTED: uncharacterized protein LOC101264202 isoform X3 [Solanum 
lycopersicum]
Length=851

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPYKL +Q   R+ FISC   + S   IRG+K PRKR  K EGAG+S++D+VQR+
Sbjct  6    SAISLCPYKLCHQLNPRKHFISCYTPSTSSIGIRGSKGPRKRPDKLEGAGRSIDDSVQRR  65

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFPGYDE GV KIIPD
Sbjct  66   MEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPGYDEPGVQKIIPD  125

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  TTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  159



>ref|XP_010319058.1| PREDICTED: uncharacterized protein LOC101264202 isoform X1 [Solanum 
lycopersicum]
Length=881

 Score =   254 bits (649),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPYKL +Q   R+ FISC   + S   IRG+K PRKR  K EGAG+S++D+VQR+
Sbjct  6    SAISLCPYKLCHQLNPRKHFISCYTPSTSSIGIRGSKGPRKRPDKLEGAGRSIDDSVQRR  65

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFPGYDE GV KIIPD
Sbjct  66   MEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPGYDEPGVQKIIPD  125

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  TTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  159



>ref|XP_006351477.1| PREDICTED: uncharacterized protein LOC102586834 [Solanum tuberosum]
Length=852

 Score =   250 bits (639),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPYKL +Q   R+ FISC   + S   +R +K PRKR  K EGAG+S++D+VQR+
Sbjct  6    SAISLCPYKLCHQLNPRKHFISCYTPSTSSIGVRRSKGPRKRPDKLEGAGRSIDDSVQRR  65

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFPGYDE GV KIIPD
Sbjct  66   MEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPGYDEPGVQKIIPD  125

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  TTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  159



>ref|XP_009774848.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104224837 
[Nicotiana sylvestris]
Length=880

 Score =   251 bits (640),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPYKL +Q    +R+ISC   + S   +RG+K PR+R  K EGAG+S++D+VQR+
Sbjct  5    SAISLCPYKLCHQLNPSKRYISCYTPSSSTIGVRGSKGPRRRPAKTEGAGRSIDDSVQRR  64

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            ME FYEG+DGPPLRILPIGGLGEIGMNCMLVG YDRYILIDAG+MFPGY++LGV KIIPD
Sbjct  65   MEHFYEGADGPPLRILPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPGYEDLGVQKIIPD  124

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  125  TTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  158



>ref|XP_009595697.1| PREDICTED: uncharacterized protein LOC104091946 isoform X2 [Nicotiana 
tomentosiformis]
Length=851

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPYKL +Q    +R+ISC   + S   +RG+K PR+R  K EGAG+S++D+VQR+
Sbjct  5    SAISLCPYKLCHQLNPSKRYISCYTPSSSTVGVRGSKGPRRRPAKTEGAGRSIDDSVQRR  64

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            ME FYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFPGY++LGV KIIPD
Sbjct  65   MEHFYEGADGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPGYEDLGVQKIIPD  124

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  125  TTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  158



>ref|XP_009595689.1| PREDICTED: uncharacterized protein LOC104091946 isoform X1 [Nicotiana 
tomentosiformis]
Length=880

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPYKL +Q    +R+ISC   + S   +RG+K PR+R  K EGAG+S++D+VQR+
Sbjct  5    SAISLCPYKLCHQLNPSKRYISCYTPSSSTVGVRGSKGPRRRPAKTEGAGRSIDDSVQRR  64

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            ME FYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFPGY++LGV KIIPD
Sbjct  65   MEHFYEGADGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPGYEDLGVQKIIPD  124

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  125  TTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  158



>ref|XP_007037950.1| RNA-metabolising metallo-beta-lactamase family protein [Theobroma 
cacao]
 gb|EOY22451.1| RNA-metabolising metallo-beta-lactamase family protein [Theobroma 
cacao]
Length=1004

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 137/162 (85%), Gaps = 3/162 (2%)
 Frame = +1

Query  193  KMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKS  372
            KMA ++     SLCPY L+ +P  R R+ISCSV +P+    R  K+PRK++ + +GA KS
Sbjct  119  KMAAST---AHSLCPYGLYCRPNPRHRYISCSVGSPTPLGTRRTKVPRKKSGRLDGARKS  175

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEG+ GPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDEL
Sbjct  176  MEDSVQRKMEQFYEGTAGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEL  235

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  236  GVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  277



>ref|XP_010105237.1| Ribonuclease J [Morus notabilis]
 gb|EXC04124.1| Ribonuclease J [Morus notabilis]
Length=872

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  220  GVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKM  399
             +SLCP  L ++P L +R  SCSV +PS     G+  PRKR  + EG  KSMED+VQRKM
Sbjct  32   SLSLCPCSLLWRPKLTKRSFSCSVGSPSSVGTPGSSAPRKRTGRKEGPKKSMEDSVQRKM  91

Query  400  EQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDT  579
            EQFYEG DGPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFPGYDELGV KIIPDT
Sbjct  92   EQFYEGRDGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPGYDELGVQKIIPDT  151

Query  580  TFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  152  TFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  184



>gb|KJB19806.1| hypothetical protein B456_003G119600 [Gossypium raimondii]
Length=860

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  214  TSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            ++ +SLCPY L  +   R R+ISCSV +P+    R  K+PRK + + +GA KSMED+VQR
Sbjct  4    STSLSLCPYILCRKAGPRNRYISCSVGSPTSISTRRTKVPRKSSGRLDGARKSMEDSVQR  63

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEG+ GPPLR+LPIGGLGEIGMNCMLVG+YDRYILIDAGVMFP YDELGV KIIP
Sbjct  64   KMEQFYEGTAGPPLRVLPIGGLGEIGMNCMLVGHYDRYILIDAGVMFPDYDELGVQKIIP  123

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  124  DTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  158



>ref|XP_010250772.1| PREDICTED: uncharacterized protein LOC104592923 isoform X2 [Nelumbo 
nucifera]
Length=886

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCP +   +P  RR  I CSV  P V   RG+K+P KR+ + EG GKSMED+VQRK
Sbjct  5    SALSLCPSRFSCRPNPRRASICCSVDAPIVTGTRGSKIPHKRSGRMEGPGKSMEDSVQRK  64

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG +DRYILIDAGVMFP YDELGV KIIPD
Sbjct  65   MEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNHDRYILIDAGVMFPDYDELGVQKIIPD  124

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            T FI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  125  TAFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  158



>ref|XP_010250771.1| PREDICTED: uncharacterized protein LOC104592923 isoform X1 [Nelumbo 
nucifera]
Length=887

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCP +   +P  RR  I CSV  P V   RG+K+P KR+ + EG GKSMED+VQRK
Sbjct  5    SALSLCPSRFSCRPNPRRASICCSVDAPIVTGTRGSKIPHKRSGRMEGPGKSMEDSVQRK  64

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG +DRYILIDAGVMFP YDELGV KIIPD
Sbjct  65   MEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNHDRYILIDAGVMFPDYDELGVQKIIPD  124

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            T FI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  125  TAFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  158



>ref|XP_006477010.1| PREDICTED: uncharacterized protein LOC102606767 isoform X1 [Citrus 
sinensis]
Length=912

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            S +SL PY    +P+ R RR ISCS+ TP+    R +K+PR+R  + EG  KSMED+VQR
Sbjct  36   SALSLSPYNFLCKPIPRIRRSISCSIDTPTTLGARESKVPRRRTGRTEGPRKSMEDSVQR  95

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV KI P
Sbjct  96   KMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQKITP  155

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  156  DTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  190



>ref|XP_006440090.1| hypothetical protein CICLE_v10018763mg [Citrus clementina]
 gb|ESR53330.1| hypothetical protein CICLE_v10018763mg [Citrus clementina]
Length=912

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            S +SL PY    +P+ R RR ISCS+ TP+    R +K+PR+R  + EG  KSMED+VQR
Sbjct  36   SALSLSPYNFLCKPIPRIRRSISCSIDTPTTLGARESKVPRRRTGRTEGPRKSMEDSVQR  95

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV KI P
Sbjct  96   KMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQKITP  155

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  156  DTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  190



>ref|XP_002511207.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51809.1| conserved hypothetical protein [Ricinus communis]
Length=880

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPL--LRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY L ++P    R+  ISCS+ + S     G+K PRKR+ + EGAGKSMED+VQ
Sbjct  5    SAISLCPYSLLHRPRPSTRKYPISCSIGSSSTIGSHGSKAPRKRSGRMEGAGKSMEDSVQ  64

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEGS+GPPLRI+PIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV KII
Sbjct  65   RKMEQFYEGSNGPPLRIVPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQKII  124

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDTTFI++WSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  125  PDTTFIKRWSHKIEAVIITHGHEDHIGALPWVIPAL  160



>emb|CBI15641.3| unnamed protein product [Vitis vinifera]
Length=1659

 Score =   245 bits (625),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = +1

Query  145  SRLAYYMHTDR*DCRMKMAVTSFT---SGVSLCPYKLWYQPLLRRRFISCSV-RTPSVKD  312
            SR+ ++ HT    CR    V  +    S +S CPY L Y+P    R I C +   P+   
Sbjct  753  SRVFFFFHTL--SCRPNKIVAEYMAAFSALSSCPYTLPYRPKPSNRSILCRMGSAPTSVG  810

Query  313  IRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVG  492
               +K+PRKR+ + EG  KSMED+VQRKMEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG
Sbjct  811  TSVSKVPRKRSRRMEGVKKSMEDSVQRKMEQFYEGSEGPPLRVLPIGGLGEIGMNCMLVG  870

Query  493  YYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIP  672
             YDRYILIDAGVMFP YDELGV KIIPDTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIP
Sbjct  871  NYDRYILIDAGVMFPDYDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIP  930

Query  673  AL  678
            AL
Sbjct  931  AL  932



>ref|XP_006827615.1| hypothetical protein AMTR_s00009p00241540 [Amborella trichopoda]
 gb|ERM95031.1| hypothetical protein AMTR_s00009p00241540 [Amborella trichopoda]
Length=866

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 131/158 (83%), Gaps = 4/158 (3%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLL----RRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDA  384
            S  S+CP +  + P      R+ FIS ++ TPSV   + ++L +KR+ + EG  KSMED+
Sbjct  5    SAFSICPCRFSFNPNFNGETRKSFISNAIGTPSVTGAKESRLRQKRSGRLEGPSKSMEDS  64

Query  385  VQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVK  564
            VQRKME+FYEGS GPPLR+LPIGGLGEIGMNCMLVG+YDRYIL+DAGVMFP YDELGV K
Sbjct  65   VQRKMEEFYEGSSGPPLRVLPIGGLGEIGMNCMLVGHYDRYILVDAGVMFPDYDELGVQK  124

Query  565  IIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            IIPDTTFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  125  IIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  162



>ref|XP_010677898.1| PREDICTED: uncharacterized protein LOC104893494 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=886

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +1

Query  202  VTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMED  381
            + +FT+ +S+CP  L+Y+P   +R+ISCSV           K+PRKR  + EGA KSMED
Sbjct  1    MAAFTA-LSICPCSLFYRPNHVKRYISCSVGPSRSLGTNATKVPRKRPGRLEGASKSMED  59

Query  382  AVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVV  561
            +V+RKMEQFYEGS GPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDE GV 
Sbjct  60   SVKRKMEQFYEGSTGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDEFGVQ  119

Query  562  KIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            KIIPDTTFI++WSHKIEAVIITHGHEDHIGALPWVI AL
Sbjct  120  KIIPDTTFIKRWSHKIEAVIITHGHEDHIGALPWVIRAL  158



>gb|EPS67461.1| hypothetical protein M569_07313, partial [Genlisea aurea]
Length=815

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = +1

Query  220  GVSLCPYKL-WYQPLLRRRFISC--SVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
             VS+  +KL W QP  R+RF+SC  S+  P+VK  + +K P K+  + EGA KSMED+V+
Sbjct  6    AVSVLHHKLFWLQPRFRKRFVSCCASIPPPNVKGPKESKAPPKKVGRAEGARKSMEDSVK  65

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQ YEG+ GPPLRILPIGGLGEIGMNCML+G YDRYIL+DAGVMFP YDELGV KII
Sbjct  66   RKMEQLYEGTSGPPLRILPIGGLGEIGMNCMLIGNYDRYILVDAGVMFPDYDELGVQKII  125

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDTTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  PDTTFIQKWSHKIEAVIITHGHEDHIGALPWVIPAL  161



>ref|XP_002279798.1| PREDICTED: uncharacterized protein LOC100268000 isoform X1 [Vitis 
vinifera]
Length=886

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            S +S CPY L Y+P    R I C +   P+      +K+PRKR+ + EG  KSMED+VQR
Sbjct  5    SALSSCPYTLPYRPKPSNRSILCRMGSAPTSVGTSVSKVPRKRSRRMEGVKKSMEDSVQR  64

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV KIIP
Sbjct  65   KMEQFYEGSEGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQKIIP  124

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  125  DTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  159



>ref|XP_002318122.2| hypothetical protein POPTR_0012s09780g [Populus trichocarpa]
 gb|EEE96342.2| hypothetical protein POPTR_0012s09780g [Populus trichocarpa]
Length=916

 Score =   238 bits (607),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 127/157 (81%), Gaps = 3/157 (2%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDI--RGAKLP-RKRNVKGEGAGKSMEDAV  387
            S +S CPY  + +P   +  +SCS  +P+   I  RG K P RKR  + EG GKSMED+V
Sbjct  32   SALSSCPYTFFCRPSSTKLCVSCSAGSPTTTTIGSRGTKAPPRKRTGRKEGTGKSMEDSV  91

Query  388  QRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKI  567
            +RKMEQFYEG DGPPLRI+PIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV KI
Sbjct  92   KRKMEQFYEGPDGPPLRIVPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQKI  151

Query  568  IPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            IPDTTFI +W HKIEAVIITHGHEDHIGALPWV+PAL
Sbjct  152  IPDTTFIRRWKHKIEAVIITHGHEDHIGALPWVVPAL  188



>gb|KJB08022.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
 gb|KJB08023.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
 gb|KJB08024.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
Length=884

 Score =   237 bits (605),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  214  TSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            ++ +SLCPY L  +P  R+R  SC V + +    R   +PR+ + + +GA KSMED+VQR
Sbjct  4    STALSLCPYILSRRPTPRKRLFSCFVGSTTPIGTRRTNVPRRSSGRLDGARKSMEDSVQR  63

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEG+ GPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV KI P
Sbjct  64   KMEQFYEGTAGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQKITP  123

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  124  DTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  158



>gb|KDP30936.1| hypothetical protein JCGZ_11312 [Jatropha curcas]
Length=879

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            + +S CP+ L  +    +  ISCSV +P+     G   PR+R  + EGAGKSMED+VQRK
Sbjct  5    NAISPCPFSLLRRRSPSKFSISCSVGSPTRIGSHGYGAPRRRQGRMEGAGKSMEDSVQRK  64

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEGSDGPPLRI+PIGGLGEIGMNCMLVG +DRYILIDAGVMFP YDELGV KIIPD
Sbjct  65   MEQFYEGSDGPPLRIVPIGGLGEIGMNCMLVGNHDRYILIDAGVMFPDYDELGVQKIIPD  124

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI+KW HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  125  TTFIKKWRHKIEAVVITHGHEDHIGALPWVIPAL  158



>ref|XP_011024044.1| PREDICTED: uncharacterized protein LOC105125338 [Populus euphratica]
Length=890

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 128/158 (81%), Gaps = 4/158 (3%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDI--RGAKLP--RKRNVKGEGAGKSMEDA  384
            S +SL PY L  +    +  ISCS  +P+   I  RG K P   KR+ + EGAGKSMED+
Sbjct  6    SALSLSPYTLVCRHNSTKHSISCSTASPTTTTIGSRGTKAPPRHKRSGRMEGAGKSMEDS  65

Query  385  VQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVK  564
            V+RKMEQFYEGSDGPPLRI+PIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV K
Sbjct  66   VKRKMEQFYEGSDGPPLRIVPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQK  125

Query  565  IIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            IIPDTTFI +W HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  IIPDTTFIRRWRHKIEAVIITHGHEDHIGALPWVIPAL  163



>gb|AFW66257.2| hypothetical protein ZEAMMB73_692349, partial [Zea mays]
Length=301

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 118/134 (88%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  CSVRTPSV--KDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGG  456
            C+V TPS   K  + ++ PR+R  K EGA KS+ED+V+RKMEQFYEGSDGPPLR+LPIGG
Sbjct  34   CAVATPSSSGKGPQESRTPRRRLRKTEGASKSLEDSVKRKMEQFYEGSDGPPLRVLPIGG  93

Query  457  LGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGH  636
            LGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHGH
Sbjct  94   LGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHGH  153

Query  637  EDHIGALPWVIPAL  678
            EDHIGALPWVIPAL
Sbjct  154  EDHIGALPWVIPAL  167



>gb|KHG17441.1| Ribonuclease J [Gossypium arboreum]
Length=884

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  214  TSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            ++ +SLCPY L  +P  R+R  SCSV + +    R   +PR+   + +GA KSMED+V R
Sbjct  4    STALSLCPYILSRRPTPRKRRFSCSVGSTTPIGTRRTNVPRRSPGRLDGARKSMEDSVLR  63

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEG+ GPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV KIIP
Sbjct  64   KMEQFYEGTAGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQKIIP  123

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  124  DTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  158



>emb|CAN81787.1| hypothetical protein VITISV_026006 [Vitis vinifera]
Length=1616

 Score =   238 bits (608),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
            S +S CPY L Y+P    R I C +   P+      +K+PRKR+ + EG  KSMED+VQR
Sbjct  767  SALSSCPYTLPYRPKPSNRSILCRMGSAPTSVGTSVSKVPRKRSRRMEGVKKSMEDSVQR  826

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KMEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELGV KIIP
Sbjct  827  KMEQFYEGSEGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGVQKIIP  886

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  887  DTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  921



>ref|XP_002321691.2| hypothetical protein POPTR_0015s10570g [Populus trichocarpa]
 gb|EEF05818.2| hypothetical protein POPTR_0015s10570g [Populus trichocarpa]
Length=890

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 128/158 (81%), Gaps = 4/158 (3%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDI--RGAKLP--RKRNVKGEGAGKSMEDA  384
            S +S+ PY L  +    +  ISCS  +P+   I  RG K P   KR+ + EGAGKSMED+
Sbjct  6    SALSISPYTLVCRHNSTKHSISCSTASPTTTTIGSRGTKAPPRHKRSERMEGAGKSMEDS  65

Query  385  VQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVK  564
            V+RKMEQFYEGSDGPPLRI+PIGGLGEIGMNCMLVG +DRYILIDAGVMFP YDELGV K
Sbjct  66   VKRKMEQFYEGSDGPPLRIVPIGGLGEIGMNCMLVGNFDRYILIDAGVMFPDYDELGVQK  125

Query  565  IIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            IIPDTTFI +W HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  IIPDTTFIRRWRHKIEAVIITHGHEDHIGALPWVIPAL  163



>gb|KFK28054.1| hypothetical protein AALP_AA8G465700 [Arabis alpina]
Length=896

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRTP-SVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY   ++   R R  +SCSV +P +      +K PR+R+ + EGAGKSMED+V+
Sbjct  30   SALSLCPYTFTFRQSSRIRTTVSCSVTSPPATGTSSSSKAPRRRSDRREGAGKSMEDSVK  89

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KI+
Sbjct  90   RKMEQFYEGADGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEPGVQKIM  149

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  150  PDTGFIRRWRHKIEAVVITHGHEDHIGALPWVIPAL  185



>ref|XP_010444239.1| PREDICTED: uncharacterized protein LOC104726958 [Camelina sativa]
Length=899

 Score =   234 bits (598),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRT-PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY   ++P+ R +  +SCSV + P+      +K PR+R+ + EG GKSMED+V+
Sbjct  24   SALSLCPYTFTFRPISRIKSTVSCSVTSAPASGTSSSSKTPRRRSGRPEGVGKSMEDSVK  83

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDE GV KI+
Sbjct  84   RKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDEPGVQKIM  143

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  144  PDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  179



>dbj|BAB08807.1| unnamed protein product [Arabidopsis thaliana]
Length=528

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRT-PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY   ++   R +  +SCSV + P+      +K PR+R+ + EG GKSMED+V+
Sbjct  36   SALSLCPYTFTFRQSSRIKSTVSCSVTSAPASGTSSSSKTPRRRSGRLEGVGKSMEDSVK  95

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEG+DGPPLRILPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDE G+ KI+
Sbjct  96   RKMEQFYEGTDGPPLRILPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDEPGIQKIM  155

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  156  PDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  191



>ref|XP_011044175.1| PREDICTED: uncharacterized protein LOC105139443 isoform X1 [Populus 
euphratica]
Length=914

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 124/157 (79%), Gaps = 3/157 (2%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDI---RGAKLPRKRNVKGEGAGKSMEDAV  387
            S +S CPY  + +P   +  +SCS  +P+   I   R    PRKR  + EG GKSMED+V
Sbjct  32   SALSSCPYTFFCRPSSTKLCVSCSAGSPTTTTIGSRRTKAPPRKRTGRMEGTGKSMEDSV  91

Query  388  QRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKI  567
            +RKMEQFYEG DGPPLRI+PIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDELG  KI
Sbjct  92   KRKMEQFYEGPDGPPLRIVPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDELGFQKI  151

Query  568  IPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            IPDTTFI +W HKIEAVIITHGHEDHIGALPWV+PAL
Sbjct  152  IPDTTFIRRWKHKIEAVIITHGHEDHIGALPWVVPAL  188



>ref|XP_007210498.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
 gb|EMJ11697.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
Length=875

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = +1

Query  220  GVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKM  399
             +S CPY L ++P    R +SCSV + +V   RG+ +  KR+ + EG  KSMED+VQRKM
Sbjct  6    ALSPCPYSLLWRPKPTNRCVSCSVGSSAVTGTRGSNV--KRSGRMEGPRKSMEDSVQRKM  63

Query  400  EQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDT  579
            EQFYEG +GPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DELGV KIIPDT
Sbjct  64   EQFYEGREGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFDELGVQKIIPDT  123

Query  580  TFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TFI+KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  124  TFIKKWSHKIEAIVITHGHEDHIGALPWVIPAL  156



>ref|XP_007210499.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
 gb|EMJ11698.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
Length=875

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = +1

Query  220  GVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKM  399
             +S CPY L ++P    R +SCSV + +V   RG+ +  KR+ + EG  KSMED+VQRKM
Sbjct  6    ALSPCPYSLLWRPKPTNRCVSCSVGSSAVTGTRGSNV--KRSGRMEGPRKSMEDSVQRKM  63

Query  400  EQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDT  579
            EQFYEG +GPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DELGV KIIPDT
Sbjct  64   EQFYEGREGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFDELGVQKIIPDT  123

Query  580  TFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TFI+KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  124  TFIKKWSHKIEAIVITHGHEDHIGALPWVIPAL  156



>ref|XP_004161356.1| PREDICTED: LOW QUALITY PROTEIN: ribonuclease J-like [Cucumis 
sativus]
Length=909

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +1

Query  193  KMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKS  372
            K  + SF   +SLCP     +P    R I C   +P+V     +K+PRKR  + EGA +S
Sbjct  21   KQRMASF-GALSLCPCSPLLRPHHPVRTIYCCRGSPTVLGKNVSKVPRKRPGRLEGAKRS  79

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DEL
Sbjct  80   MEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDHDEL  139

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  140  GVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  181



>ref|XP_004138055.1| PREDICTED: ribonuclease J-like [Cucumis sativus]
Length=909

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +1

Query  193  KMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKS  372
            K  + SF   +SLCP     +P    R I C   +P+V     +K+PRKR  + EGA +S
Sbjct  21   KQRMASF-GALSLCPCSPLLRPHHPVRTIYCCRGSPTVLGKNVSKVPRKRPGRLEGAKRS  79

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DEL
Sbjct  80   MEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDHDEL  139

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  140  GVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  181



>gb|KGN63492.1| hypothetical protein Csa_1G002120 [Cucumis sativus]
Length=910

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +1

Query  193  KMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKS  372
            K  + SF   +SLCP     +P    R I C   +P+V     +K+PRKR  + EGA +S
Sbjct  21   KQRMASF-GALSLCPCSPLLRPHHPVRTIYCCRGSPTVLGKNVSKVPRKRPGRLEGAKRS  79

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DEL
Sbjct  80   MEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDHDEL  139

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  140  GVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  181



>ref|XP_008239449.1| PREDICTED: uncharacterized protein LOC103338047 [Prunus mume]
Length=903

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = +1

Query  220  GVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKM  399
             +S CPY L ++P    R +SCSV + +V   RG+ +  KR+ + EG  KSMED+VQRKM
Sbjct  33   ALSPCPYSLLWRPKPTNRCVSCSVGSSAVTGTRGSNV--KRSGRMEGPRKSMEDSVQRKM  90

Query  400  EQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDT  579
            EQFYEG +GPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DELGV KIIPDT
Sbjct  91   EQFYEGREGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFDELGVQKIIPDT  150

Query  580  TFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TFI+KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  151  TFIKKWSHKIEAIVITHGHEDHIGALPWVIPAL  183



>ref|XP_008464473.1| PREDICTED: uncharacterized protein LOC103502342 isoform X1 [Cucumis 
melo]
Length=910

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +1

Query  193  KMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKS  372
            K  + SF   +SLCP     +P    R I C   +P+V     +K+PRKR  + EGA +S
Sbjct  21   KQRMASF-GALSLCPCSPLLRPHHPVRTIYCCHGSPTVLGKNVSKVPRKRPGRLEGAKRS  79

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DEL
Sbjct  80   MEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDHDEL  139

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  140  GVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  181



>ref|XP_008464474.1| PREDICTED: uncharacterized protein LOC103502342 isoform X2 [Cucumis 
melo]
Length=909

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +1

Query  193  KMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKS  372
            K  + SF   +SLCP     +P    R I C   +P+V     +K+PRKR  + EGA +S
Sbjct  21   KQRMASF-GALSLCPCSPLLRPHHPVRTIYCCHGSPTVLGKNVSKVPRKRPGRLEGAKRS  79

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DEL
Sbjct  80   MEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDHDEL  139

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  140  GVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  181



>gb|AFW70509.1| hypothetical protein ZEAMMB73_357548 [Zea mays]
Length=169

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 126/168 (75%), Gaps = 18/168 (11%)
 Frame = +1

Query  202  VTSFTSGVSLCPYKLWYQPLLRRRFIS-----------CSVRTPSV--KDIRGAKLPRKR  342
            + +  S  SLCP  +      RRR  S           C+V TPS   K  + ++ PR+R
Sbjct  1    MVALASLSSLCPCGI-----ARRRAASATSSTAFSISCCAVATPSFSGKGPQESRTPRRR  55

Query  343  NVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDA  522
              K EGA KS+ED+V+RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDA
Sbjct  56   LRKTEGATKSLEDSVKRKMEQFYEGADGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDA  115

Query  523  GVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWV  666
            GVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHGHEDHIGALPWV
Sbjct  116  GVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWV  163



>ref|XP_006394279.1| hypothetical protein EUTSA_v10003624mg [Eutrema salsugineum]
 gb|ESQ31565.1| hypothetical protein EUTSA_v10003624mg [Eutrema salsugineum]
Length=916

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRTPSVKDIRGA-KLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY   ++   R R  +SCSV +P       + K PR+R+ + EGAGKSMED+V+
Sbjct  42   SALSLCPYPFTFRKSSRVRSTVSCSVTSPPASGTSSSSKTPRRRSGRLEGAGKSMEDSVK  101

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DE GV KI+
Sbjct  102  RKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFDEPGVQKIM  161

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  162  PDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  197



>ref|XP_009419382.1| PREDICTED: uncharacterized protein LOC103999362 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=888

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 130/158 (82%), Gaps = 1/158 (1%)
 Frame = +1

Query  208  SFTSGVSLCPYKLWYQPLLRRRFISCSVRTPS-VKDIRGAKLPRKRNVKGEGAGKSMEDA  384
            S ++  SLCP  +   P + R  + CS+ +P  V   R +K PR+R+ + +GAGKSMED+
Sbjct  3    SLSAFPSLCPCGVSRLPKIPRTAVWCSLGSPPPVAGARESKAPRRRSRRTDGAGKSMEDS  62

Query  385  VQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVK  564
            VQRK+EQFYEG DGPPLR+LPIGGLGEIGMNCMLVG +DRYILIDAG+MFP YDE GV K
Sbjct  63   VQRKLEQFYEGLDGPPLRVLPIGGLGEIGMNCMLVGNFDRYILIDAGIMFPDYDEFGVQK  122

Query  565  IIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            I+PDTTFI++WSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  123  IVPDTTFIKRWSHKIEALVITHGHEDHIGALPWVIPAL  160



>emb|CDP10033.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 132/171 (77%), Gaps = 11/171 (6%)
 Frame = +1

Query  196  MAVTSFTSGVSLCPY------KLWYQPLLRRRFISC---SVRTPSVKDIRGAKLPRKRNV  348
            MA  SF S VSL PY           P   R+ ISC   S  T ++    G++ P KR+ 
Sbjct  1    MAAISF-SAVSLYPYAHKGSLSRAANPNPSRQCISCCGPSHSTSTIGSRGGSREPHKRSR  59

Query  349  -KGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAG  525
             + EG  KSMED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG +DRYILIDAG
Sbjct  60   GRAEGPRKSMEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNFDRYILIDAG  119

Query  526  VMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            VMFPGYDELGV KIIPDTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  120  VMFPGYDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  170



>ref|NP_201147.2| RNase J [Arabidopsis thaliana]
 gb|AAO42228.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD93952.1| putative protein [Arabidopsis thaliana]
 gb|AED97746.1| RNA-metabolising metallo-beta-lactamase family protein [Arabidopsis 
thaliana]
Length=911

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRT-PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY   ++   R +  +SCSV + P+      +K PR+R+ + EG GKSMED+V+
Sbjct  36   SALSLCPYTFTFRQSSRIKSTVSCSVTSAPASGTSSSSKTPRRRSGRLEGVGKSMEDSVK  95

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEG+DGPPLRILPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDE G+ KI+
Sbjct  96   RKMEQFYEGTDGPPLRILPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDEPGIQKIM  155

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  156  PDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  191



>dbj|BAD44310.1| putative protein [Arabidopsis thaliana]
Length=911

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRT-PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY   ++   R +  +SCSV + P+      +K PR+R+ + EG GKSMED+V+
Sbjct  36   SALSLCPYTFTFRQSSRIKSTVSCSVTSAPASGTSSSSKTPRRRSGRLEGVGKSMEDSVK  95

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEG+DGPPLRILPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDE G+ KI+
Sbjct  96   RKMEQFYEGTDGPPLRILPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDEPGIQKIM  155

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  156  PDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  191



>ref|XP_009359453.1| PREDICTED: uncharacterized protein LOC103950027 isoform X1 [Pyrus 
x bretschneideri]
Length=920

 Score =   229 bits (585),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 126/153 (82%), Gaps = 2/153 (1%)
 Frame = +1

Query  220  GVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKM  399
             +S CPY L ++P    R +SCSV + +    R + +  +R+ + EG  KSMED+VQRKM
Sbjct  33   ALSPCPYSLLWRPKTSNRCVSCSVGSSTATGTRRSNV--RRSGRMEGPRKSMEDSVQRKM  90

Query  400  EQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDT  579
            EQFYEG +GPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DELGV KIIPDT
Sbjct  91   EQFYEGREGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFDELGVQKIIPDT  150

Query  580  TFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TFI+KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  151  TFIKKWSHKIEAIVITHGHEDHIGALPWVIPAL  183



>ref|XP_002864846.1| EMB2746 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41105.1| EMB2746 [Arabidopsis lyrata subsp. lyrata]
Length=927

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRT-PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY   ++   R +  +SCSV + P+      +K PR+R+ + EG GKSMED+V+
Sbjct  35   SALSLCPYTFTFRQSSRIKSTVSCSVTSAPASGTSPSSKTPRRRSGRPEGVGKSMEDSVK  94

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDE GV KI+
Sbjct  95   RKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDEPGVQKIM  154

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  155  PDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  190



>ref|XP_010484076.1| PREDICTED: uncharacterized protein LOC104762480 [Camelina sativa]
Length=899

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 130/167 (78%), Gaps = 5/167 (3%)
 Frame = +1

Query  181  DCRMKMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRT-PSVKDIRGAKLPRKRNVKGE  357
            D R    + +F S +SLCP+   ++P  R   I CSV + P+       K  R+R+ + E
Sbjct  17   DVRRPAKMAAF-SALSLCPHTFNFRPNSR---IKCSVTSAPASGTSSSPKTQRRRSGRPE  72

Query  358  GAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFP  537
            GAGKSMED+V+RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP
Sbjct  73   GAGKSMEDSVKRKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFP  132

Query  538  GYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
             YDE GV KI+PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  133  DYDEPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  179



>ref|XP_009375227.1| PREDICTED: uncharacterized protein LOC103964064 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375236.1| PREDICTED: uncharacterized protein LOC103964071 isoform X1 [Pyrus 
x bretschneideri]
Length=920

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = +1

Query  223  VSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            +S CPY L ++P    R  SCS  +P+    RG+ +  +R+ + EG  KSMED+V+RKME
Sbjct  34   LSPCPYSLLWRPKAVGRCFSCSAGSPTAAGTRGSNV--RRSGRMEGPRKSMEDSVKRKME  91

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG +GPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DELGV KIIPDTT
Sbjct  92   QFYEGREGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFDELGVQKIIPDTT  151

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            FI+KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  152  FIKKWSHKIEAIVITHGHEDHIGALPWVIPAL  183



>ref|XP_009346516.1| PREDICTED: uncharacterized protein LOC103938240 [Pyrus x bretschneideri]
Length=920

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = +1

Query  223  VSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            +S CPY L ++P    R  SCS  +P+    RG+ +  +R+ + EG  KSMED+V+RKME
Sbjct  34   LSPCPYSLLWRPKAVGRCFSCSSGSPTAAGTRGSNV--RRSGRMEGPRKSMEDSVKRKME  91

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG +GPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DELGV KIIPDTT
Sbjct  92   QFYEGREGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFDELGVQKIIPDTT  151

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            FI+KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  152  FIKKWSHKIEAIVITHGHEDHIGALPWVIPAL  183



>ref|XP_010519514.1| PREDICTED: uncharacterized protein LOC104798948 isoform X1 [Tarenaya 
hassleriana]
Length=904

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPY   ++   R R       +        +K+PR+R+ + EG G+SMED+V+RK
Sbjct  35   SALSLCPYTFSFRARSRNRSSVSYSASSPPASGTSSKVPRRRSSRLEGPGRSMEDSVKRK  94

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KIIPD
Sbjct  95   MEQFYEGADGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEPGVQKIIPD  154

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI++W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  155  TTFIKRWRHKIEAVVITHGHEDHIGALPWVIPAL  188



>ref|XP_010519515.1| PREDICTED: uncharacterized protein LOC104798948 isoform X2 [Tarenaya 
hassleriana]
Length=904

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRK  396
            S +SLCPY   ++   R R       +        +K+PR+R+ + EG G+SMED+V+RK
Sbjct  35   SALSLCPYTFSFRARSRNRSSVSYSASSPPASGTSSKVPRRRSSRLEGPGRSMEDSVKRK  94

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            MEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KIIPD
Sbjct  95   MEQFYEGADGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEPGVQKIIPD  154

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TTFI++W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  155  TTFIKRWRHKIEAVVITHGHEDHIGALPWVIPAL  188



>ref|XP_008811803.1| PREDICTED: uncharacterized protein LOC103722876 isoform X3 [Phoenix 
dactylifera]
Length=701

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = +1

Query  226  SLCPYKLWYQPLLRRRFISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            SLCP  L  +P L +  + CS+  + SV   R +K+ R+++ + EG  KSMED VQRK+E
Sbjct  9    SLCPCGLSRRPRLPKSIVRCSLGSSSSVPGSRESKVSRRKSRRTEGVRKSMEDPVQRKLE  68

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KI+PD T
Sbjct  69   QFYEGLDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIVPDIT  128

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            FI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  129  FIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  160



>ref|XP_008392826.1| PREDICTED: uncharacterized protein LOC103455013 isoform X1 [Malus 
domestica]
Length=917

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +1

Query  187  RMKMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAG  366
            R   A  +    +S CPY L ++P    R +S SV + +    R + +  +R+ + EG  
Sbjct  22   RSASAQMAALGALSPCPYSLLWRPKTSNRCVSXSVGSSTATGTRRSNV--RRSGRMEGPR  79

Query  367  KSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYD  546
            KSMED+VQRKMEQFYEG +GPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +D
Sbjct  80   KSMEDSVQRKMEQFYEGREGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFD  139

Query  547  ELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            ELGV KIIPDTTFI+KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  140  ELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPAL  183



>ref|XP_008374252.1| PREDICTED: uncharacterized protein LOC103437549 isoform X1 [Malus 
domestica]
Length=917

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = +1

Query  223  VSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            +S CPY L ++P    R +SCSV + +     G+ +  +R+ + EG  KSMED+V+RKME
Sbjct  34   LSPCPYSLLWRPKAAGRCVSCSVGSSTAAGTHGSNV--RRSGRMEGPRKSMEDSVKRKME  91

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG +GPP+R+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP +DELGV KIIPDTT
Sbjct  92   QFYEGKEGPPIRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDFDELGVQKIIPDTT  151

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            FI+KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  152  FIKKWSHKIEAIVITHGHEDHIGALPWVIPAL  183



>ref|XP_008645344.1| PREDICTED: uncharacterized protein LOC103626744 isoform X1 [Zea 
mays]
Length=874

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 130/172 (76%), Gaps = 18/172 (10%)
 Frame = +1

Query  202  VTSFTSGVSLCPYKLWYQPLLRRRFIS-----------CSVRTPSV--KDIRGAKLPRKR  342
            + +  S  SLCP  +      RRR  S           C+V TPS   K  + ++ PR+R
Sbjct  1    MVALASLSSLCPCGI-----ARRRAASATSSTAFSISCCAVATPSFSGKGPQESRTPRRR  55

Query  343  NVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDA  522
              K EGA KS+ED+V+RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDA
Sbjct  56   LRKTEGATKSLEDSVKRKMEQFYEGADGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDA  115

Query  523  GVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  116  GVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPAL  167



>ref|XP_008811801.1| PREDICTED: uncharacterized protein LOC103722876 isoform X1 [Phoenix 
dactylifera]
Length=889

 Score =   226 bits (576),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = +1

Query  226  SLCPYKLWYQPLLRRRFISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            SLCP  L  +P L +  + CS+  + SV   R +K+ R+++ + EG  KSMED VQRK+E
Sbjct  9    SLCPCGLSRRPRLPKSIVRCSLGSSSSVPGSRESKVSRRKSRRTEGVRKSMEDPVQRKLE  68

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KI+PD T
Sbjct  69   QFYEGLDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIVPDIT  128

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            FI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  129  FIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  160



>dbj|BAD28842.1| putative metallo beta subunit lactamase [Oryza sativa Japonica 
Group]
Length=506

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  298  PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMN  477
            PS K  + ++ PR+R  K EGA KS+ED+V+RKMEQFYEG DGPPLR+LPIGGLGEIGMN
Sbjct  36   PSAKGSQESRTPRRRVRKTEGATKSLEDSVKRKMEQFYEGLDGPPLRVLPIGGLGEIGMN  95

Query  478  CMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGAL  657
            CMLVG YDRYILIDAGVMFP +DE GV KIIPDTTFI+KWSHKIEAVIITHGHEDHIGAL
Sbjct  96   CMLVGNYDRYILIDAGVMFPDFDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGAL  155

Query  658  PWVIPAL  678
            PWVIPAL
Sbjct  156  PWVIPAL  162



>ref|XP_006279731.1| hypothetical protein CARUB_v10027519mg [Capsella rubella]
 gb|EOA12629.1| hypothetical protein CARUB_v10027519mg [Capsella rubella]
Length=908

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRT-PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQ  390
            S +SLCPY   ++   R +  +SCSV + P+      +K PR+R    EG GKSMED+V+
Sbjct  36   SALSLCPYTFTFRQSSRIKSTVSCSVTSAPASGTSSSSKTPRRRR---EGVGKSMEDSVK  92

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDE GV KI+
Sbjct  93   RKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDEPGVQKIM  152

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PDT FI +W H+IEAV+ITHGHEDHIGALPWVIPAL
Sbjct  153  PDTGFIRRWKHQIEAVVITHGHEDHIGALPWVIPAL  188



>ref|XP_007155529.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
 gb|ESW27523.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
Length=869

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 128/155 (83%), Gaps = 2/155 (1%)
 Frame = +1

Query  220  GVSLCPYKLW--YQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
             +SLCP+     ++P   RR +SCS+ + S+ D  G K+ RKR+ + EG  KSMED+VQR
Sbjct  6    SLSLCPHTFCCRHRPYSTRRSLSCSLSSSSLLDTDGHKVLRKRSRRIEGPRKSMEDSVQR  65

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KME+FYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDELG+ KIIP
Sbjct  66   KMEEFYEGRDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDELGIQKIIP  125

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI KW HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  DTTFIRKWRHKIEAVIITHGHEDHIGALPWVIPAL  160



>ref|XP_002451689.1| hypothetical protein SORBIDRAFT_04g005900 [Sorghum bicolor]
 gb|EES04665.1| hypothetical protein SORBIDRAFT_04g005900 [Sorghum bicolor]
Length=875

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  CSVRTPSV--KDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGG  456
            C+V TPS   K  + ++ PR+R  K EGA KS+ED+V+RKMEQFYEG DGPPLR+LPIGG
Sbjct  34   CAVATPSSSGKGPQESRTPRRRLRKTEGATKSLEDSVKRKMEQFYEGVDGPPLRVLPIGG  93

Query  457  LGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGH  636
            LGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHGH
Sbjct  94   LGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHGH  153

Query  637  EDHIGALPWVIPAL  678
            EDHIGALPWVIPAL
Sbjct  154  EDHIGALPWVIPAL  167



>ref|XP_007155530.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
 gb|ESW27524.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
Length=870

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 128/155 (83%), Gaps = 2/155 (1%)
 Frame = +1

Query  220  GVSLCPYKLW--YQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQR  393
             +SLCP+     ++P   RR +SCS+ + S+ D  G K+ RKR+ + EG  KSMED+VQR
Sbjct  6    SLSLCPHTFCCRHRPYSTRRSLSCSLSSSSLLDTDGHKVLRKRSRRIEGPRKSMEDSVQR  65

Query  394  KMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIP  573
            KME+FYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDELG+ KIIP
Sbjct  66   KMEEFYEGRDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDELGIQKIIP  125

Query  574  DTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            DTTFI KW HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  126  DTTFIRKWRHKIEAVIITHGHEDHIGALPWVIPAL  160



>ref|XP_010909137.1| PREDICTED: uncharacterized protein LOC105035311 isoform X2 [Elaeis 
guineensis]
Length=879

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = +1

Query  226  SLCPYKLWYQPLLRRRFISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            SLCP  L  +P L +  + CS+  + SV   +  ++ R+++ + EG  KSMED VQRK+E
Sbjct  9    SLCPCGLSGRPRLPKSIVRCSLGSSSSVPGAQELEVSRRKSRRTEGVRKSMEDPVQRKLE  68

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KI+PDTT
Sbjct  69   QFYEGLDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIVPDTT  128

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            FI++WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  129  FIKRWSHKIEAVVITHGHEDHIGALPWVIPAL  160



>emb|CDX84407.1| BnaC03g50930D [Brassica napus]
Length=893

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 3/157 (2%)
 Frame = +1

Query  217  SGVSLCPYKLWYQPLLR-RRFISCSVRTPSVKDIRGA--KLPRKRNVKGEGAGKSMEDAV  387
            S +SL PY   ++   R R  ISCSV +P       +  K PR+R+ + EGAGKSMED+V
Sbjct  33   SALSLSPYTFTFRQSSRVRSTISCSVTSPPASSGTSSSSKAPRRRSGRLEGAGKSMEDSV  92

Query  388  QRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKI  567
            +RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YD+ GV KI
Sbjct  93   KRKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDDPGVQKI  152

Query  568  IPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            +PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  153  MPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  189



>ref|XP_010045503.1| PREDICTED: uncharacterized protein LOC104434227 [Eucalyptus grandis]
Length=867

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +1

Query  322  AKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYD  501
            +K+PRK++ + EGAGKSMED+V+RKMEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG +D
Sbjct  19   SKIPRKKSGRMEGAGKSMEDSVKRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNFD  78

Query  502  RYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            RYILIDAGVMFP YDE+GV KIIPDTTFI +WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  79   RYILIDAGVMFPDYDEIGVQKIIPDTTFIRRWSHKIEAVVITHGHEDHIGALPWVIPAL  137



>gb|KCW83176.1| hypothetical protein EUGRSUZ_B00129 [Eucalyptus grandis]
Length=861

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +1

Query  322  AKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYD  501
            +K+PRK++ + EGAGKSMED+V+RKMEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG +D
Sbjct  13   SKIPRKKSGRMEGAGKSMEDSVKRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNFD  72

Query  502  RYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            RYILIDAGVMFP YDE+GV KIIPDTTFI +WSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  73   RYILIDAGVMFPDYDEIGVQKIIPDTTFIRRWSHKIEAVVITHGHEDHIGALPWVIPAL  131



>gb|EEE57142.1| hypothetical protein OsJ_07047 [Oryza sativa Japonica Group]
Length=868

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  298  PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMN  477
            PS K  + ++ PR+R  K EGA KS+ED+V+RKMEQFYEG DGPPLR+LPIGGLGEIGMN
Sbjct  36   PSAKGSQESRTPRRRVRKTEGATKSLEDSVKRKMEQFYEGLDGPPLRVLPIGGLGEIGMN  95

Query  478  CMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGAL  657
            CMLVG YDRYILIDAGVMFP +DE GV KIIPDTTFI+KWSHKIEAVIITHGHEDHIGAL
Sbjct  96   CMLVGNYDRYILIDAGVMFPDFDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGAL  155

Query  658  PWVIPAL  678
            PWVIPAL
Sbjct  156  PWVIPAL  162



>gb|EMS68688.1| Ribonuclease J [Triticum urartu]
Length=369

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = +1

Query  277  ISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIG  453
            ISC V  TPS +    +++PR+R  + EGA KSMED+V+RKMEQFYEG DGPPLR+LPIG
Sbjct  27   ISCCVLATPSGRGSHESRIPRRRFRRTEGATKSMEDSVKRKMEQFYEGVDGPPLRVLPIG  86

Query  454  GLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHG  633
            GLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHG
Sbjct  87   GLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHG  146

Query  634  HEDHIGALPWVIPAL  678
            HEDHIGALPWVIPAL
Sbjct  147  HEDHIGALPWVIPAL  161



>gb|EEC73354.1| hypothetical protein OsI_07566 [Oryza sativa Indica Group]
Length=871

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  298  PSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMN  477
            PS K  + ++ PR+R  K EGA KS+ED+V+RKMEQFYEG DGPPLR+LPIGGLGEIGMN
Sbjct  36   PSAKGSQESRTPRRRVRKTEGATKSLEDSVKRKMEQFYEGLDGPPLRVLPIGGLGEIGMN  95

Query  478  CMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGAL  657
            CMLVG YDRYILIDAGVMFP +DE GV KIIPDTTFI+KWSHKIEAVIITHGHEDHIGAL
Sbjct  96   CMLVGNYDRYILIDAGVMFPDFDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGAL  155

Query  658  PWVIPAL  678
            PWVIPAL
Sbjct  156  PWVIPAL  162



>ref|XP_004297533.1| PREDICTED: uncharacterized protein LOC101299666 [Fragaria vesca 
subsp. vesca]
Length=897

 Score =   221 bits (562),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +1

Query  220  GVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKM  399
             +S CPY L  +     R +SCS+ + +           KR+ + EG  KSMED+VQRKM
Sbjct  29   ALSPCPYTLLSRLKSSHRSVSCSLGSSTAPSTGTRGSGYKRSGRVEGPRKSMEDSVQRKM  88

Query  400  EQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDT  579
            EQFYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP +DELGV KIIPDT
Sbjct  89   EQFYEGRDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDFDELGVQKIIPDT  148

Query  580  TFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            TFI KW HKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  149  TFIRKWKHKIEAIVITHGHEDHIGALPWVIPAL  181



>gb|AES91056.2| RNA-metabolising metallo-beta-lactamase [Medicago truncatula]
Length=721

 Score =   219 bits (557),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  196  MAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSV-KDIRGAKLPRKRNVKGEGAGKS  372
            +   S +   +L  Y  +++    RR   C  R+ ++ +D  GAK+  KR  + EG  KS
Sbjct  2    VTCNSISLSHNLHFYTRFHRLHPTRRSHYCRFRSNALPRDTDGAKVVHKRPRRIEGPRKS  61

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG +DRYIL+DAGVMFPG DEL
Sbjct  62   MEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNHDRYILVDAGVMFPGDDEL  121

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIP L
Sbjct  122  GVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPML  163



>ref|XP_003608859.1| Ribonuclease J [Medicago truncatula]
Length=739

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  196  MAVTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSV-KDIRGAKLPRKRNVKGEGAGKS  372
            +   S +   +L  Y  +++    RR   C  R+ ++ +D  GAK+  KR  + EG  KS
Sbjct  2    VTCNSISLSHNLHFYTRFHRLHPTRRSHYCRFRSNALPRDTDGAKVVHKRPRRIEGPRKS  61

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG +DRYIL+DAGVMFPG DEL
Sbjct  62   MEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNHDRYILVDAGVMFPGDDEL  121

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIP L
Sbjct  122  GVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPML  163



>ref|XP_010460357.1| PREDICTED: uncharacterized protein LOC104741250 [Camelina sativa]
Length=900

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 129/168 (77%), Gaps = 6/168 (4%)
 Frame = +1

Query  181  DCRMKMAVTSFTSGVSLCPYKLWYQPLLRRRFISCSV--RTPSVKDIRGAKLPRKRNVKG  354
            D R    + +F S +SLCP+   ++P  R   I CSV     S      +K PR+R+ + 
Sbjct  17   DVRRPAKMAAF-SALSLCPHTFNFRPNSR---IKCSVTSAPASSGTSSSSKTPRRRSGRP  72

Query  355  EGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMF  534
            EG GKSMED+V+RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MF
Sbjct  73   EGVGKSMEDSVKRKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMF  132

Query  535  PGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            P YDE GV KI+PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  133  PDYDEPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  180



>ref|XP_009150395.1| PREDICTED: uncharacterized protein LOC103873754 [Brassica rapa]
Length=907

 Score =   219 bits (557),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 125/161 (78%), Gaps = 7/161 (4%)
 Frame = +1

Query  217  SGVSLCPYKLWY-QPLLRRRFISCSVRTPSVKDIRGA------KLPRKRNVKGEGAGKSM  375
            S +SL PY   + Q    R  +SCSV +P       +      K PR+R+ + EGAGKSM
Sbjct  34   SALSLSPYSFTFRQSSPVRSTVSCSVTSPPASSGTSSSSSSSNKTPRRRSGRLEGAGKSM  93

Query  376  EDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELG  555
            ED+V+RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YD+ G
Sbjct  94   EDSVKRKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDDPG  153

Query  556  VVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            V KI+PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  154  VQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  194



>ref|XP_004952679.1| PREDICTED: uncharacterized protein LOC101761263 isoform X1 [Setaria 
italica]
Length=878

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +1

Query  283  CSVRTPSV-KDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGL  459
            C+V  PS  K  + ++ PRK+  + EGA KS+ED+V+RK+EQFYEG DGPPLR+LPIGGL
Sbjct  40   CAVAIPSSGKGPQESRTPRKKLRRTEGATKSLEDSVKRKLEQFYEGVDGPPLRVLPIGGL  99

Query  460  GEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHE  639
            GEIGMNCMLVG YDRYILIDAGVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHGHE
Sbjct  100  GEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHE  159

Query  640  DHIGALPWVIPAL  678
            DHIGALPWVIPAL
Sbjct  160  DHIGALPWVIPAL  172



>ref|XP_006578697.1| PREDICTED: uncharacterized protein LOC100783850 isoform X2 [Glycine 
max]
Length=886

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  331  PRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYI  510
            PRKR  + EG  KSMED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG +DRYI
Sbjct  44   PRKRTRRIEGPRKSMEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNHDRYI  103

Query  511  LIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            LIDAGVMFP YDELGV KIIPDTTFI KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  104  LIDAGVMFPDYDELGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPAL  159



>ref|XP_003522430.1| PREDICTED: uncharacterized protein LOC100783850 isoform X1 [Glycine 
max]
Length=888

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  331  PRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYI  510
            PRKR  + EG  KSMED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG +DRYI
Sbjct  46   PRKRTRRIEGPRKSMEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNHDRYI  105

Query  511  LIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            LIDAGVMFP YDELGV KIIPDTTFI KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  106  LIDAGVMFPDYDELGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPAL  161



>ref|XP_007137930.1| hypothetical protein PHAVU_009G167400g [Phaseolus vulgaris]
 gb|ESW09924.1| hypothetical protein PHAVU_009G167400g [Phaseolus vulgaris]
Length=871

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +1

Query  322  AKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYD  501
             K PR R  + EG  KSMED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG +D
Sbjct  40   TKAPRGRARRNEGPRKSMEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNHD  99

Query  502  RYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            RYILIDAGVMFP YDELGV KIIPDTTFI KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  100  RYILIDAGVMFPDYDELGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPAL  158



>gb|KHN31905.1| Ribonuclease J [Glycine soja]
Length=888

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  331  PRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYI  510
            PRKR  + EG  KSMED+VQRKMEQFYEGSDGPPLR+LPIGGLGEIGMNCMLVG +DRYI
Sbjct  46   PRKRTRRIEGPRKSMEDSVQRKMEQFYEGSDGPPLRVLPIGGLGEIGMNCMLVGNHDRYI  105

Query  511  LIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            LIDAGVMFP YDELGV KIIPDTTFI KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  106  LIDAGVMFPDYDELGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPAL  161



>emb|CDY41516.1| BnaA06g22690D [Brassica napus]
Length=1149

 Score =   220 bits (560),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 125/160 (78%), Gaps = 6/160 (4%)
 Frame = +1

Query  217  SGVSLCPYKLWY-QPLLRRRFISCSVRTPSVKDIRGA-----KLPRKRNVKGEGAGKSME  378
            S +SL PY   + Q    R  +SCSV +P       +     K PR+R+ + EGAGKSME
Sbjct  34   SALSLSPYSFTFRQSSPVRSTVSCSVTSPPASSGTSSSSSSNKTPRRRSGRLEGAGKSME  93

Query  379  DAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGV  558
            D+V+RKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YD+ GV
Sbjct  94   DSVKRKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDDPGV  153

Query  559  VKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
             KI+PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  154  QKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPAL  193



>ref|XP_006600800.1| PREDICTED: uncharacterized protein LOC100814619 isoform X1 [Glycine 
max]
Length=870

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 3/157 (2%)
 Frame = +1

Query  217  SGVSLCPYKLW--YQPL-LRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAV  387
            + +SLCP+     ++P   RR   SCS+   S+ D  G K+ RKR+ + EG  KSMED+V
Sbjct  5    TSLSLCPHTFCCRHRPHPTRRSLASCSLSPSSLPDTDGPKVLRKRSRRIEGPRKSMEDSV  64

Query  388  QRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKI  567
            Q KME+FYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDELGV KI
Sbjct  65   QCKMEEFYEGQDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDELGVQKI  124

Query  568  IPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            IPDTTFI KW HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  125  IPDTTFIRKWKHKIEAVIITHGHEDHIGALPWVIPAL  161



>ref|XP_006600801.1| PREDICTED: uncharacterized protein LOC100814619 isoform X2 [Glycine 
max]
Length=869

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 3/157 (2%)
 Frame = +1

Query  217  SGVSLCPYKLW--YQPL-LRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAV  387
            + +SLCP+     ++P   RR   SCS+   S+ D  G K+ RKR+ + EG  KSMED+V
Sbjct  5    TSLSLCPHTFCCRHRPHPTRRSLASCSLSPSSLPDTDGPKVLRKRSRRIEGPRKSMEDSV  64

Query  388  QRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKI  567
            Q KME+FYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDELGV KI
Sbjct  65   QCKMEEFYEGQDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDELGVQKI  124

Query  568  IPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            IPDTTFI KW HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  125  IPDTTFIRKWKHKIEAVIITHGHEDHIGALPWVIPAL  161



>ref|XP_004500652.1| PREDICTED: ribonuclease J-like isoform X1 [Cicer arietinum]
Length=863

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 126/159 (79%), Gaps = 4/159 (3%)
 Frame = +1

Query  202  VTSFTSGVSLCPYKLWYQPLLRRRFISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMED  381
            + S T+ + L    L+++P L    +S S  + S  D   ++ P KR  + EG  KSMED
Sbjct  1    MASLTTSLPL----LFHRPKLTTLSVSASALSASGSDGSNSRAPHKRRRRIEGPRKSMED  56

Query  382  AVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVV  561
            +VQRKMEQFYEG+DGPPLR+LPIGGLGEIGMNCMLVG +DRYILIDAG+MFP YD+LGV 
Sbjct  57   SVQRKMEQFYEGTDGPPLRVLPIGGLGEIGMNCMLVGNHDRYILIDAGIMFPDYDDLGVQ  116

Query  562  KIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            KIIPDTTFI KWSHKIEA++ITHGHEDHIGALPWVIPAL
Sbjct  117  KIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPAL  155



>gb|EMT12329.1| Ribonuclease J [Aegilops tauschii]
Length=851

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = +1

Query  277  ISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIG  453
            ISC V  TPS +    +++PR+R  + EGA KSMED+V+RKMEQFYEG DGPPLR+LPIG
Sbjct  27   ISCCVLATPSGRGSHESRIPRRRFRRTEGATKSMEDSVKRKMEQFYEGVDGPPLRVLPIG  86

Query  454  GLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHG  633
            GLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHG
Sbjct  87   GLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHG  146

Query  634  HEDHIGALPWVIPAL  678
            HEDHIGALPWVIPAL
Sbjct  147  HEDHIGALPWVIPAL  161



>ref|XP_006581877.1| PREDICTED: uncharacterized protein LOC100779771 isoform X2 [Glycine 
max]
Length=855

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +1

Query  331  PRKRNV-KGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRY  507
            PRKR   + EG  KSMED+VQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVG  DRY
Sbjct  43   PRKRRTGRIEGPRKSMEDSVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGNNDRY  102

Query  508  ILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            ILIDAGVMFP YDELGV KIIPDTTFI KWSHKIEA+IITHGHEDHIGALPWVIPAL
Sbjct  103  ILIDAGVMFPDYDELGVQKIIPDTTFIRKWSHKIEALIITHGHEDHIGALPWVIPAL  159



>ref|XP_006581876.1| PREDICTED: uncharacterized protein LOC100779771 isoform X1 [Glycine 
max]
Length=884

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +1

Query  331  PRKRNV-KGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRY  507
            PRKR   + EG  KSMED+VQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVG  DRY
Sbjct  43   PRKRRTGRIEGPRKSMEDSVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGNNDRY  102

Query  508  ILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            ILIDAGVMFP YDELGV KIIPDTTFI KWSHKIEA+IITHGHEDHIGALPWVIPAL
Sbjct  103  ILIDAGVMFPDYDELGVQKIIPDTTFIRKWSHKIEALIITHGHEDHIGALPWVIPAL  159



>gb|KHN23276.1| Ribonuclease J [Glycine soja]
Length=884

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +1

Query  331  PRKRNV-KGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRY  507
            PRKR   + EG  KSMED+VQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVG  DRY
Sbjct  43   PRKRRTGRIEGPRKSMEDSVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGNNDRY  102

Query  508  ILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            ILIDAGVMFP YDELGV KIIPDTTFI KWSHKIEA+IITHGHEDHIGALPWVIPAL
Sbjct  103  ILIDAGVMFPDYDELGVQKIIPDTTFIRKWSHKIEALIITHGHEDHIGALPWVIPAL  159



>gb|AES72341.2| RNA-metabolising metallo-beta-lactamase [Medicago truncatula]
Length=867

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  307  KDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCML  486
             D   +++P+KR  + EG  KSMED+VQR+MEQFYEG+DGPPLR+LPIGGLGEIGMNCML
Sbjct  36   NDGSTSRVPQKRRRRIEGPRKSMEDSVQRRMEQFYEGNDGPPLRVLPIGGLGEIGMNCML  95

Query  487  VGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWV  666
            VG +DRYILIDAG+MFP YD+LGV KIIPDTTFI KWSHKIEA++ITHGHEDHIGALPWV
Sbjct  96   VGNHDRYILIDAGIMFPDYDDLGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWV  155

Query  667  IPAL  678
            IPAL
Sbjct  156  IPAL  159



>ref|XP_003602090.1| Ribonuclease J [Medicago truncatula]
Length=959

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  307  KDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCML  486
             D   +++P+KR  + EG  KSMED+VQR+MEQFYEG+DGPPLR+LPIGGLGEIGMNCML
Sbjct  36   NDGSTSRVPQKRRRRIEGPRKSMEDSVQRRMEQFYEGNDGPPLRVLPIGGLGEIGMNCML  95

Query  487  VGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWV  666
            VG +DRYILIDAG+MFP YD+LGV KIIPDTTFI KWSHKIEA++ITHGHEDHIGALPWV
Sbjct  96   VGNHDRYILIDAGIMFPDYDDLGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWV  155

Query  667  IPAL  678
            IPAL
Sbjct  156  IPAL  159



>ref|XP_010235506.1| PREDICTED: uncharacterized protein LOC100825739 isoform X1 [Brachypodium 
distachyon]
Length=875

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  283  CSVRTP-SVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGL  459
            C+V TP S K    +++PR+R  + EGA KSMED+V+RK+EQFYEG DGPPLR+LPIGGL
Sbjct  34   CAVATPPSGKGSHESRIPRRRFRRTEGATKSMEDSVKRKLEQFYEGLDGPPLRVLPIGGL  93

Query  460  GEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHE  639
            GEIGMNCMLVG YDRYILIDAGVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHGHE
Sbjct  94   GEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHE  153

Query  640  DHIGALPWVIPAL  678
            DHIGALPWVIPAL
Sbjct  154  DHIGALPWVIPAL  166



>ref|XP_010909140.1| PREDICTED: uncharacterized protein LOC105035311 isoform X5 [Elaeis 
guineensis]
Length=706

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = +1

Query  226  SLCPYKLWYQPLLRRRFISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            SLCP  L  +P L +  + CS+  + SV   +  ++ R+++ + EG  KSMED VQRK+E
Sbjct  9    SLCPCGLSGRPRLPKSIVRCSLGSSSSVPGAQELEVSRRKSRRTEGVRKSMEDPVQRKLE  68

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KI+PDTT
Sbjct  69   QFYEGLDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIVPDTT  128

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPW-----VIPAL  678
            FI++WSHKIEAV+ITHGHEDHI +  +     VIPAL
Sbjct  129  FIKRWSHKIEAVVITHGHEDHIVSASYCSVKQVIPAL  165



>gb|KHG13818.1| Ribonuclease J [Gossypium arboreum]
Length=790

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +1

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQRKMEQFYEG+ GPPLR+LPIGGLGEIGMNCMLVG+YDRYILIDAGVMFP YDEL
Sbjct  1    MEDSVQRKMEQFYEGTAGPPLRVLPIGGLGEIGMNCMLVGHYDRYILIDAGVMFPDYDEL  60

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI+KWSHKIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  61   GVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPAL  102



>ref|XP_010909138.1| PREDICTED: uncharacterized protein LOC105035311 isoform X3 [Elaeis 
guineensis]
Length=865

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = +1

Query  226  SLCPYKLWYQPLLRRRFISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            SLCP  L  +P L +  + CS+  + SV   +  ++ R+++ + EG  KSMED VQRK+E
Sbjct  9    SLCPCGLSGRPRLPKSIVRCSLGSSSSVPGAQELEVSRRKSRRTEGVRKSMEDPVQRKLE  68

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KI+PDTT
Sbjct  69   QFYEGLDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIVPDTT  128

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPW-----VIPAL  678
            FI++WSHKIEAV+ITHGHEDHI +  +     VIPAL
Sbjct  129  FIKRWSHKIEAVVITHGHEDHIVSASYCSVKQVIPAL  165



>ref|XP_010909136.1| PREDICTED: uncharacterized protein LOC105035311 isoform X1 [Elaeis 
guineensis]
Length=884

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = +1

Query  226  SLCPYKLWYQPLLRRRFISCSV-RTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKME  402
            SLCP  L  +P L +  + CS+  + SV   +  ++ R+++ + EG  KSMED VQRK+E
Sbjct  9    SLCPCGLSGRPRLPKSIVRCSLGSSSSVPGAQELEVSRRKSRRTEGVRKSMEDPVQRKLE  68

Query  403  QFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTT  582
            QFYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAGVMFP YDE GV KI+PDTT
Sbjct  69   QFYEGLDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIVPDTT  128

Query  583  FIEKWSHKIEAVIITHGHEDHIGALPW-----VIPAL  678
            FI++WSHKIEAV+ITHGHEDHI +  +     VIPAL
Sbjct  129  FIKRWSHKIEAVVITHGHEDHIVSASYCSVKQVIPAL  165



>ref|XP_002975019.1| hypothetical protein SELMODRAFT_102611, partial [Selaginella 
moellendorffii]
 gb|EFJ23804.1| hypothetical protein SELMODRAFT_102611, partial [Selaginella 
moellendorffii]
Length=829

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  355  EGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMF  534
            EGAG S +DAVQR M +FYEG +GPPLRILPIGGLGEIGMNCMLVG+YDRYI+IDAG+MF
Sbjct  8    EGAGHSKDDAVQRTMRKFYEGRNGPPLRILPIGGLGEIGMNCMLVGHYDRYIMIDAGLMF  67

Query  535  PGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            P Y++ GVVK++PDTTFI +W HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  68   PDYEDFGVVKVLPDTTFISRWKHKIEAVIITHGHEDHIGALPWVIPAL  115



>gb|KHN14093.1| Ribonuclease J [Glycine soja]
Length=810

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            MED+VQ KME+FYEG DGPPLR+LPIGGLGEIGMNCMLVG YDRYILIDAG+MFP YDEL
Sbjct  1    MEDSVQCKMEEFYEGQDGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGIMFPDYDEL  60

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            GV KIIPDTTFI KW HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  61   GVQKIIPDTTFIRKWKHKIEAVIITHGHEDHIGALPWVIPAL  102



>ref|XP_002977440.1| hypothetical protein SELMODRAFT_107166, partial [Selaginella 
moellendorffii]
 gb|EFJ21444.1| hypothetical protein SELMODRAFT_107166, partial [Selaginella 
moellendorffii]
Length=835

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  355  EGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMF  534
            EGAG S +DAVQR M +FYEG +GPPLRILPIGGLGEIGMNCMLVG+YDRYI+IDAG+MF
Sbjct  8    EGAGYSKDDAVQRTMRKFYEGRNGPPLRILPIGGLGEIGMNCMLVGHYDRYIMIDAGLMF  67

Query  535  PGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            P Y++ GVVK++PDTTFI +W HKIEAVIITHGHEDHIGALPWVIPAL
Sbjct  68   PDYEDFGVVKVLPDTTFISRWKHKIEAVIITHGHEDHIGALPWVIPAL  115



>ref|XP_001775526.1| predicted protein [Physcomitrella patens]
 gb|EDQ59723.1| predicted protein, partial [Physcomitrella patens]
Length=582

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  355  EGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMF  534
            EG  +S +DAV RKM+ F+EGSDGPPLR+LPIGGLGEIGMNCMLVG YDRYI+IDAG+MF
Sbjct  4    EGPKRSRDDAVTRKMKSFHEGSDGPPLRVLPIGGLGEIGMNCMLVGNYDRYIMIDAGLMF  63

Query  535  PGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            P YD+LG+ K++PDT FI +W  KIEAVIITHGHEDHIGALPWVIPAL
Sbjct  64   PDYDDLGIQKVLPDTQFIHRWRDKIEAVIITHGHEDHIGALPWVIPAL  111



>ref|XP_001419620.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97913.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=413

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            D PPL+ILP+GGLGEIGMNCMLVG  DRY+L+DAG+MFP ++ELG+ K++PD +F+ +W 
Sbjct  2    DDPPLKILPLGGLGEIGMNCMLVGSGDRYVLLDAGLMFPDHEELGIQKVLPDVSFLARWK  61

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
             KIEAV+ITHGHEDHIGALPWV+PAL
Sbjct  62   DKIEAVLITHGHEDHIGALPWVVPAL  87



>ref|XP_001692070.1| hypothetical protein CHLREDRAFT_115745 [Chlamydomonas reinhardtii]
 gb|EDP04560.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=415

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  424  GPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSH  603
            GPPLRILPIGGLGEIGMNCML G  DRY++IDAG+MFP + +LG+ KI+PDT F+ +W  
Sbjct  1    GPPLRILPIGGLGEIGMNCMLAGVGDRYVVIDAGLMFPDFSDLGMQKILPDTDFLAQWKD  60

Query  604  KIEAVIITHGHEDHIGALPWVIPAL  678
            +IEA+IITHGHEDHIGALPWV+PAL
Sbjct  61   RIEALIITHGHEDHIGALPWVVPAL  85



>ref|XP_007510671.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18204.1| predicted protein [Bathycoccus prasinos]
Length=850

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            D PP++ILP+GGLGEIGMNCMLVG  DRYIL+DAG+MFP ++ELG+ K++PD +F+++W 
Sbjct  204  DDPPIKILPLGGLGEIGMNCMLVGVNDRYILLDAGLMFPDHEELGIQKVLPDVSFLKRWR  263

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
             KIEAV+ITHGHEDHIGALPW IPAL
Sbjct  264  DKIEAVVITHGHEDHIGALPWAIPAL  289



>gb|KIZ01083.1| hypothetical protein MNEG_6877 [Monoraphidium neglectum]
Length=163

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR+LP+GGLGEIGMNCMLVG  DRYIL+DAG+MFP + +LG+ KI+PD +F+ +W  KIE
Sbjct  50   LRVLPVGGLGEIGMNCMLVGVRDRYILVDAGLMFPDFADLGMQKILPDVSFLAQWRDKIE  109

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            AV+ITHGHEDHIGALPWVIPAL
Sbjct  110  AVVITHGHEDHIGALPWVIPAL  131



>emb|CEF99170.1| Beta-lactamase-like [Ostreococcus tauri]
Length=729

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +1

Query  364  GKSMEDAVQRKMEQFYEGS--DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFP  537
            G+++E A ++           D PPL++LP+GGLGEIGMNCMLVG  DR++L+DAG+MFP
Sbjct  82   GQTLEYAAEKAFPAVEANDLIDDPPLKVLPLGGLGEIGMNCMLVGSGDRWVLLDAGLMFP  141

Query  538  GYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
             ++ELG+ K++PD +F+ +W  KIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  142  DHEELGIQKVLPDVSFLHRWRDKIEAVLITHGHEDHIGALPWVIPAL  188



>ref|XP_005846864.1| hypothetical protein CHLNCDRAFT_35723 [Chlorella variabilis]
 gb|EFN54762.1| hypothetical protein CHLNCDRAFT_35723 [Chlorella variabilis]
Length=814

 Score =   146 bits (368),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR+LPIGGLGEIGMNCML+G YDRYIL+DAG+MFP + +LG+ KI+PDT+F+ +W  KIE
Sbjct  94   LRVLPIGGLGEIGMNCMLIGVYDRYILVDAGLMFPDFTDLGMQKILPDTSFLAQWRDKIE  153

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            AV+ITHGHEDHIGALPWV PAL
Sbjct  154  AVVITHGHEDHIGALPWVWPAL  175



>ref|XP_011400344.1| Ribonuclease J [Auxenochlorella protothecoides]
 gb|KFM27377.1| Ribonuclease J [Auxenochlorella protothecoides]
Length=693

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR+LPIGGLGEIGMNCML+G  DRYIL+DAG+MFP   +LG+ K++PDT+F+ KW  KIE
Sbjct  84   LRVLPIGGLGEIGMNCMLIGVGDRYILLDAGLMFPDVTDLGMAKLLPDTSFLAKWKDKIE  143

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            AV ITHGHEDHIGALPWVIPAL
Sbjct  144  AVFITHGHEDHIGALPWVIPAL  165



>ref|XP_003057206.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58851.1| predicted protein [Micromonas pusilla CCMP1545]
Length=813

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            D PP++ LP+GGLGEIGMNC LVG  +RY+L+DAG+MFP ++ELG+ K++PD +F+ +W 
Sbjct  144  DDPPIKFLPLGGLGEIGMNCALVGTENRYVLLDAGLMFPDHEELGIQKVLPDVSFLSRWK  203

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
             KIEAV+ITHGHEDHIGALPWVIPAL
Sbjct  204  DKIEAVLITHGHEDHIGALPWVIPAL  229



>ref|XP_006647352.1| PREDICTED: uncharacterized protein LOC102710271 isoform X1 [Oryza 
brachyantha]
Length=778

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  472  MNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIG  651
            MNCMLVG YDRYILIDAGVMFP YDE GV KIIPDTTFI+KWSHKIEAVIITHGHEDHIG
Sbjct  1    MNCMLVGNYDRYILIDAGVMFPDYDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIG  60

Query  652  ALPWVIPAL  678
            ALPWVIPAL
Sbjct  61   ALPWVIPAL  69



>ref|XP_002949431.1| hypothetical protein VOLCADRAFT_59321 [Volvox carteri f. nagariensis]
 gb|EFJ49450.1| hypothetical protein VOLCADRAFT_59321 [Volvox carteri f. nagariensis]
Length=463

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LRILPIGGLGEIGMNCML G  DRY++IDAG+MFP + +LG+ KI+PDT F+ +W  +IE
Sbjct  32   LRILPIGGLGEIGMNCMLAGVRDRYVVIDAGLMFPDFSDLGMQKILPDTDFLAQWKDRIE  91

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+IITHGHEDHIGALPWV+PAL
Sbjct  92   ALIITHGHEDHIGALPWVVPAL  113



>gb|ACD36969.1| chloroplast RNase J variant 1 [Chlamydomonas reinhardtii]
Length=920

 Score =   140 bits (353),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LRILPIGGLGEIGMNCML G  DRY++IDAG+MFP + +LG+ KI+PDT F+ +W  +IE
Sbjct  119  LRILPIGGLGEIGMNCMLAGVGDRYVVIDAGLMFPDFSDLGMQKILPDTDFLAQWKDRIE  178

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+IITHGHEDHIGALPWV+PAL
Sbjct  179  ALIITHGHEDHIGALPWVVPAL  200



>gb|ACD36970.1| chloroplast RNase J variant 2 [Chlamydomonas reinhardtii]
Length=767

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LRILPIGGLGEIGMNCML G  DRY++IDAG+MFP + +LG+ KI+PDT F+ +W  +IE
Sbjct  119  LRILPIGGLGEIGMNCMLAGVGDRYVVIDAGLMFPDFSDLGMQKILPDTDFLAQWKDRIE  178

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+IITHGHEDHIGALPWV+PAL
Sbjct  179  ALIITHGHEDHIGALPWVVPAL  200



>ref|XP_002505947.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67205.1| predicted protein [Micromonas sp. RCC299]
Length=791

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            D  P++ LP+GGLGEIGMNC LVG  +RY+L+DAG+MFP ++ELG+ K++PD +F+ +W 
Sbjct  130  DDAPIKFLPLGGLGEIGMNCALVGTENRYVLLDAGLMFPDHEELGIQKVLPDVSFLARWR  189

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
             K+EAV+ITHGHEDHIGALPWVIPAL
Sbjct  190  DKVEAVLITHGHEDHIGALPWVIPAL  215



>gb|KDO52625.1| hypothetical protein CISIN_1g0392132mg, partial [Citrus sinensis]
Length=121

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  316  RGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGY  495
            R +K+PR+R  + EG  KSMED+VQRKMEQFYEGS+GPPLR+LPIGGLGEIGMNCMLVG 
Sbjct  2    RESKVPRRRTGRTEGPRKSMEDSVQRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGN  61

Query  496  YDRYILIDAG  525
            YDRYILIDAG
Sbjct  62   YDRYILIDAG  71



>gb|AIB09652.1| myb domain-containing regulator of transcription [Lotharella 
sp. CCMP622]
Length=654

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +1

Query  340  RNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILID  519
            +N+       S  + +++K+    E      L I+P+GGLGEIGMNCML+G  +R+ILID
Sbjct  63   KNINNFYKNISKNNIIRKKITNI-EKKINKGLVIIPLGGLGEIGMNCMLLGIDNRFILID  121

Query  520  AGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            AG++F   D +GV KIIPD  F+  +  KIE+++ITHGHEDHIGAL W+IP L
Sbjct  122  AGILFSDLDTIGVKKIIPDINFLAFFKDKIESIVITHGHEDHIGALEWIIPIL  174



>ref|XP_005646511.1| Metallo-hydrolase/oxidoreductase [Coccomyxa subellipsoidea C-169]
 gb|EIE21967.1| Metallo-hydrolase/oxidoreductase [Coccomyxa subellipsoidea C-169]
Length=662

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  472  MNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIG  651
            MNCMLVG  DRYILIDAG+MFP + +LG+ KI+PDT+F+ +W  KIEAVIITHGHEDHIG
Sbjct  1    MNCMLVGVGDRYILIDAGLMFPDFTDLGMQKILPDTSFLHRWRDKIEAVIITHGHEDHIG  60

Query  652  ALPWVIPAL  678
            A+PWV+PAL
Sbjct  61   AMPWVVPAL  69



>ref|XP_001712914.1| regulator of transcription that contains myb domains [Bigelowiella 
natans]
 gb|ABA27302.1| regulator of transcription that contains myb domains [Bigelowiella 
natans]
Length=636

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +1

Query  379  DAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGV  558
            + + RK  +  E      + ++P+GGLGEIGMNCML+G   R+ILID G+MF     LG+
Sbjct  55   NTILRKKNRVIEQVLDKDIIVVPLGGLGEIGMNCMLIGSKKRFILIDCGIMFTDLSHLGI  114

Query  559  VKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
             K+IPD  F+    + IE +IITHGHEDHIGA+ WV+P L
Sbjct  115  QKVIPDINFLTHIQNLIEGLIITHGHEDHIGAINWVLPIL  154



>ref|WP_011522894.1| ribonuclease J [Candidatus Koribacter versatilis]
 gb|ABF41093.1| beta-lactamase-like protein [Candidatus Koribacter versatilis 
Ellin345]
Length=556

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGE GMNCM V Y D  ++IDAG+MFP  + LGV  ++PD +++ +   K+ 
Sbjct  6    LQVIPLGGLGEFGMNCMAVRYGDDIVVIDAGMMFPEAELLGVDIVVPDISYLVENRDKVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIGALPW++  L
Sbjct  66   AILLTHGHEDHIGALPWILSEL  87



>ref|WP_013581330.1| ribonuclease J [Granulicella tundricola]
 gb|ADW70016.1| RNA-metabolising metallo-beta-lactamase [Granulicella tundricola 
MP5ACTX9]
Length=554

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR++P+GGLGE GMNCM + + D  I+IDAG+MFP  + LGV  ++PD +++ +   K++
Sbjct  6    LRLIPLGGLGEFGMNCMALRWQDDIIVIDAGLMFPEEELLGVDIVVPDISYLTENRTKVK  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+I+THGHEDHIG LPW++  L
Sbjct  66   AIILTHGHEDHIGGLPWILSEL  87



>ref|WP_012731758.1| ribonuclease J [Corynebacterium kroppenstedtii]
 gb|ACR17871.1| conserved hypothetical protein [Corynebacterium kroppenstedtii 
DSM 44385]
Length=719

 Score =   101 bits (252),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 55/126 (44%), Positives = 78/126 (62%), Gaps = 7/126 (6%)
 Frame = +1

Query  307  KDIRGAKLPRKRNV---KGEGAGKSME--DAVQRKMEQFYEGSDGPPLRILPIGGLGEIG  471
            K+ R  K  R RN    K     KSM+  D  QR  E      DG  LRI+ +GG+ EIG
Sbjct  113  KNNRPNKRGRDRNRGHNKNRSVVKSMQGADLTQRMPEPPKAPKDG--LRIVALGGISEIG  170

Query  472  MNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIG  651
             N  +  Y++R ++ID GV+FP  DE GV  I+PD +++E    ++EA+++THGHEDHIG
Sbjct  171  RNMTVFEYHNRLLIIDCGVLFPSSDEPGVDLILPDFSYLEDKMDRVEALVVTHGHEDHIG  230

Query  652  ALPWVI  669
            A+PW++
Sbjct  231  AIPWLL  236



>gb|ACF24513.1| myb domain containing transcription regulator [Gymnochlora stellata]
Length=552

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  457  LGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGH  636
            LGEIGMNCML+G  +++I+IDAG+MF  + + G+ KI+PD   +  +  ++E++IITHGH
Sbjct  3    LGEIGMNCMLIGENNKFIIIDAGIMFTEFTKYGIKKIVPDINLLSYFKDRVESLIITHGH  62

Query  637  EDHIGALPWVIP  672
            EDHIGAL W+IP
Sbjct  63   EDHIGALSWIIP  74



>ref|WP_011698454.1| ribonuclease J [Syntrophobacter fumaroxidans]
 gb|ABK17284.1| beta-lactamase domain protein [Syntrophobacter fumaroxidans MPOB]
Length=561

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            M Q  E      L+I+P+GGLGEIG+N M++ Y D  ++IDAG+MFP  D LG+  +IPD
Sbjct  1    MMQKQEDVQPSALKIIPLGGLGEIGLNMMVLEYEDTIVVIDAGLMFPEEDMLGIDIVIPD  60

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVI  669
             T+++K  +++ A+++THGHEDHIGA+P+++
Sbjct  61   FTYLQKNRNRVRALLVTHGHEDHIGAIPFLL  91



>ref|WP_015752366.1| ribonuclease J [Desulfohalobium retbaense]
 gb|ACV69223.1| beta-lactamase domain protein [Desulfohalobium retbaense DSM 
5692]
Length=555

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +1

Query  412  EGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIE  591
            E +D P + + P+GGLG+IG+NCML+   D  +LID G+MFP    LGV  +IP   F+ 
Sbjct  3    EKNDTPWVTLSPLGGLGQIGLNCMLLETADSAVLIDCGLMFPDEVHLGVDVVIPRFDFLL  62

Query  592  KWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            +  HK++AV++THGHEDHIGALPW++  +
Sbjct  63   EKKHKLKAVVLTHGHEDHIGALPWLLKEM  91



>ref|WP_020715164.1| ribonuclease J [Acidobacteriaceae bacterium KBS 89]
Length=554

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGE GMNCM + + D  I+IDAG+MFP  + LGV  ++PD +++ +   K+ 
Sbjct  6    LKLIPLGGLGEFGMNCMAIRWQDDIIVIDAGLMFPEEELLGVDIVVPDISYLTENREKVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIG LPW++  L
Sbjct  66   AILLTHGHEDHIGGLPWILSEL  87



>ref|WP_012934707.1| ribonuclease J [Conexibacter woesei]
 gb|ADB51656.1| beta-lactamase domain protein [Conexibacter woesei DSM 14684]
Length=556

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  424  GPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSH  603
            G  LR+LP+GGLGEIG N  +V Y DR +++D G+ FP  +++G+  ++PD T++     
Sbjct  3    GGTLRVLPLGGLGEIGKNMTVVEYDDRIVVVDTGLRFPTAEQMGIDLVLPDFTYLRDRVE  62

Query  604  KIEAVIITHGHEDHIGALPWVIPAL  678
             IEA++ITHGHEDH+GALPWV+  L
Sbjct  63   DIEAIVITHGHEDHLGALPWVLREL  87



>ref|WP_007908681.1| ribonuclease J [Ktedonobacter racemifer]
 gb|EFH90923.1| RNA-metabolising metallo-beta-lactamase [Ktedonobacter racemifer 
DSM 44963]
Length=553

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            +R++P+GGLGEIG N M++ Y D  +++D GVMFP  +  GV  +IPDT+++    H+I 
Sbjct  6    IRVVPLGGLGEIGKNMMVIEYGDDILIVDVGVMFPDDEMFGVDLVIPDTSYLADKKHRIR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             ++ITHGHEDH+G+LP+V+P L
Sbjct  66   GILITHGHEDHVGSLPYVLPML  87



>ref|WP_031583929.1| ribonuclease J [Selenomonas bovis]
Length=554

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N  ++ Y D  +LIDAG+MFP  D LG+  +IPD T++ +   KI+
Sbjct  8    LQIIPLGGLGEIGKNMTVIRYEDEILLIDAGLMFPEEDMLGIDLVIPDITYLLENRDKIK  67

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIGALP+V+  +
Sbjct  68   AIVLTHGHEDHIGALPYVLKQI  89



>ref|WP_035348753.1| ribonuclease J [Edaphobacter aggregans]
Length=554

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGE GMNCM + + D  ++IDAG+MFP  + LGV  ++PD +++ +   K+ 
Sbjct  6    LKLIPLGGLGEFGMNCMALRWQDDILVIDAGLMFPEEELLGVDIVVPDISYLTENRDKVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIG LPW++  L
Sbjct  66   AIVLTHGHEDHIGGLPWILSEL  87



>ref|WP_025779536.1| ribonuclease J [Dehalococcoidia bacterium DscP2]
Length=552

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +1

Query  424  GPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSH  603
             P L+I+P+GGLGEIG N M++ Y +  I+ID G+MFP  + LG+  +IPD +++ +   
Sbjct  3    NPRLKIIPLGGLGEIGKNMMMMEYENDIIIIDVGLMFPEEEMLGIDLVIPDISYLLEKRE  62

Query  604  KIEAVIITHGHEDHIGALPWVIPAL  678
            KI  ++ITHGHEDHIGALP+++P L
Sbjct  63   KIRGIVITHGHEDHIGALPYLLPQL  87



>ref|WP_026388559.1| ribonuclease J [Acidobacteria bacterium KBS 146]
Length=554

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGE GMNCM + + D  I+IDAG+MFP  + LGV  ++PD +++ +   K+ 
Sbjct  6    LKLIPLGGLGEFGMNCMALRWQDDIIVIDAGLMFPEDELLGVDIVVPDISYLIENRDKVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIG LPW++  L
Sbjct  66   AIVLTHGHEDHIGGLPWILSEL  87



>ref|WP_043487108.1| hypothetical protein [Holophaga foetida]
Length=555

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            +R++PIGGLGE GMNCM+V       L+D G +FP  D+ G+  I+PD  ++E ++ +IE
Sbjct  1    MRLVPIGGLGEFGMNCMVVHTSKSLFLVDCGQLFPSDDQPGIDSIVPDFAYLEPFADRIE  60

Query  613  AVIITHGHEDHIGALPWVI  669
            AV++THGHEDHIGALP+ +
Sbjct  61   AVLLTHGHEDHIGALPYFL  79



>ref|WP_019541676.1| ribonuclease J [Selenomonas bovis]
Length=554

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N  ++ Y D  +LID+G+MFP  D LG+  +IPD T++ +   KI+
Sbjct  8    LQIIPLGGLGEIGKNMTVIRYEDEILLIDSGLMFPEEDMLGIDLVIPDITYLLENRDKIK  67

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIGALP+V+  +
Sbjct  68   AIVLTHGHEDHIGALPYVLKQI  89



>ref|WP_022258063.1| hypothetical protein [Clostridium sp. CAG:508]
 emb|CDC30995.1| putative uncharacterized protein [Clostridium sp. CAG:508]
Length=629

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGL EIG N  +  Y D  IL+D G+ FPG D LGV  +IPD T++ K   K
Sbjct  80   PNLKIIPLGGLQEIGKNITVFEYEDEIILVDCGLEFPGNDMLGVDLVIPDITYLLKNQEK  139

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            ++ ++ITHGHEDHIGA+P+++  +
Sbjct  140  VKGLVITHGHEDHIGAIPYILKQI  163



>ref|WP_034376707.1| ribonuclease J [Dehalococcoides mccartyi]
 gb|AII60541.1| ribonuclease J [Dehalococcoides mccartyi CG5]
Length=551

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGLGEIG N M V Y +  ILID G+MFP  + LG+  +IPD +++ +   K
Sbjct  4    PKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEMLGIDLVIPDISYVLENREK  63

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  ++ITHGHEDHIGALP+++P +
Sbjct  64   VRGIVITHGHEDHIGALPYILPQI  87



>ref|WP_012984193.1| ribonuclease J [Dehalococcoides mccartyi]
 gb|ADC73746.1| RNA-metabolising metallo-beta-lactamase [Dehalococcoides mccartyi 
GT]
Length=551

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGLGEIG N M V Y +  ILID G+MFP  + LG+  +IPD +++ +   K
Sbjct  4    PKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEMLGIDLVIPDISYVLENREK  63

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  ++ITHGHEDHIGALP+++P +
Sbjct  64   VRGIVITHGHEDHIGALPYILPQI  87



>ref|WP_011308960.1| ribonuclease J [Dehalococcoides mccartyi]
 emb|CAI82603.1| metallo-beta-lactamase family protein [Dehalococcoides mccartyi 
CBDB1]
 gb|ABQ17000.1| beta-lactamase domain protein [Dehalococcoides mccartyi BAV1]
 gb|AGG06078.1| beta-lactamase domain-containing protein [Dehalococcoides mccartyi 
DCMB5]
Length=551

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGLGEIG N M V Y +  ILID G+MFP  + LG+  +IPD +++ +   K
Sbjct  4    PKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEMLGIDLVIPDISYVLENREK  63

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  ++ITHGHEDHIGALP+++P +
Sbjct  64   VRGIVITHGHEDHIGALPYILPQI  87



>ref|WP_041341370.1| ribonuclease J [Dehalococcoides mccartyi]
 gb|AII59124.1| ribonuclease J [Dehalococcoides mccartyi CG4]
Length=551

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGLGEIG N M V Y +  ILID G+MFP  + LG+  +IPD +++ +   K
Sbjct  4    PKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEMLGIDLVIPDISYVLENREK  63

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  ++ITHGHEDHIGALP+++P +
Sbjct  64   VRGIVITHGHEDHIGALPYILPQI  87



>ref|WP_015407585.1| beta-lactamase domain-containing protein [Dehalococcoides mccartyi]
 gb|AGG07510.1| beta-lactamase domain-containing protein [Dehalococcoides mccartyi 
BTF08]
Length=551

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGLGEIG N M V Y +  ILID G+MFP  + LG+  +IPD +++ +   K
Sbjct  4    PKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEMLGIDLVIPDISYVLENREK  63

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  ++ITHGHEDHIGALP+++P +
Sbjct  64   VRGIVITHGHEDHIGALPYILPQI  87



>ref|WP_010936215.1| ribonuclease J [Dehalococcoides mccartyi]
 gb|AAW40265.1| metallo-beta-lactamase family protein [Dehalococcoides mccartyi 
195]
 gb|AII57584.1| ribonuclease J [Dehalococcoides mccartyi CG1]
 dbj|BAQ34328.1| hypothetical protein UCH007_03700 [Dehalococcoides sp. UCH007]
Length=551

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGLGEIG N M V Y +  ILID G+MFP  + LG+  +IPD +++ +   K
Sbjct  4    PKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEMLGIDLVIPDISYVLENREK  63

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  ++ITHGHEDHIGALP+++P +
Sbjct  64   VRGIVITHGHEDHIGALPYILPQI  87



>ref|WP_012881709.1| ribonuclease J [Dehalococcoides mccartyi]
 gb|ACZ61536.1| metallo-beta-lactamase [Dehalococcoides mccartyi VS]
Length=551

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGLGEIG N M V Y +  ILID G+MFP  + LG+  +IPD +++ +   K
Sbjct  4    PKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEMLGIDLVIPDISYVLENREK  63

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  ++ITHGHEDHIGALP+++P +
Sbjct  64   VRGIVITHGHEDHIGALPYILPQI  87



>ref|WP_023651985.1| metallo-beta-lactamase [Dehalococcoides mccartyi]
 ref|YP_008855613.1| metallo-beta-lactamase [Dehalococcoides mccartyi GY50]
 gb|AHB13146.1| metallo-beta-lactamase [Dehalococcoides mccartyi GY50]
Length=551

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L+I+P+GGLGEIG N M V Y +  ILID G+MFP  + LG+  +IPD +++ +   K
Sbjct  4    PKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEMLGIDLVIPDISYVLENREK  63

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  ++ITHGHEDHIGALP+++P +
Sbjct  64   VRGIVITHGHEDHIGALPYILPQI  87



>ref|WP_015944632.1| ribonuclease J [Desulfitobacterium hafniense]
 gb|ACL21536.1| beta-lactamase domain protein [Desulfitobacterium hafniense DCB-2]
Length=552

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L I+P+GG GEIG N ++  Y D  I+ID GV FP  + LG+  +IPD T++EK  HKI+
Sbjct  3    LSIIPLGGTGEIGKNLLVFEYGDSIIVIDGGVKFPDDELLGIDLVIPDITYLEKRKHKIQ  62

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG LP+++P L
Sbjct  63   GIFITHGHEDHIGGLPFLLPKL  84



>gb|ACD97120.1| beta-lactamase domain protein [Geobacter lovleyi SZ]
Length=593

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  424  GPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSH  603
              PLRI+ +GGLGEIG+NCM   Y D  IL+DAG+MFP  D  GV  +IPD +++ + + 
Sbjct  45   NSPLRIVALGGLGEIGINCMAYEYGDDLILVDAGLMFPDADMPGVDYVIPDFSWLRERAD  104

Query  604  KIEAVIITHGHEDHIGALPWVI  669
            K+  +++THGHEDHIGALP+++
Sbjct  105  KLRGILLTHGHEDHIGALPFLL  126



>ref|WP_018211211.1| ribonuclease J [Desulfitobacterium hafniense]
Length=552

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L I+P+GG GEIG N ++  Y D  I+ID GV FP  + LG+  +IPD T++EK  HKI+
Sbjct  3    LSIIPLGGTGEIGKNLLVFEYGDSIIVIDGGVKFPDDELLGIDLVIPDITYLEKRKHKIQ  62

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG LP+++P L
Sbjct  63   GIFITHGHEDHIGGLPFLLPKL  84



>ref|WP_040598287.1| ribonuclease J [Patulibacter medicamentivorans]
Length=558

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR+LP+GGLGEIG N  +V Y  + ++IDAGV FP  +++G+  ++PD ++++  +  IE
Sbjct  7    LRVLPLGGLGEIGKNMTVVEYDGKIVVIDAGVRFPTAEQVGIDLVLPDFSYLKDRAQDIE  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A++ITHGHEDH+GALP+VI  L
Sbjct  67   AIVITHGHEDHLGALPYVIKQL  88



>ref|WP_026441799.1| ribonuclease J [Acidobacterium sp. PMMR2]
Length=553

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGE GMNC+ + Y +  I++DAG+MFP  + LGV  ++PD T++ +    + 
Sbjct  6    LQIIPLGGLGEFGMNCLAIRYQNDIIVMDAGLMFPESELLGVDIVVPDITYLVENRELVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+I+THGHEDHIG LPW++  L
Sbjct  66   AIILTHGHEDHIGGLPWILSEL  87



>gb|EFB89527.1| hypothetical protein HMPREF7215_0020 [Pyramidobacter piscolens 
W5455]
Length=604

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+ +P+GGLGEIG N   + Y +  ++IDAG+MFP  + LG+  +IPD +++E+   KI 
Sbjct  60   LKFIPLGGLGEIGKNMYAIEYENDIVVIDAGLMFPDEEMLGIDFVIPDISYLEENRKKIR  119

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             ++ITHGHEDHIGALP+V+P L
Sbjct  120  GILITHGHEDHIGALPFVLPKL  141



>ref|WP_040397176.1| ribonuclease J [Anaerococcus senegalensis]
Length=558

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGEIG NC +V Y +  I+ID G+ FP  D LGV  +IPD T+IE+   K++
Sbjct  7    LKVIPLGGLGEIGKNCTVVEYKNEMIMIDCGLTFPDQDMLGVDIVIPDFTYIEENKDKLK  66

Query  613  AVIITHGHEDHIGALPWVI  669
             + ITHGHEDHIGA+ +++
Sbjct  67   GIFITHGHEDHIGAIAYLL  85



>ref|WP_040551170.1| ribonuclease J [Pyramidobacter piscolens]
Length=566

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+ +P+GGLGEIG N   + Y +  ++IDAG+MFP  + LG+  +IPD +++E+   KI 
Sbjct  22   LKFIPLGGLGEIGKNMYAIEYENDIVVIDAGLMFPDEEMLGIDFVIPDISYLEENRKKIR  81

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             ++ITHGHEDHIGALP+V+P L
Sbjct  82   GILITHGHEDHIGALPFVLPKL  103



>ref|WP_026446432.1| ribonuclease J [Acidobacteriaceae bacterium URHE0068]
Length=551

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGE GMNC+ + + D  I+IDAG+MFP  + LGV  ++PD T++ +    + 
Sbjct  6    LKIIPLGGLGEFGMNCLALQWEDDIIVIDAGLMFPETELLGVDIVVPDITYLVENRQLVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIG LPW++  +
Sbjct  66   AIVLTHGHEDHIGGLPWILSEI  87



>ref|WP_019117677.1| ribonuclease J [Anaerococcus obesiensis]
Length=558

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGEIG NC +V Y +  I+ID G+ FP  D LGV  +IPD T++E+   K++
Sbjct  7    LKVIPLGGLGEIGKNCTIVEYKNEMIMIDCGLTFPDEDMLGVDIVIPDFTYVEENKDKLK  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIGA+ +++  +
Sbjct  67   GIFITHGHEDHIGAIAYLLKTV  88



>ref|WP_022842172.1| ribonuclease J [Acidobacteriaceae bacterium TAA166]
Length=554

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGE GMNCM + + D  ++IDAG+MFP  + LGV  ++PD +++ +   K+ 
Sbjct  6    LKLIPLGGLGEFGMNCMALRWQDDILVIDAGLMFPEEELLGVDIVVPDISYLTENRDKVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +++THGHEDHIG LPW++  L
Sbjct  66   GIVLTHGHEDHIGGLPWILSEL  87



>ref|WP_044603071.1| ribonuclease J [Candidatus Magnetoglobus multicellularis]
Length=553

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            D  PL+I+P+GGLGE+G+N M++ Y    I+IDAG+MFP    LG+  +IPD ++ +  +
Sbjct  2    DNLPLKIIPLGGLGEVGLNMMVIEYNKTLIIIDAGLMFPEEYMLGIDIVIPDFSYAKDRA  61

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
              + A+I+THGHEDHIGALP+V+  +
Sbjct  62   ENVAAIILTHGHEDHIGALPYVLKQI  87



>ref|WP_021914771.1| hypothetical protein [Firmicutes bacterium CAG:24]
 emb|CCY21088.1| putative uncharacterized protein [Firmicutes bacterium CAG:24]
Length=559

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            DGP L+I+P+GGL +IGMN     Y D  +++D G+ FP  D LG+  +IPD T++++ +
Sbjct  10   DGPSLKIIPLGGLEQIGMNITAFEYEDSIVVVDCGLSFPDDDMLGIDLVIPDVTYLKENA  69

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
             +++  +ITHGHEDHIGALP+V+  L
Sbjct  70   DRVKGFVITHGHEDHIGALPYVLREL  95



>ref|WP_004813380.1| ribonuclease J [Anaerococcus hydrogenalis]
 gb|EEB36425.1| hypothetical protein ANHYDRO_00725 [Anaerococcus hydrogenalis 
DSM 7454]
Length=558

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGEIG NC +V Y +  I+ID G+ FP  D LGV  +IPD T+IE+   K++
Sbjct  7    LKVIPLGGLGEIGKNCTVVEYKNEMIMIDCGLTFPDEDMLGVDIVIPDFTYIEENKDKLK  66

Query  613  AVIITHGHEDHIGALPWVI  669
             + ITHGHEDHIGA+ +++
Sbjct  67   GIFITHGHEDHIGAIAYLL  85



>ref|WP_004816729.1| ribonuclease J [Anaerococcus hydrogenalis]
 gb|EGC84524.1| hypothetical protein HMPREF9246_0645 [Anaerococcus hydrogenalis 
ACS-025-V-Sch4]
Length=558

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGEIG NC +V Y +  I+ID G+ FP  D LGV  +IPD T+IE+   K++
Sbjct  7    LKVIPLGGLGEIGKNCTVVEYKNEMIMIDCGLTFPDEDMLGVDIVIPDFTYIEENKDKLK  66

Query  613  AVIITHGHEDHIGALPWVI  669
             + ITHGHEDHIGA+ +++
Sbjct  67   GIFITHGHEDHIGAIAYLL  85



>gb|ETR72921.1| ribonuclease J [Candidatus Magnetoglobus multicellularis str. 
Araruama]
Length=566

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            D  PL+I+P+GGLGE+G+N M++ Y    I+IDAG+MFP    LG+  +IPD ++ +  +
Sbjct  15   DNLPLKIIPLGGLGEVGLNMMVIEYNKTLIIIDAGLMFPEEYMLGIDIVIPDFSYAKDRA  74

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
              + A+I+THGHEDHIGALP+V+  +
Sbjct  75   ENVAAIILTHGHEDHIGALPYVLKQI  100



>ref|WP_020708767.1| ribonuclease J [Acidobacteriaceae bacterium KBS 83]
Length=553

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+PIGGLGE GMNCM + + +   +IDAG+MFP  D LGV  ++PD T++ +   +I 
Sbjct  6    LQIIPIGGLGEFGMNCMAIRWDEDIFVIDAGLMFPESDLLGVDIVVPDITYLIENRSRIR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +++THGHEDHIG LPW++  L
Sbjct  66   GIVLTHGHEDHIGGLPWLLREL  87



>ref|WP_033206893.1| ribonuclease J [Patulibacter americanus]
Length=561

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR+LP+GGLGEIG N  +V Y  + ++ID GV FP  +++G+  ++PD ++++  +  IE
Sbjct  11   LRVLPLGGLGEIGKNMTVVEYNGKIVVIDVGVRFPTAEQVGIDLVLPDFSYLKDRAQDIE  70

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A++ITHGHEDHIGALP+V+  L
Sbjct  71   AIVITHGHEDHIGALPFVLKQL  92



>ref|WP_029468815.1| ribonuclease J [Clostridiales bacterium VE202-06]
Length=557

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            ++I+P+GGL +IGMN   V Y D  I+ID G+ FP  D LG+ K+IPD T++ +   K++
Sbjct  12   VKIIPLGGLDKIGMNITAVEYNDTIIVIDCGISFPDDDMLGIDKVIPDVTYLIENKEKVK  71

Query  613  AVIITHGHEDHIGALPWVIPAL  678
              +ITHGHEDHIGALP+++P +
Sbjct  72   GFVITHGHEDHIGALPYILPQI  93



>ref|WP_018598031.1| hypothetical protein [Blautia producta]
Length=557

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            ++I+P+GGL +IGMN   V Y D  I+ID G+ FP  D LG+ K+IPD T++ +   K++
Sbjct  12   VKIIPLGGLDKIGMNITAVEYNDTIIVIDCGISFPDDDMLGIDKVIPDVTYLIENKEKVK  71

Query  613  AVIITHGHEDHIGALPWVIPAL  678
              +ITHGHEDHIGALP+++P +
Sbjct  72   GFVITHGHEDHIGALPYILPQI  93



>ref|WP_028058567.1| ribonuclease J [Solirubrobacter sp. URHD0082]
Length=555

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR+LP+GG+GEIG N  +V Y DR +++D G+ FP  + +G+  ++PD T++ +    IE
Sbjct  5    LRVLPLGGVGEIGKNLTVVEYEDRIVVVDCGLRFPTAEMMGIDLVLPDFTYLRERVADIE  64

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A++ITHGHEDH+GALPWV+  L
Sbjct  65   AIVITHGHEDHLGALPWVLRDL  86



>ref|WP_037977897.1| ribonuclease J [Synergistes jonesii]
 gb|KEJ91491.1| ribonuclease J [Synergistes jonesii]
Length=569

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L + P+GG+GEIG N  + GY + YI+ID G+ FP  D LG+  +IPD TF+ +   KI 
Sbjct  21   LFVCPLGGMGEIGKNLTVFGYGEDYIVIDCGLKFPEEDMLGIDFVIPDATFLVENKSKIR  80

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIGALP+++P L
Sbjct  81   GIFITHGHEDHIGALPFILPRL  102



>ref|WP_008539861.1| MULTISPECIES: ribonuclease J [Megamonas]
 gb|EHR33391.1| hypothetical protein HMPREF9454_02232 [Megamonas funiformis YIT 
11815]
 emb|CDB94290.1| putative uncharacterized protein [Megamonas funiformis CAG:377]
Length=555

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +1

Query  415  GSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEK  594
              +   L+I+P+GGLGEIG N  +V Y D  I+IDAG+MFP  + LG+  +IPD T++ +
Sbjct  2    AKEAQKLQIIPLGGLGEIGKNMTVVRYGDDIIVIDAGLMFPEEEMLGIDLVIPDITYLLE  61

Query  595  WSHKIEAVIITHGHEDHIGALPWVI  669
               KI+A+++THGHEDHIGALP+V+
Sbjct  62   NKDKIKAIVLTHGHEDHIGALPYVL  86



>ref|WP_040929284.1| ribonuclease J [Nosocomiicoccus sp. NP2]
Length=561

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            + +  +GGLGEIG N   V Y D  I+IDAG+ FP  DELGV  +IPD T++++  HKI+
Sbjct  7    VNVFALGGLGEIGKNTYCVEYKDEIIIIDAGIKFPSDDELGVDYVIPDYTYLKENEHKIK  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIG +P+++  +
Sbjct  67   ALVVTHGHEDHIGGIPFLLKEI  88



>ref|WP_014786772.1| ribonuclease J [Terriglobus roseus]
 gb|AFL89511.1| putative hydrolase of the metallo-beta-lactamase superfamily 
[Terriglobus roseus DSM 18391]
Length=553

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGE GMNCM + + D  ++IDAG+MFP  D LGV  ++PD T++ +   K+ 
Sbjct  6    LKIIPLGGLGEFGMNCMAIQWKDDIVVIDAGLMFPEDDLLGVDIVVPDITYLLENREKVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +++THGHEDHIG LP ++  L
Sbjct  66   GILLTHGHEDHIGGLPRILSQL  87



>gb|EFC90240.1| beta-lactamase domain protein [Dethiosulfovibrio peptidovorans 
DSM 11002]
Length=601

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR +P+GG+GEIG N  L+ + +  I+ID G+MFP  + LG+  +IPDTT++E    +++
Sbjct  52   LRFIPLGGIGEIGKNMYLLEFGEDMIVIDCGLMFPEEEMLGIDFVIPDTTYLEANKDRVK  111

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +++THGHEDH+GALP+V+P L
Sbjct  112  GILLTHGHEDHVGALPFVLPGL  133



>ref|WP_036375186.1| ribonuclease J [Mitsuokella jalaludinii]
Length=559

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +1

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            ME ++       L+I+P+GGLGEIG N  ++   D  ++ID+G+MFP  D LG+  +IPD
Sbjct  1    MEVYFLAKGAQKLQIIPLGGLGEIGKNMTVIRVDDEILVIDSGLMFPDEDMLGIDLVIPD  60

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
             +++ +   KI+A+++THGHEDHIGALP+V+  +
Sbjct  61   ISYLIENKDKIKAIVLTHGHEDHIGALPYVLKKI  94



>ref|WP_004827489.1| ribonuclease J [Anaerococcus lactolyticus]
 gb|EEI87148.1| hypothetical protein HMPREF0072_0381 [Anaerococcus lactolyticus 
ATCC 51172]
 gb|KGF03157.1| ribonuclease J [Anaerococcus lactolyticus S7-1-13]
Length=558

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  418  SDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKW  597
            ++   LRI+PIGGL E+G NC LV Y +  I+ID G+ FP  + LGV  +IPD T++E+ 
Sbjct  2    TNEKKLRIIPIGGLHEVGKNCALVEYGNDMIMIDCGLTFPNEEMLGVDIVIPDFTYVEEN  61

Query  598  SHKIEAVIITHGHEDHIGALPWVI  669
              K++ + +THGHEDH+GA+P+ +
Sbjct  62   KQKLKGIFVTHGHEDHVGAIPYFL  85



>ref|WP_022490201.1| predicted hydrolase of the metallo-beta-lactamase superfamily 
[Clostridium sp. CAG:567]
 emb|CDE96507.1| predicted hydrolase of the metallo-beta-lactamase superfamily 
[Clostridium sp. CAG:567]
Length=623

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGL EIG N  +  Y D  IL+D G+ FPG D LGV  +IPD T++ K   KI+
Sbjct  76   LKIIPLGGLQEIGKNITVFEYEDEIILVDCGLEFPGDDMLGVDLVIPDVTYLVKNKEKIK  135

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             ++ITHGHEDHIGA+P+++  +
Sbjct  136  GLVITHGHEDHIGAIPYILKQI  157



>ref|WP_019115798.1| ribonuclease J [Anaerococcus sp. PH9]
Length=558

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GG+GEIG NC +V Y +  I+ID G+ FP  D LGV  +IPD T++E+   K++
Sbjct  7    LKVIPLGGIGEIGKNCTVVEYKNEMIMIDCGLTFPDADMLGVDIVIPDFTYVEENKDKLK  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIGA+ +++  +
Sbjct  67   GIFITHGHEDHIGAIAYLLKTI  88



>ref|WP_040382769.1| ribonuclease J [Dethiosulfovibrio peptidovorans]
Length=574

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR +P+GG+GEIG N  L+ + +  I+ID G+MFP  + LG+  +IPDTT++E    +++
Sbjct  25   LRFIPLGGIGEIGKNMYLLEFGEDMIVIDCGLMFPEEEMLGIDFVIPDTTYLEANKDRVK  84

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +++THGHEDH+GALP+V+P L
Sbjct  85   GILLTHGHEDHVGALPFVLPGL  106



>ref|WP_027369512.1| ribonuclease J [Desulfovermiculus halophilus]
Length=551

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L + PIGGLGEIGMNC+L+      +LID G+MFP     GV  +IP   FI +   K+ 
Sbjct  7    LTLYPIGGLGEIGMNCLLLETAQSAVLIDCGLMFPDDFHYGVDVVIPRLDFILEKKDKLR  66

Query  613  AVIITHGHEDHIGALPWVIP  672
            A+I+THGHEDHIGALPW++P
Sbjct  67   AIILTHGHEDHIGALPWILP  86



>ref|WP_015896602.1| ribonuclease J [Acidobacterium capsulatum]
 gb|ACO32187.1| metallo-beta-lactamase family protein [Acidobacterium capsulatum 
ATCC 51196]
Length=553

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGE GMNCM + + D  ++IDAG+MFP  + LGV  ++PD T++ +    + 
Sbjct  6    LQIIPLGGLGEFGMNCMALRWQDDIVVIDAGLMFPESELLGVDIVVPDITYLIENKEHVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +++THGHEDHIG LPW++  L
Sbjct  66   GILLTHGHEDHIGGLPWILSEL  87



>ref|WP_022463472.1| beta-lactamase domain protein [Clostridium sp. CAG:277]
 emb|CDE68505.1| beta-lactamase domain protein [Clostridium sp. CAG:277]
Length=643

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +1

Query  361  AGKSMEDAVQRKMEQFYEGSD----GPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGV  528
            A K++ + V+R  E+  + S     G  L+I+P+GGL +IGMN     Y D  +++D G+
Sbjct  69   ADKAVAEKVRRMTEKSNQKSKSSLIGHGLKIIPLGGLEQIGMNITAFEYEDNIVVVDCGL  128

Query  529  MFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVI  669
             FPG D LG+  +IPD T++++   K+   +ITHGHEDHIGALP+V+
Sbjct  129  SFPGDDMLGIDLVIPDITYLKENIDKVRGFVITHGHEDHIGALPYVL  175



>ref|WP_015391753.1| ribonuclease J 1 [Clostridium saccharoperbutylacetonicum]
 gb|AGF55432.1| ribonuclease J 1 [Clostridium saccharoperbutylacetonicum N1-4(HMT)]
Length=569

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  430  PLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKI  609
            PL+I+P+GGLGEIG N     Y D  I+ID G+ FP  D  G+  +IPD TF+ K   K+
Sbjct  21   PLKIIPLGGLGEIGKNMTAFEYNDEIIVIDCGLAFPDEDLYGIDSVIPDVTFLIKNKEKV  80

Query  610  EAVIITHGHEDHIGALPWVIPAL  678
            + + ITHGHEDHIGALP+++  +
Sbjct  81   KGIFITHGHEDHIGALPYILKQI  103



>ref|WP_019879255.1| ribonuclease J [Succinispira mobilis]
Length=554

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N  ++ Y D  IL+DAG+MFP  D LGV  +IPD +++ +    I 
Sbjct  8    LQIIPLGGLGEIGKNMTVIRYEDDIILVDAGLMFPDDDMLGVDLVIPDMSYLFENRDNIR  67

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            AV +THGHEDHIGALP+++  L
Sbjct  68   AVFLTHGHEDHIGALPYLLKNL  89



>ref|WP_013175208.1| ribonuclease J [Syntrophothermus lipocalidus]
 gb|ADI01806.1| RNA-metabolising metallo-beta-lactamase [Syntrophothermus lipocalidus 
DSM 12680]
Length=554

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  439  ILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAV  618
            ++P+GGLGEIG N MLV Y D  ++IDAG+MFP  + LG+  +IPD T++ +   K++AV
Sbjct  10   VIPLGGLGEIGKNMMLVRYQDNIVVIDAGLMFPEEELLGIDIVIPDMTYLFENRDKVKAV  69

Query  619  IITHGHEDHIGALPWVI  669
            ++THGHEDH+GALP+++
Sbjct  70   LVTHGHEDHVGALPYLL  86



>ref|WP_029215441.1| ribonuclease J [bacterium JKG1]
Length=561

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LRI+P+GG GE+G NC ++ Y D  I++D GVMFP  + LGV  I+PD T++++    I 
Sbjct  6    LRIMPLGGAGEVGRNCWVLEYGDDIIVLDMGVMFPESEMLGVDLIVPDPTYLQERKATIH  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             V+++HGHEDHIGALP+++P L
Sbjct  66   GVLVSHGHEDHIGALPYLLPLL  87



>ref|WP_040349207.1| ribonuclease J [Anaerococcus tetradius]
Length=560

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            +   LRI+P+GGL E+G NC LV Y +  I+ID G+ FP  + LGV  +IPD T++E+  
Sbjct  3    NDKKLRIIPLGGLQEVGKNCTLVEYGNDMIMIDCGLTFPDAEMLGVDIVIPDFTYVEENK  62

Query  601  HKIEAVIITHGHEDHIGALPWVI  669
            +K+  + +THGHEDHIGA+P+ +
Sbjct  63   NKLRGIFVTHGHEDHIGAIPYFL  85



>ref|WP_041970296.1| ribonuclease J [Geobacter sp. OR-1]
 dbj|GAM08676.1| ribonuclease J 1 [Geobacter sp. OR-1]
Length=558

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            D   L+I+P+GGLGEIG+N  L  Y D  I++D G+MFP    LG+  ++PD T++    
Sbjct  7    DNSGLKIIPLGGLGEIGLNMALFEYGDEIIVVDCGLMFPDASMLGIDLVVPDITYLRDRV  66

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
             +I  + +THGHEDHIGALP+V+P +
Sbjct  67   ERIRGIFLTHGHEDHIGALPYVLPEI  92



>gb|EEI83558.1| hypothetical protein HMPREF0077_0287 [Anaerococcus tetradius 
ATCC 35098]
Length=568

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            +   LRI+P+GGL E+G NC LV Y +  I+ID G+ FP  + LGV  +IPD T++E+  
Sbjct  11   NDKKLRIIPLGGLQEVGKNCTLVEYGNDMIMIDCGLTFPDAEMLGVDIVIPDFTYVEENK  70

Query  601  HKIEAVIITHGHEDHIGALPWVI  669
            +K+  + +THGHEDHIGA+P+ +
Sbjct  71   NKLRGIFVTHGHEDHIGAIPYFL  93



>ref|WP_019902763.1| hypothetical protein [Chloroflexi bacterium SCGC AB-629-P13]
Length=551

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  430  PLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKI  609
            PL+I+P+GGLGEIG N M + Y +  ++IDAGVMFP  D  GV  +IPD T+++    K+
Sbjct  4    PLKIIPLGGLGEIGKNMMALEYGEDIVVIDAGVMFPDDDLPGVDLVIPDITYLKDNVDKV  63

Query  610  EAVIITHGHEDHIGALPWVI  669
             A++ITHGHEDH GALP+++
Sbjct  64   RAILITHGHEDHTGALPYIL  83



>ref|WP_020717484.1| hypothetical protein [Acidobacteriaceae bacterium KBS 96]
Length=555

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGE GMN M + Y D  I+IDAG+MFP  + LGV  + PD +F+EK + K+ 
Sbjct  6    LQVIPLGGLGEFGMNSMALQYGDDIIVIDAGMMFPDAELLGVDIVTPDFSFLEKNAEKVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +++THGHEDHIG +P+++  L
Sbjct  66   GLVLTHGHEDHIGGVPFLLGTL  87



>ref|WP_013048847.1| metallo-beta-lactamase [Aminobacterium colombiense]
 gb|ADE57584.1| beta-lactamase domain protein [Aminobacterium colombiense DSM 
12261]
Length=575

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L++  +GGLGEIG N  +  Y D  +++DAG+MFP  + LG+  +IPD +++E+   KI+
Sbjct  20   LKVFALGGLGEIGKNMYVFQYGDDILVVDAGLMFPDEEMLGIDFVIPDISYLEENREKIK  79

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +IITHGHEDHIGALP+V+P L
Sbjct  80   GIIITHGHEDHIGALPFVLPRL  101



>ref|WP_015777872.1| ribonuclease J [Anaerococcus prevotii]
 gb|ACV28969.1| beta-lactamase domain protein [Anaerococcus prevotii DSM 20548]
Length=560

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LRI+P+GGL E+G NC LV Y +  I+ID G+ FP  + LGV  +IPD T++E+  +K+ 
Sbjct  7    LRIIPLGGLQEVGKNCTLVEYGNDMIMIDCGLTFPDAEMLGVDIVIPDFTYVEENKNKLR  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + +THGHEDHIGA+P+ +  +
Sbjct  67   GIFVTHGHEDHIGAIPYFLKNI  88



>ref|WP_029165798.1| ribonuclease J [Aminiphilus circumscriptus]
Length=570

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = +1

Query  373  MEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDEL  552
            M +A  R+     + + G  LR   +GGLGEIG N  ++ Y +  ++IDAG+ FP  + L
Sbjct  1    MGNARTRRRRPRRKSAAGEELRYFALGGLGEIGKNMHVLEYGEDLLVIDAGLKFPDEEML  60

Query  553  GVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            G+  +IPD T++E   H+I  +I+THGHEDHIGALP+V+P L
Sbjct  61   GIDFVIPDITYLENNKHRIRGLILTHGHEDHIGALPFVLPKL  102



>ref|WP_026911959.1| ribonuclease J [Patulibacter minatonensis]
Length=561

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LRILP+GGLGEIG N  +V Y  + ++ID GV FP  +++G+  ++PD ++++  +  IE
Sbjct  11   LRILPLGGLGEIGKNMTVVEYDGKIVVIDVGVRFPTAEQVGIDLVLPDFSYLKDRAADIE  70

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A++ITHGHEDHIGALP+V+  L
Sbjct  71   AIVITHGHEDHIGALPFVLKQL  92



>ref|WP_040590439.1| ribonuclease [Scardovia inopinata]
 gb|EFG26764.2| hypothetical protein HMPREF9020_00391 [Scardovia inopinata F0304]
Length=609

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 80/136 (59%), Gaps = 12/136 (9%)
 Frame = +1

Query  286  SVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQ--------FYEGSDGPPLRI  441
            + R  S K    A   RK N +  G  K+   A Q   ++        +++GS    +RI
Sbjct  4    TARRTSKKSSTSAGRSRKGNGRSHGGRKTAPAAAQTVAQEGKLVAPPKYHKGS----MRI  59

Query  442  LPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVI  621
            +P+GGLGEIG N  ++ Y    +LID GV+FP  ++ GV  I+PD ++I     K+EA++
Sbjct  60   VPLGGLGEIGRNMNVIEYNGHILLIDCGVLFPEEEQPGVDLILPDFSYIRSRLDKVEALV  119

Query  622  ITHGHEDHIGALPWVI  669
            +THGHEDHIGA+P+++
Sbjct  120  LTHGHEDHIGAVPYLL  135



>ref|WP_015739648.1| ribonuclease J [Ammonifex degensii]
 gb|ACX52771.1| beta-lactamase domain protein [Ammonifex degensii KC4]
Length=553

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG NCM V   +  ++ID G+MFP  + LG+  +IPD +++ +    + 
Sbjct  6    LQIIPLGGLGEIGKNCMAVRCGNDIVVIDCGLMFPEEELLGIDVVIPDVSYLVENRQMVR  65

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIGALP+V+P L
Sbjct  66   AIVLTHGHEDHIGALPYVLPQL  87



>ref|WP_026867476.1| ribonuclease J [Jeotgalicoccus marinus]
Length=559

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  439  ILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAV  618
            +  +GGLGEIG N   + Y D  I+IDAGV FP  DELGV  +IPD T++++  HKI A+
Sbjct  10   VFSLGGLGEIGKNTYCIEYKDEIIIIDAGVKFPTDDELGVDYVIPDYTYLKENEHKISAL  69

Query  619  IITHGHEDHIGALPWVI  669
            I+THGHEDHIG +P+++
Sbjct  70   IVTHGHEDHIGGIPFLL  86



>gb|EKD57039.1| hypothetical protein ACD_58C00017G0005 [uncultured bacterium]
Length=595

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = +1

Query  277  ISCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGG  456
            ++   RT   +D R      +++    G   S + +  R+  Q +       L+I+P+GG
Sbjct  1    MNTKQRTDHNRDYRS---DNRKDSNNNGQNHSSQQS-SRQAGQDFNLPKTKTLKIIPLGG  56

Query  457  LGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGH  636
             GEIG N M+  Y D  I++D G+MFP  + LG+  +IPD  ++E   H+I  ++ THGH
Sbjct  57   QGEIGKNMMVYEYGDDIIVVDMGIMFPEEEMLGIDFVIPDHRYLEANKHRIRGILFTHGH  116

Query  637  EDHIGALPWVIPAL  678
            EDHIGA+P++ P L
Sbjct  117  EDHIGAVPYIWPKL  130



>ref|WP_022118860.1| metallo-beta-lactamase family protein [Firmicutes bacterium CAG:56]
 emb|CDA63591.1| metallo-beta-lactamase family protein [Firmicutes bacterium CAG:56]
Length=554

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            +   LRI+P+GGL +IGMN     + D  +++D G+ FP  D LG+  +IPD T+++  +
Sbjct  5    NNSKLRIIPLGGLEQIGMNITAFEFEDSIVVVDCGLSFPEDDMLGIDLVIPDITYLKNNA  64

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
            HK++  +ITHGHEDHIGALP+V+  L
Sbjct  65   HKVKGFVITHGHEDHIGALPYVLKEL  90



>ref|WP_011460280.1| ribonuclease J [Desulfitobacterium hafniense]
 dbj|BAE84165.1| hypothetical protein [Desulfitobacterium hafniense Y51]
Length=552

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L I+P+GG GEIG N ++  Y D  I+ID GV FP  + LG+  +IPD  ++EK  HKI+
Sbjct  3    LSIIPLGGTGEIGKNLLVFEYGDSIIVIDGGVKFPDDELLGIDLVIPDIIYLEKRKHKIQ  62

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG LP+++P L
Sbjct  63   GIFITHGHEDHIGGLPFLLPKL  84



>ref|WP_035213816.1| ribonuclease J [Desulfitobacterium hafniense]
Length=552

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L I+P+GG GEIG N ++  Y D  I+ID GV FP  + LG+  +IPD  ++EK  HKI+
Sbjct  3    LSIIPLGGTGEIGKNLLVFEYGDSIIVIDGGVKFPDDELLGIDLVIPDIIYLEKRKHKIQ  62

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG LP+++P L
Sbjct  63   GIFITHGHEDHIGGLPFLLPKL  84



>ref|WP_018306754.1| ribonuclease J [Desulfitobacterium hafniense]
 emb|CDX02455.1| Ribonuclease J 1 [Desulfitobacterium hafniense]
Length=552

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L I+P+GG GEIG N ++  Y D  I+ID GV FP  + LG+  +IPD  ++EK  HKI+
Sbjct  3    LSIIPLGGTGEIGKNLLVFEYGDSIIVIDGGVKFPDDELLGIDLVIPDIIYLEKRKHKIQ  62

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG LP+++P L
Sbjct  63   GIFITHGHEDHIGGLPFLLPKL  84



>ref|WP_027396918.1| ribonuclease J [Anaerovibrio lipolyticus]
Length=553

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N  +V Y +  +LIDAG+MFP  + LG+  +IPD TF+ +    ++
Sbjct  7    LQIIPLGGLGEIGKNMTVVRYGEEILLIDAGLMFPDEEMLGIDLVIPDFTFLVENREHVK  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIGALP+V+  +
Sbjct  67   AIVLTHGHEDHIGALPYVLKQI  88



>ref|WP_021718511.1| ribonuclease J 1 [Phascolarctobacterium sp. CAG:207]
 emb|CDB46555.1| ribonuclease J 1 [Phascolarctobacterium sp. CAG:207]
Length=554

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L I+P+GGLGEIG N  +  Y D  IL+DAG+MFP  D LG+  +IPD T++ +   K++
Sbjct  8    LNIIPLGGLGEIGKNMTVFRYGDDIILVDAGLMFPEDDMLGIDLVIPDITYLVENKDKVK  67

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+ +THGHEDHIGALP+V+  +
Sbjct  68   AIFLTHGHEDHIGALPYVMKQI  89



>ref|WP_039209195.1| ribonuclease J [Anaerovibrio lipolyticus]
 gb|KHM51792.1| ribonuclease J [Anaerovibrio lipolyticus]
Length=553

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N  +V Y +  +LIDAG+MFP  + LG+  +IPD TF+ +    ++
Sbjct  7    LQIIPLGGLGEIGKNMTVVRYGEEILLIDAGLMFPDEEMLGIDLVIPDFTFLVENREHVK  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIGALP+V+  +
Sbjct  67   AIVLTHGHEDHIGALPYVLKEI  88



>ref|WP_027405512.1| ribonuclease J [Anaerovibrio sp. RM50]
Length=553

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N  +V Y +  +LIDAG+MFP  + LG+  +IPD TF+ +    ++
Sbjct  7    LQIIPLGGLGEIGKNMTVVRYGEEILLIDAGLMFPDEEMLGIDLVIPDFTFLVENREHVK  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIGALP+V+  +
Sbjct  67   AIVLTHGHEDHIGALPYVLKEI  88



>gb|EHL07559.1| hypothetical protein HMPREF0322_01676 [Desulfitobacterium hafniense 
DP7]
Length=572

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L I+P+GG GEIG N ++  Y D  I+ID GV FP  + LG+  +IPD  ++EK  HKI+
Sbjct  23   LSIIPLGGTGEIGKNLLVFEYGDSIIVIDGGVKFPDDELLGIDLVIPDIIYLEKRKHKIQ  82

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG LP+++P L
Sbjct  83   GIFITHGHEDHIGGLPFLLPKL  104



>ref|WP_022152842.1| hypothetical protein [Firmicutes bacterium CAG:65]
 emb|CDA98767.1| putative uncharacterized protein [Firmicutes bacterium CAG:65]
Length=558

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +1

Query  397  MEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPD  576
            M++  E S+   L+I+P+GGL +IGMN     Y D  I++D G+ FP  D LG+  +IPD
Sbjct  1    MKKKKENSNASGLKIIPLGGLEQIGMNITAFQYEDSIIVVDCGLSFPADDMLGIDLVIPD  60

Query  577  TTFIEKWSHKIEAVIITHGHEDHIGALPWVI  669
             T+++    K++  +ITHGHEDHIGALP+V+
Sbjct  61   VTYLKDNIDKVKGFVITHGHEDHIGALPYVL  91



>ref|WP_027363779.1| ribonuclease J [Desulfotomaculum alcoholivorax]
Length=554

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +1

Query  427  PPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHK  606
            P L I+P+GGLGEIG N M+V Y +  ++ID+G+MFP  D LG+  +IPD T++ +  + 
Sbjct  5    PKLYIVPLGGLGEIGKNMMVVRYGENILVIDSGLMFPEEDLLGIDMVIPDITYLLENKNI  64

Query  607  IEAVIITHGHEDHIGALPWVIPAL  678
            +  +++THGHEDHIGALP+V+  L
Sbjct  65   VRGIVLTHGHEDHIGALPYVLREL  88



>gb|EEU12802.1| hypothetical protein HMPREF0078_0773 [Anaerococcus vaginalis 
ATCC 51170]
Length=556

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGEIG NC +V Y +  I+ID G+ FP  D LGV  +IPD T++E+   K++
Sbjct  5    LKVIPLGGLGEIGKNCTIVEYKNEMIMIDCGLTFPDEDMLGVDIVIPDFTYVEENKDKLK  64

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG + +++  +
Sbjct  65   GIFITHGHEDHIGGIAYLLKTV  86



>ref|WP_039920503.1| ribonuclease J [Anaerococcus vaginalis]
Length=558

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGLGEIG NC +V Y +  I+ID G+ FP  D LGV  +IPD T++E+   K++
Sbjct  7    LKVIPLGGLGEIGKNCTIVEYKNEMIMIDCGLTFPDEDMLGVDIVIPDFTYVEENKDKLK  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG + +++  +
Sbjct  67   GIFITHGHEDHIGGIAYLLKTV  88



>ref|WP_022434989.1| ribonuclease J 1 [Firmicutes bacterium CAG:321]
 emb|CDE38929.1| ribonuclease J 1 [Firmicutes bacterium CAG:321]
Length=580

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +1

Query  436  RILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEA  615
            +I+P+GGLGE+G N   V + D  I++D+GVMFP  D LG+  +IPD TF+++   KI+A
Sbjct  4    KIIPLGGLGEVGKNMYTVMHGDEIIIVDSGVMFPDDDLLGIDYVIPDYTFLKENESKIKA  63

Query  616  VIITHGHEDHIGALPWVIPAL  678
            +IITHGHEDHIG++P+++ ++
Sbjct  64   LIITHGHEDHIGSIPFLLQSV  84



>ref|WP_018023832.1| ribonuclease J [Corynebacterium ulceribovis]
Length=703

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIE-KWSHKI  609
            LRI+ +GG+ EIG N  +  Y++R +++D GV+FP  DE GV  I+PD +++E KW  ++
Sbjct  140  LRIVALGGISEIGRNMTVFEYHNRLLIVDCGVLFPSSDEPGVDLILPDFSYLEGKWD-RV  198

Query  610  EAVIITHGHEDHIGALPWVI  669
            EA IITHGHEDHIGA+PW++
Sbjct  199  EAAIITHGHEDHIGAIPWLL  218



>ref|WP_033139463.1| ribonuclease J [Blautia producta]
Length=557

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            ++I+P+GGL +IGMN   V Y+D  I+ID G+ FP  + LG+ K+IPD +++ +   K++
Sbjct  12   VKIIPLGGLDKIGMNITAVEYHDTIIVIDCGISFPDDEMLGIDKVIPDVSYLIENKEKVK  71

Query  613  AVIITHGHEDHIGALPWVIPAL  678
              +ITHGHEDHIGALP+++P +
Sbjct  72   GFVITHGHEDHIGALPYILPQI  93



>ref|WP_027426039.1| ribonuclease J [Lachnospiraceae bacterium NC2004]
Length=557

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  409  YEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFI  588
            Y+G   P ++I+P+GGL +IGMN     Y D  I++D G+ FP  D LGV  +IPD T++
Sbjct  4    YQGDAAPKVKIIPLGGLEQIGMNITAFEYEDSIIIVDCGLSFPEDDMLGVDLVIPDITYL  63

Query  589  EKWSHKIEAVIITHGHEDHIGALPWV  666
            ++   KI+ +IITH HEDHIGA+P+V
Sbjct  64   KENREKIKGMIITHAHEDHIGAIPYV  89



>ref|WP_008711909.1| MULTISPECIES: metallo-beta-lactamase [Synergistaceae]
 gb|EHL65318.1| hypothetical protein HMPREF1006_00331 [Synergistes sp. 3_1_syn1]
Length=569

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L + P+GG+GEIG N  + GY D YI++D G+ FP  D LG+  +IPD  F+ +   KI 
Sbjct  21   LFVCPLGGMGEIGKNLTVFGYGDDYIIVDCGLKFPEEDMLGIDFVIPDVEFLMENKSKIR  80

Query  613  AVIITHGHEDHIGALPWVIP  672
             + ITHGHEDHIGALP+V+P
Sbjct  81   GIFITHGHEDHIGALPFVLP  100



>ref|WP_012869230.1| metallo-beta-lactamase [Thermanaerovibrio acidaminovorans]
 ref|YP_003316996.1| beta-lactamase domain-containing protein [Thermanaerovibrio acidaminovorans 
DSM 6589]
 gb|ACZ18714.1| beta-lactamase domain protein [Thermanaerovibrio acidaminovorans 
DSM 6589]
Length=572

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +1

Query  352  GEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVM  531
            G+ +G S      R+  +    + G  L+ +P+GG+GEIG N   + Y D  I+ID G+ 
Sbjct  2    GKESGGSSPSKPNRRRGKGKPSNRGKELKWIPLGGMGEIGKNISALQYGDEMIVIDCGLK  61

Query  532  FPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            FP  D LG+  +IPD +F+E+   KI  + ITHGHEDHIG LP+V+P L
Sbjct  62   FPEEDMLGIDLLIPDVSFLEQNRGKIRGIFITHGHEDHIGGLPYVLPKL  110



>ref|WP_044566217.1| ribonuclease J [Anaerococcus sp. 9402080]
Length=559

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++PIGGL EIG NC +V Y +  ++ID G+ FP  D LGV  +IPD T++E+   K+ 
Sbjct  7    LKLIPIGGLQEIGKNCTIVEYGNDMVMIDCGLTFPDQDMLGVDIVIPDFTYVEENKDKLR  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + +THGHEDHIGA+P+ + ++
Sbjct  67   GIFVTHGHEDHIGAIPYFLKSV  88



>gb|EFY05518.1| hypothetical protein HMPREF9443_00479 [Phascolarctobacterium 
succinatutens YIT 12067]
Length=580

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +1

Query  406  FYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTF  585
            F+ G     ++I+P+GGLGEIG N  +  Y D  ILIDAG+MFP  D LG+  +IPD T+
Sbjct  25   FFLGKFQHKVQIIPLGGLGEIGKNMTVFRYGDDMILIDAGLMFPEDDMLGIDLVIPDITY  84

Query  586  IEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            + +   KI+ + +THGHEDHIGALP+V+  +
Sbjct  85   LVENKDKIKGIFLTHGHEDHIGALPYVMKQI  115



>ref|WP_034859832.1| ribonuclease J [[Clostridium] hathewayi]
Length=547

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            ++I+P+GGL +IGMN     Y D  I++D G+ FP  D LG+  +IPD T++++ + KI+
Sbjct  1    MKIIPLGGLEQIGMNITAFEYEDNIIIVDCGLAFPSDDMLGIDLVIPDVTYLKQNADKIK  60

Query  613  AVIITHGHEDHIGALPWVIPAL  678
              +ITHGHEDHIGALP+++P +
Sbjct  61   GFVITHGHEDHIGALPYILPQI  82



>ref|WP_019138567.1| ribonuclease J [Peptoniphilus timonensis]
Length=553

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            ++I+P+GGL EIG N  LV Y D  I+ID G+ FP  + LG+  +IPD T++E   HKI 
Sbjct  7    VKIIPLGGLHEIGKNLTLVEYRDDIIIIDCGMTFPEDEMLGIDVVIPDVTYLENNKHKIR  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             +++THGHEDHIGA+P+V+  L
Sbjct  67   GLVLTHGHEDHIGAIPYVLRKL  88



>ref|WP_027889188.1| ribonuclease J [Megamonas hypermegale]
Length=555

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N  +V Y D  ++IDAG+MFP  + LG+  +IPD T++ +   KI 
Sbjct  8    LQIIPLGGLGEIGKNMTVVRYGDDILVIDAGLMFPEEEMLGIDLVIPDITYLLENKDKIR  67

Query  613  AVIITHGHEDHIGALPWVI  669
            A+++THGHEDHIGALP+V+
Sbjct  68   AIVLTHGHEDHIGALPYVL  86



>ref|WP_041531564.1| ribonuclease J [Pelobacter carbinolicus]
Length=553

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +1

Query  427  PP--LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            PP  +RILP+GGLGEIG+N M+V Y D  ++ID G+MFP     G+  +IPD + +E  +
Sbjct  2    PPEAVRILPLGGLGEIGLNMMVVEYRDELLIIDCGLMFPEPHMPGIDLVIPDISCLEDHT  61

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
            H+I  +++THGHEDHIGA+P+++  L
Sbjct  62   HRIRGLVLTHGHEDHIGAVPFLLRKL  87



>ref|WP_021752935.1| ribonuclease J 1 [Gemella bergeri]
 gb|ERK56346.1| ribonuclease J 1 [Gemella bergeriae ATCC 700627]
Length=556

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  439  ILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAV  618
            I  IGGLGEIG N   + Y D  I+IDAGV FPG + LG+  +IPD ++IEK   KI+A+
Sbjct  12   IAAIGGLGEIGKNTYAIQYRDEIIIIDAGVKFPGDNILGIDYVIPDYSYIEKNVSKIKAL  71

Query  619  IITHGHEDHIGALPWVI  669
            IITHGHEDHIG LP+++
Sbjct  72   IITHGHEDHIGGLPFLL  88



>ref|WP_022411946.1| hypothetical protein [Clostridium sp. CAG:470]
 emb|CDE14244.1| putative uncharacterized protein [Clostridium sp. CAG:470]
Length=674

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 72/111 (65%), Gaps = 6/111 (5%)
 Frame = +1

Query  346  VKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAG  525
            V+GE A   + +   RK E  ++    P L+I+P+GGL E+G N  +  Y D  I++D G
Sbjct  103  VRGESA---IAERKTRKNEMIFKK---PKLKIIPLGGLHEVGKNITVFEYDDEIIVVDCG  156

Query  526  VMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            + FP  D LGV  +IPD T++++   KI+ +IITHGHEDHIG++P+++  +
Sbjct  157  LSFPDDDMLGVDLVIPDITYLQRNEEKIKGLIITHGHEDHIGSVPYLLKQI  207



>ref|WP_022122662.1| hypothetical protein [Clostridium sp. CAG:510]
 emb|CDA68479.1| putative uncharacterized protein [Clostridium sp. CAG:510]
Length=557

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +1

Query  412  EGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIE  591
            E +    L+I+P+GGL +IGMN     Y D  +++D G+ FP  D LG+  +IPDTT++E
Sbjct  5    ENTAASKLKIIPLGGLEQIGMNITAFEYEDSIVVVDCGLSFPEDDMLGIDLVIPDTTYLE  64

Query  592  KWSHKIEAVIITHGHEDHIGALPWVI  669
                K++  +ITHGHEDHIGALP+V+
Sbjct  65   NNLDKVKGFVITHGHEDHIGALPYVL  90



>ref|WP_027434675.1| ribonuclease J [Lachnospiraceae bacterium AB2028]
Length=559

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  424  GPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSH  603
              PLRI+P+GGL +IGMN     Y D  +++D G+ FPG D  GV  +IPD T++E+   
Sbjct  9    ASPLRIIPLGGLDQIGMNITAFEYEDSIMILDCGLGFPGDDMYGVDLVIPDVTYLEERLD  68

Query  604  KIEAVIITHGHEDHIGALPWVIPAL  678
            KI+  +ITHGHEDHIGALP+++  +
Sbjct  69   KIKGFVITHGHEDHIGALPYILKKI  93



>ref|WP_022107384.1| hypothetical protein [Clostridium sp. CAG:138]
 emb|CDA51239.1| putative uncharacterized protein [Clostridium sp. CAG:138]
Length=621

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +1

Query  382  AVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVV  561
            AV RK +     S  P L+I+P+GGLGEIG N  ++ Y +  I+ID G+ FP  +  G+ 
Sbjct  55   AVHRKEKNLARKSTAPQLKIIPLGGLGEIGKNMTVLEYNEDIIVIDCGLAFPDEEMPGID  114

Query  562  KIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVI  669
             +IPD +++E+ + ++ A IITHGHEDHIGA+ + +
Sbjct  115  MVIPDMSYLEQNAERLRAFIITHGHEDHIGAISYAL  150



>gb|EHI58103.1| hypothetical protein HMPREF9473_03867 [ [[Clostridium] hathewayi 
WAL-18680]
Length=560

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            ++I+P+GGL +IGMN     Y D  I++D G+ FP  D LG+  +IPD T++++ + KI+
Sbjct  14   VKIIPLGGLEQIGMNITAFEYEDNIIIVDCGLAFPSDDMLGIDLVIPDVTYLKQNADKIK  73

Query  613  AVIITHGHEDHIGALPWVIPAL  678
              +ITHGHEDHIGALP+++P +
Sbjct  74   GFVITHGHEDHIGALPYILPQI  95



>ref|WP_002842267.1| ribonuclease J [Finegoldia magna]
 gb|EGS32292.1| hypothetical protein HMPREF9489_0492 [Finegoldia magna SY403409CC001050417]
Length=555

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGL EIG N  +V Y D  I++D G+ FP  + LGV  +IPD +++EK   KI 
Sbjct  9    LKVIPLGGLNEIGKNMTVVEYKDDIIVVDCGMTFPDEEMLGVDIVIPDISYLEKNKEKIR  68

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             ++ITHGHEDHIGA+P+V+  L
Sbjct  69   GIVITHGHEDHIGAIPYVLKKL  90



>ref|WP_002845950.1| MULTISPECIES: ribonuclease J 1 [Peptostreptococcus]
 gb|EKX93905.1| ribonuclease J 1 [Peptostreptococcus anaerobius VPI 4330 = DSM 
2949]
 emb|CCY47426.1| putative ribonuclease J1 [Peptostreptococcus anaerobius CAG:621]
Length=556

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +1

Query  418  SDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKW  597
            ++   ++I+P+GGL EIG N  L+ Y D  I+IDAG+ FP  + LG+  +IPD T++EK 
Sbjct  4    NNNDKIKIIPLGGLNEIGKNMTLIEYKDEIIVIDAGLCFPEDELLGIDIVIPDITYLEKN  63

Query  598  SHKIEAVIITHGHEDHIGALPWVIPAL  678
              K++ + ITHGHEDHIGA+P+++  +
Sbjct  64   IDKVKGIFITHGHEDHIGAMPYILKKI  90



>ref|WP_002838416.1| ribonuclease J [Finegoldia magna]
 gb|EFK93693.1| hypothetical protein HMPREF9261_0666 [Finegoldia magna ACS-171-V-Col3]
 gb|EFL54724.1| hypothetical protein HMPREF9289_0627 [Finegoldia magna BVS033A4]
 gb|EXF27024.1| ribonuclease J [Finegoldia magna ALB8]
Length=555

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGL EIG N  +V Y D  I++D G+ FP  + LGV  +IPD +++EK   KI 
Sbjct  9    LKVIPLGGLNEIGKNMTVVEYKDDIIVVDCGMTFPDEEMLGVDIVIPDISYLEKNKEKIR  68

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             ++ITHGHEDHIGA+P+V+  L
Sbjct  69   GIVITHGHEDHIGAIPYVLKKL  90



>ref|WP_012290528.1| ribonuclease J [Finegoldia magna]
 dbj|BAG08049.1| putative Zn-dependent hydrolase [Finegoldia magna ATCC 29328]
Length=555

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGL EIG N  +V Y D  I++D G+ FP  + LGV  +IPD +++EK   KI 
Sbjct  9    LKVIPLGGLNEIGKNMTVVEYKDDIIVVDCGMTFPDEEMLGVDIVIPDISYLEKNKEKIR  68

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             ++ITHGHEDHIGA+P+V+  L
Sbjct  69   GIVITHGHEDHIGAIPYVLKKL  90



>ref|WP_021772397.1| hypothetical protein [Mitsuokella sp. oral taxon 131]
 gb|ERL25030.1| hypothetical protein HMPREF1985_00491 [Mitsuokella sp. oral taxon 
131 str. W9106]
Length=554

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N  +V   D  ++ID+G+MFP  D LG+  +IPD T++ +   KI+
Sbjct  8    LQIIPLGGLGEIGKNMTVVRVDDEILVIDSGLMFPEEDMLGIDLVIPDITYLLENRDKIK  67

Query  613  AVIITHGHEDHIGALPWVIPAL  678
            A+++THGHEDHIGALP+V+  +
Sbjct  68   AIVLTHGHEDHIGALPYVLKQI  89



>gb|ABA87904.1| metal-dependent hydrolase, beta-lactamase superfamily [Pelobacter 
carbinolicus DSM 2380]
Length=564

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +1

Query  427  PP--LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            PP  +RILP+GGLGEIG+N M+V Y D  ++ID G+MFP     G+  +IPD + +E  +
Sbjct  13   PPEAVRILPLGGLGEIGLNMMVVEYRDELLIIDCGLMFPEPHMPGIDLVIPDISCLEDHT  72

Query  601  HKIEAVIITHGHEDHIGALPWVIPAL  678
            H+I  +++THGHEDHIGA+P+++  L
Sbjct  73   HRIRGLVLTHGHEDHIGAVPFLLRKL  98



>ref|WP_042272127.1| ribonuclease J [Clostridium sp. 01]
Length=555

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  421  DGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWS  600
            +   ++I+ +GGL E+G N  LV Y D  I+IDAG+ FPG D LG+  +IPD T++ K  
Sbjct  5    NANKIKIMALGGLNEVGKNMTLVEYKDEIIVIDAGLSFPGDDMLGIDIVIPDITYLIKNK  64

Query  601  HKIEAVIITHGHEDHIGALPWVI  669
             K++ + ITHGHEDHIGALP+++
Sbjct  65   DKVKGIFITHGHEDHIGALPYIL  87



>ref|WP_022165737.1| uncharacterized protein [Eubacterium sp. CAG:192]
 emb|CDB13355.1| uncharacterized protein BN525_01242 [Eubacterium sp. CAG:192]
Length=553

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  418  SDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKW  597
            SD   ++I+P+GGL EIGMN     Y D  I++D G+ FP  D LG+  +IPD TF+++ 
Sbjct  2    SDNSKIKIIPLGGLEEIGMNMTAFEYNDGIIVVDCGLSFPSDDMLGIDCVIPDITFLKEN  61

Query  598  SHKIEAVIITHGHEDHIGALPWVIPAL  678
              K++  +ITHGHEDHIGALP+V+  +
Sbjct  62   IKKVKGFVITHGHEDHIGALPYVLKEI  88



>ref|WP_022077793.1| hypothetical protein [Clostridium sp. CAG:571]
 emb|CDA16544.1| putative uncharacterized protein [Clostridium sp. CAG:571]
Length=620

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 73/119 (61%), Gaps = 12/119 (10%)
 Frame = +1

Query  322  AKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYD  501
            A+ PR + VK E   KS  D   +K          P L+I+P+GGL EIG N  +  Y +
Sbjct  48   ARKPRTKKVKNEI--KSSNDFEFKK----------PNLKIIPLGGLEEIGKNITVFEYDN  95

Query  502  RYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
              +L+D G+ FP  + LGV  +IPD T++E+   KI+ ++ITHGHEDHIG++P+V+  +
Sbjct  96   EIVLVDCGLEFPEDNMLGVDLVIPDVTYLERNKEKIKGLVITHGHEDHIGSIPYVLKQV  154



>ref|WP_022224813.1| hypothetical protein [Clostridium sp. CAG:253]
 emb|CDB89280.1| putative uncharacterized protein [Clostridium sp. CAG:253]
Length=167

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 76/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  286  SVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGE  465
            ++  P+ ++ + AK P +   K      ++     R  ++  +   G  L+I+P+GGL +
Sbjct  14   NIEEPAAEE-KTAKRPGRPRRKTTDKPATVRKTAARSTKKKEDAPLGKGLKIIPLGGLEQ  72

Query  466  IGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDH  645
            IGMN     Y D  +++D G+ FP  + LG+  +IPD T++++   K++  +ITHGHEDH
Sbjct  73   IGMNITAFEYEDSIVVVDCGLSFPEDEMLGIDLVIPDITYLKENIDKVKGFVITHGHEDH  132

Query  646  IGALPWVI  669
            IGALP+V+
Sbjct  133  IGALPYVL  140



>ref|WP_043166822.1| ribonuclease [Bifidobacterium callitrichos]
 gb|KFI56051.1| ribonuclease [Bifidobacterium callitrichos DSM 23973]
Length=648

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = +1

Query  319  GAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYY  498
            GA   R++NV G  A    +DAV     ++ +GS    +RI P+GGLGEIG N  ++ Y 
Sbjct  65   GASRSRRQNV-GTQATAPQQDAVLIAPPKYRKGS----MRITPLGGLGEIGRNMNVIEYN  119

Query  499  DRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHEDHIGALPWVI  669
               +LID GV+FP  ++ GV  I+PD ++I+    ++EA+++THGHEDHIG +P+++
Sbjct  120  GHLLLIDCGVLFPEEEQPGVDLILPDFSYIKDRLDQVEALVLTHGHEDHIGGVPYLL  176



>gb|EEG56378.1| hypothetical protein CLOSTASPAR_01541 [ [[Clostridium asparagiforme] 
DSM 15981]
Length=704

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/130 (38%), Positives = 73/130 (56%), Gaps = 12/130 (9%)
 Frame = +1

Query  280  SCSVRTPSVKDIRGAKLPRKRNVKGEGAGKSMEDAVQRKMEQFYEGSDGPPLRILPIGGL  459
            + S R P  ++ R A  P+ +N       KS             +G     L+I+P+GGL
Sbjct  120  NASKREPG-RETRPAAKPQNQNQNRPAKAKSAP-----------KGDGKGKLKIIPLGGL  167

Query  460  GEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAVIITHGHE  639
             +IGMN     Y D  I++D G+ FPG D LG+  +IPD T+++    K++  +ITHGHE
Sbjct  168  EQIGMNITAFEYEDTIIVVDCGLAFPGDDMLGIDLVIPDVTYLKNNIDKVKGFVITHGHE  227

Query  640  DHIGALPWVI  669
            DHIGALP+++
Sbjct  228  DHIGALPYIL  237



>ref|WP_004822778.1| ribonuclease J [Peptoniphilus indolicus]
 gb|EGY76634.1| metallo-beta-lactamase [Peptoniphilus indolicus ATCC 29427]
Length=554

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            +RI+P+GG+ EIG N  LV Y D  +++D G+ FPG++ LG+  +IPD T++ K   +I+
Sbjct  7    VRIIPLGGMLEIGKNLTLVEYKDEILIVDCGMTFPGHELLGIDAVIPDVTYLIKNKDRIK  66

Query  613  AVIITHGHEDHIGALPWVI  669
            A+I+THGHEDHIGA+P+V+
Sbjct  67   AMILTHGHEDHIGAIPYVL  85



>ref|WP_041537920.1| ribonuclease J [Carboxydothermus hydrogenoformans]
Length=552

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N M++ Y D  I+IDAG+MFP  + LG+  +IPD +++ +   K++
Sbjct  6    LQIIPLGGLGEIGKNMMVIKYNDAIIVIDAGLMFPEEELLGIDMVIPDMSYLIENKEKVK  65

Query  613  AVIITHGHEDHIGALPWVI  669
            AV++THGHEDHIG +P+ +
Sbjct  66   AVLLTHGHEDHIGGMPYFL  84



>ref|WP_005509425.1| ribonuclease J [Corynebacterium amycolatum]
 gb|EEB64078.1| hypothetical protein CORAM0001_0826 [Corynebacterium amycolatum 
SK46]
Length=693

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR++ +GG+ EIG N  ++ Y +R I++D GV+FP  DE GV  I+PD +++E    ++E
Sbjct  129  LRVVALGGISEIGRNMTVLEYKNRLIIVDCGVLFPSSDEPGVDLILPDFSYMEDKWDRVE  188

Query  613  AVIITHGHEDHIGALPWVI  669
            A+++THGHEDHIGA+PW++
Sbjct  189  ALVVTHGHEDHIGAIPWLL  207



>ref|WP_027190382.1| ribonuclease J [Desulfovibrio putealis]
Length=550

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  439  ILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIEAV  618
            + P+GGLGEIGMNC+ +   D  +++D G+MFP     GV  +IP   F+    H+++A+
Sbjct  7    LFPLGGLGEIGMNCLCISSGDSMVMVDCGLMFPEDYLFGVDVVIPRFDFVLARKHQLKAI  66

Query  619  IITHGHEDHIGALPWVIP  672
            I+THGHEDHIGALPW++P
Sbjct  67   ILTHGHEDHIGALPWLLP  84



>ref|WP_004834450.1| ribonuclease J [Anaerococcus prevotii]
 gb|EGC82551.1| hypothetical protein HMPREF9290_1338 [Anaerococcus prevotii ACS-065-V-Col13]
Length=560

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LRI+P+GGL E+G NC +V Y +  I+ID G+ FP  + LGV  +IPD T++E+   K++
Sbjct  7    LRIIPLGGLQEVGKNCTVVEYGNDMIMIDCGLTFPDAEMLGVDIVIPDFTYVEENKKKLK  66

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + +THGHEDHIGA+P+ +  +
Sbjct  67   GIFVTHGHEDHIGAIPYFLKNI  88



>gb|EHL14165.1| hypothetical protein HMPREF9625_00008 [Oribacterium parvum ACB1]
 gb|EJF13754.1| hypothetical protein HMPREF1145_0422 [Oribacterium parvum ACB8]
Length=737

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +1

Query  391  RKMEQFYEGSDGPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKII  570
            +K +  ++GS    ++++P+GGL +IGMN   +   D  I++D G+ FP ++ LG+  +I
Sbjct  178  KKPKHTFQGS----VKVIPLGGLDQIGMNITAIETEDSMIIVDCGLAFPSFNMLGIDLVI  233

Query  571  PDTTFIEKWSHKIEAVIITHGHEDHIGALPWVIPAL  678
            PD T+I+   HK++  +ITHGHEDHIGALP+V+  +
Sbjct  234  PDITYIKSQIHKMKGFVITHGHEDHIGALPYVLQQI  269



>ref|WP_006583942.1| metallo-beta-lactamase [Thermanaerovibrio velox]
 gb|EHM10448.1| putative hydrolase of the metallo-beta-lactamase superfamily 
[Thermanaerovibrio velox DSM 12556]
Length=572

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+ +P+GG+GEIG N  ++ Y D  ++ID G+ FP  + LG+  +IPD +F+E+   KI+
Sbjct  29   LKWIPLGGMGEIGKNVSVLQYGDEMVVIDCGLKFPEEEMLGIDLVIPDVSFLEENRDKIK  88

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIGALP+V+P L
Sbjct  89   GIFITHGHEDHIGALPFVLPKL  110



>ref|WP_014794735.1| MULTISPECIES: ribonuclease J [Desulfitobacterium]
 gb|AFM01255.1| hypothetical protein Desde_2955 [Desulfitobacterium dehalogenans 
ATCC 51507]
Length=552

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L I+P+GG GEIG N ++  + D  I+ID GV FP  + LG+  +IPD T++EK   KI+
Sbjct  3    LSIIPLGGTGEIGKNLLVFEFGDSIIVIDGGVKFPDDELLGIDLVIPDITYLEKRKSKIQ  62

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             + ITHGHEDHIG LP+++P L
Sbjct  63   GIFITHGHEDHIGGLPFILPKL  84



>gb|ABB14068.1| metallo-beta-lactamase family protein [Carboxydothermus hydrogenoformans 
Z-2901]
Length=554

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+I+P+GGLGEIG N M++ Y D  I+IDAG+MFP  + LG+  +IPD +++ +   K++
Sbjct  8    LQIIPLGGLGEIGKNMMVIKYNDAIIVIDAGLMFPEEELLGIDMVIPDMSYLIENKEKVK  67

Query  613  AVIITHGHEDHIGALPWVI  669
            AV++THGHEDHIG +P+ +
Sbjct  68   AVLLTHGHEDHIGGMPYFL  86



>ref|WP_014967490.1| ribonuclease J [Gottschalkia acidurici]
 gb|AFS78353.1| RNA-metabolising metallo-beta-lactamase [ [[Clostridium] acidurici 
9a]
Length=553

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  424  GPPLRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSH  603
             P LRI+P+GGL E+G N  ++ Y D  I+ID G+ FP  + LG+  +IPD T++ K   
Sbjct  5    SPKLRIIPLGGLYEVGKNITVIEYNDEIIVIDCGLTFPEEEMLGIDVVIPDITYLLKNRE  64

Query  604  KIEAVIITHGHEDHIGALPWVI  669
            KI+ +++THGHEDHIGALP+V+
Sbjct  65   KIKGIVLTHGHEDHIGALPYVL  86



>ref|WP_016422601.1| ribonuclease J [Corynebacterium sp. HFH0082]
 gb|EPD47223.1| ribonuclease J [Corynebacterium sp. HFH0082]
Length=693

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            LR++ +GG+ EIG N  ++ Y +R I++D GV+FP  DE GV  I+PD +++E    ++E
Sbjct  129  LRVVALGGISEIGRNMTVLEYKNRLIIVDCGVLFPSSDEPGVDLILPDFSYMEDKWDRVE  188

Query  613  AVIITHGHEDHIGALPWVI  669
            A+++THGHEDHIGA+PW++
Sbjct  189  ALVVTHGHEDHIGAIPWLL  207



>ref|WP_002836243.1| ribonuclease J [Finegoldia magna]
 gb|EFH92399.1| hypothetical protein HMPREF0391_11371 [Finegoldia magna ATCC 
53516]
Length=555

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  433  LRILPIGGLGEIGMNCMLVGYYDRYILIDAGVMFPGYDELGVVKIIPDTTFIEKWSHKIE  612
            L+++P+GGL EIG N  ++ Y D  I++D G+ FP  + LGV  +IPD +++EK   KI 
Sbjct  9    LKVIPLGGLNEIGKNMTVIEYKDDIIVVDCGMTFPDEEMLGVDIVIPDISYLEKNKEKIR  68

Query  613  AVIITHGHEDHIGALPWVIPAL  678
             ++ITHGHEDHIGA+P+V+  L
Sbjct  69   GIVITHGHEDHIGAIPYVLKKL  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240