BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038M19

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002272165.1|  PREDICTED: probable CCR4-associated factor 1...    246   7e-78   Vitis vinifera
ref|XP_011082241.1|  PREDICTED: probable CCR4-associated factor 1...    245   1e-77   Sesamum indicum [beniseed]
ref|XP_006356242.1|  PREDICTED: probable CCR4-associated factor 1...    245   1e-77   Solanum tuberosum [potatoes]
ref|XP_004241682.1|  PREDICTED: probable CCR4-associated factor 1...    245   2e-77   Solanum lycopersicum
gb|EYU24608.1|  hypothetical protein MIMGU_mgv1a011718mg                243   7e-77   Erythranthe guttata [common monkey flower]
gb|KJB68026.1|  hypothetical protein B456_010G222500                    243   8e-77   Gossypium raimondii
gb|KJB66334.1|  hypothetical protein B456_010G136400                    242   2e-76   Gossypium raimondii
ref|XP_002527306.1|  ccr4-associated factor, putative                   242   2e-76   Ricinus communis
ref|XP_009760590.1|  PREDICTED: probable CCR4-associated factor 1...    242   3e-76   Nicotiana sylvestris
ref|XP_009605547.1|  PREDICTED: probable CCR4-associated factor 1...    242   3e-76   Nicotiana tomentosiformis
ref|XP_006341359.1|  PREDICTED: probable CCR4-associated factor 1...    241   3e-76   Solanum tuberosum [potatoes]
gb|KDP41983.1|  hypothetical protein JCGZ_27001                         241   4e-76   Jatropha curcas
ref|XP_004235935.1|  PREDICTED: probable CCR4-associated factor 1...    241   4e-76   Solanum lycopersicum
ref|XP_011020623.1|  PREDICTED: probable CCR4-associated factor 1...    241   6e-76   Populus euphratica
ref|XP_002303842.1|  hypothetical protein POPTR_0003s17950g             241   7e-76   
ref|XP_007023407.1|  CCR4-associated factor 1                           243   8e-76   
ref|XP_007023408.1|  Polynucleotidyl transferase, ribonuclease H-...    241   9e-76   Theobroma cacao [chocolate]
gb|KHG18085.1|  putative CCR4-associated factor 1 -like protein         241   2e-75   Gossypium arboreum [tree cotton]
ref|XP_011034532.1|  PREDICTED: probable CCR4-associated factor 1...    240   2e-75   Populus euphratica
ref|XP_010275748.1|  PREDICTED: probable CCR4-associated factor 1...    239   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_007215794.1|  hypothetical protein PRUPE_ppa009874mg             239   2e-75   Prunus persica
ref|XP_009793121.1|  PREDICTED: probable CCR4-associated factor 1...    239   4e-75   Nicotiana sylvestris
ref|XP_007023405.1|  Polynucleotidyl transferase, ribonuclease H-...    236   6e-75   
ref|XP_011073341.1|  PREDICTED: probable CCR4-associated factor 1...    238   1e-74   Sesamum indicum [beniseed]
ref|XP_007023403.1|  Polynucleotidyl transferase, ribonuclease H-...    238   1e-74   
ref|XP_008228784.1|  PREDICTED: probable CCR4-associated factor 1...    238   1e-74   Prunus mume [ume]
ref|XP_009594641.1|  PREDICTED: probable CCR4-associated factor 1...    237   2e-74   Nicotiana tomentosiformis
ref|XP_011082251.1|  PREDICTED: probable CCR4-associated factor 1...    235   1e-73   Sesamum indicum [beniseed]
gb|KJB07590.1|  hypothetical protein B456_001G031500                    235   1e-73   Gossypium raimondii
ref|XP_010265638.1|  PREDICTED: probable CCR4-associated factor 1...    234   2e-73   Nelumbo nucifera [Indian lotus]
gb|EPS71126.1|  hypothetical protein M569_03633                         234   3e-73   Genlisea aurea
ref|XP_003526204.1|  PREDICTED: probable CCR4-associated factor 1...    234   3e-73   Glycine max [soybeans]
gb|KHN07034.1|  Putative CCR4-associated factor 1 like 7                234   4e-73   Glycine soja [wild soybean]
ref|XP_002515442.1|  ccr4-associated factor, putative                   234   4e-73   
ref|XP_006427595.1|  hypothetical protein CICLE_v10026260mg             234   5e-73   
gb|KDO42998.1|  hypothetical protein CISIN_1g023991mg                   233   5e-73   Citrus sinensis [apfelsine]
gb|KHG00404.1|  putative CCR4-associated factor 1 -like protein         233   6e-73   Gossypium arboreum [tree cotton]
ref|XP_006465196.1|  PREDICTED: probable CCR4-associated factor 1...    233   6e-73   Citrus sinensis [apfelsine]
gb|KHN29617.1|  Putative CCR4-associated factor 1 like 7                233   7e-73   Glycine soja [wild soybean]
ref|XP_003522433.1|  PREDICTED: probable CCR4-associated factor 1...    233   9e-73   Glycine max [soybeans]
emb|CDO98220.1|  unnamed protein product                                233   1e-72   Coffea canephora [robusta coffee]
ref|XP_009354185.1|  PREDICTED: probable CCR4-associated factor 1...    232   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_008375521.1|  PREDICTED: probable CCR4-associated factor 1...    232   2e-72   Malus domestica [apple tree]
gb|EPS59819.1|  hypothetical protein M569_14984                         231   3e-72   Genlisea aurea
ref|XP_004305482.1|  PREDICTED: probable CCR4-associated factor 1...    231   5e-72   Fragaria vesca subsp. vesca
ref|XP_009801027.1|  PREDICTED: probable CCR4-associated factor 1...    230   8e-72   Nicotiana sylvestris
gb|KDP33530.1|  hypothetical protein JCGZ_07101                         230   1e-71   Jatropha curcas
ref|XP_010089956.1|  putative CCR4-associated factor 1-7-like pro...    230   2e-71   Morus notabilis
ref|XP_010665982.1|  PREDICTED: probable CCR4-associated factor 1...    229   3e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007136961.1|  hypothetical protein PHAVU_009G088600g             228   4e-71   Phaseolus vulgaris [French bean]
gb|KHG16599.1|  putative CCR4-associated factor 1 -like protein         228   5e-71   Gossypium arboreum [tree cotton]
gb|KJB68416.1|  hypothetical protein B456_010G244300                    228   7e-71   Gossypium raimondii
gb|EYU21723.1|  hypothetical protein MIMGU_mgv1a019889mg                227   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_002324905.2|  hypothetical protein POPTR_0018s02370g             227   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_009620266.1|  PREDICTED: probable CCR4-associated factor 1...    227   2e-70   Nicotiana tomentosiformis
ref|XP_011036659.1|  PREDICTED: probable CCR4-associated factor 1...    227   2e-70   Populus euphratica
ref|XP_010063560.1|  PREDICTED: probable CCR4-associated factor 1...    226   4e-70   Eucalyptus grandis [rose gum]
ref|XP_008336906.1|  PREDICTED: probable CCR4-associated factor 1...    227   4e-70   
ref|XP_008445259.1|  PREDICTED: probable CCR4-associated factor 1...    226   5e-70   Cucumis melo [Oriental melon]
ref|XP_004138704.1|  PREDICTED: probable CCR4-associated factor 1...    226   5e-70   Cucumis sativus [cucumbers]
ref|XP_004501372.1|  PREDICTED: probable CCR4-associated factor 1...    226   6e-70   
ref|XP_009358471.1|  PREDICTED: probable CCR4-associated factor 1...    226   8e-70   Pyrus x bretschneideri [bai li]
ref|XP_003530297.1|  PREDICTED: probable CCR4-associated factor 1...    225   1e-69   Glycine max [soybeans]
gb|ACU24625.1|  unknown                                                 225   1e-69   Glycine max [soybeans]
gb|KJB55043.1|  hypothetical protein B456_009G061200                    224   1e-69   Gossypium raimondii
ref|XP_002309667.1|  hypothetical protein POPTR_0006s27840g             224   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010532089.1|  PREDICTED: probable CCR4-associated factor 1...    224   3e-69   Tarenaya hassleriana [spider flower]
ref|XP_010532091.1|  PREDICTED: probable CCR4-associated factor 1...    224   3e-69   Tarenaya hassleriana [spider flower]
ref|XP_010048831.1|  PREDICTED: probable CCR4-associated factor 1...    223   4e-69   Eucalyptus grandis [rose gum]
ref|XP_006857184.1|  hypothetical protein AMTR_s00065p00182000          223   4e-69   Amborella trichopoda
ref|XP_010648684.1|  PREDICTED: probable CCR4-associated factor 1...    223   4e-69   Vitis vinifera
ref|XP_007135810.1|  hypothetical protein PHAVU_010G160400g             224   5e-69   Phaseolus vulgaris [French bean]
ref|XP_007011965.1|  Polynucleotidyl transferase, ribonuclease H-...    223   5e-69   
ref|XP_007202386.1|  hypothetical protein PRUPE_ppa009376mg             224   6e-69   Prunus persica
ref|XP_008242960.1|  PREDICTED: probable CCR4-associated factor 1...    224   6e-69   Prunus mume [ume]
gb|KHF99352.1|  putative CCR4-associated factor 1 -like protein         224   7e-69   Gossypium arboreum [tree cotton]
ref|XP_006483458.1|  PREDICTED: probable CCR4-associated factor 1...    223   9e-69   Citrus sinensis [apfelsine]
emb|CDP10211.1|  unnamed protein product                                222   1e-68   Coffea canephora [robusta coffee]
ref|XP_004507083.1|  PREDICTED: probable CCR4-associated factor 1...    222   1e-68   Cicer arietinum [garbanzo]
ref|XP_008242959.1|  PREDICTED: probable CCR4-associated factor 1...    223   1e-68   
gb|AFK43307.1|  unknown                                                 222   2e-68   Lotus japonicus
ref|XP_003604226.1|  Ribonuclease CAF1                                  222   2e-68   
ref|XP_006356929.1|  PREDICTED: probable CCR4-associated factor 1...    221   2e-68   Solanum tuberosum [potatoes]
ref|XP_008354337.1|  PREDICTED: probable CCR4-associated factor 1...    222   3e-68   
ref|XP_008344039.1|  PREDICTED: probable CCR4-associated factor 1...    221   4e-68   
ref|XP_011039582.1|  PREDICTED: probable CCR4-associated factor 1...    221   4e-68   Populus euphratica
emb|CAN79806.1|  hypothetical protein VITISV_031504                     221   5e-68   Vitis vinifera
ref|XP_010532085.1|  PREDICTED: probable CCR4-associated factor 1...    221   5e-68   Tarenaya hassleriana [spider flower]
ref|XP_003531734.1|  PREDICTED: probable CCR4-associated factor 1...    221   6e-68   
gb|AFK45143.1|  unknown                                                 220   6e-68   Lotus japonicus
gb|KJB06630.1|  hypothetical protein B456_001G037000                    220   6e-68   Gossypium raimondii
ref|XP_009363839.1|  PREDICTED: probable CCR4-associated factor 1...    220   6e-68   Pyrus x bretschneideri [bai li]
ref|XP_004291948.1|  PREDICTED: probable CCR4-associated factor 1...    220   7e-68   Fragaria vesca subsp. vesca
ref|XP_003603309.1|  Ribonuclease CAF1                                  220   7e-68   
ref|XP_010092187.1|  putative CCR4-associated factor 1-7-like pro...    220   8e-68   Morus notabilis
ref|XP_006450304.1|  hypothetical protein CICLE_v10008276mg             224   2e-67   
ref|XP_009366159.1|  PREDICTED: probable CCR4-associated factor 1...    219   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_010537879.1|  PREDICTED: probable CCR4-associated factor 1...    219   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_010556071.1|  PREDICTED: probable CCR4-associated factor 1...    219   4e-67   Tarenaya hassleriana [spider flower]
gb|ACU20942.1|  unknown                                                 218   9e-67   Glycine max [soybeans]
gb|ACJ84891.1|  unknown                                                 217   1e-66   Medicago truncatula
ref|XP_010942117.1|  PREDICTED: probable CCR4-associated factor 1...    217   1e-66   Elaeis guineensis
ref|XP_004504674.1|  PREDICTED: probable CCR4-associated factor 1...    217   2e-66   Cicer arietinum [garbanzo]
ref|XP_010048142.1|  PREDICTED: probable CCR4-associated factor 1...    217   2e-66   Eucalyptus grandis [rose gum]
ref|NP_178193.1|  putative CCR4-associated factor 1-like 6              216   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185452.1|  putative CCR4-associated factor 1-like 6           216   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417447.1|  PREDICTED: probable CCR4-associated factor 1...    216   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010472873.1|  PREDICTED: probable CCR4-associated factor 1...    216   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006294779.1|  hypothetical protein CARUB_v10023830mg             216   5e-66   Capsella rubella
gb|ACN40154.1|  unknown                                                 216   5e-66   Picea sitchensis
ref|XP_006473977.1|  PREDICTED: probable CCR4-associated factor 1...    215   6e-66   Citrus sinensis [apfelsine]
ref|XP_010691601.1|  PREDICTED: probable CCR4-associated factor 1...    215   7e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011073532.1|  PREDICTED: probable CCR4-associated factor 1...    215   7e-66   Sesamum indicum [beniseed]
ref|XP_008378874.1|  PREDICTED: probable CCR4-associated factor 1...    215   8e-66   Malus domestica [apple tree]
ref|XP_006302671.1|  hypothetical protein CARUB_v10020778mg             215   9e-66   Capsella rubella
ref|XP_002881215.1|  hypothetical protein ARALYDRAFT_902256             215   1e-65   Arabidopsis lyrata subsp. lyrata
gb|ABK22659.1|  unknown                                                 215   1e-65   Picea sitchensis
emb|CDY63973.1|  BnaC02g46620D                                          214   1e-65   Brassica napus [oilseed rape]
ref|XP_010414034.1|  PREDICTED: probable CCR4-associated factor 1...    214   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010469632.1|  PREDICTED: probable CCR4-associated factor 1...    214   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010911571.1|  PREDICTED: probable CCR4-associated factor 1...    209   3e-65   Elaeis guineensis
ref|XP_004160761.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    213   4e-65   
ref|XP_009128391.1|  PREDICTED: probable CCR4-associated factor 1...    213   4e-65   Brassica rapa
ref|XP_004138706.1|  PREDICTED: probable CCR4-associated factor 1...    213   4e-65   Cucumis sativus [cucumbers]
ref|XP_008445257.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    213   5e-65   Cucumis melo [Oriental melon]
ref|NP_565735.1|  polynucleotidyl transferase, ribonuclease H-lik...    213   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929136.1|  PREDICTED: probable CCR4-associated factor 1...    213   6e-65   Elaeis guineensis
ref|XP_006368924.1|  hypothetical protein POPTR_0001s14860g             211   7e-65   
ref|XP_008799630.1|  PREDICTED: probable CCR4-associated factor 1...    213   7e-65   Phoenix dactylifera
gb|ABK24400.1|  unknown                                                 213   7e-65   Picea sitchensis
ref|XP_006389834.1|  hypothetical protein EUTSA_v10018990mg             212   2e-64   Eutrema salsugineum [saltwater cress]
ref|XP_009399558.1|  PREDICTED: probable CCR4-associated factor 1...    211   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010491786.1|  PREDICTED: probable CCR4-associated factor 1...    211   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006453661.1|  hypothetical protein CICLE_v10009159mg             211   2e-64   Citrus clementina [clementine]
ref|XP_009390565.1|  PREDICTED: probable CCR4-associated factor 1...    211   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010429900.1|  PREDICTED: probable CCR4-associated factor 1...    211   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010510101.1|  PREDICTED: probable CCR4-associated factor 1...    211   3e-64   Camelina sativa [gold-of-pleasure]
emb|CDY39943.1|  BnaC06g40210D                                          211   3e-64   Brassica napus [oilseed rape]
ref|XP_004250764.1|  PREDICTED: probable CCR4-associated factor 1...    211   3e-64   Solanum lycopersicum
ref|XP_002871445.1|  hypothetical protein ARALYDRAFT_487926             211   4e-64   
ref|XP_009106716.1|  PREDICTED: probable CCR4-associated factor 1...    211   4e-64   Brassica rapa
ref|NP_196657.1|  polynucleotidyl transferase, ribonuclease H-lik...    211   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92792.1|  putative CCR4-associated factor                         210   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122009.1|  PREDICTED: probable CCR4-associated factor 1...    210   6e-64   Brassica rapa
ref|XP_010453129.1|  PREDICTED: probable CCR4-associated factor 1...    210   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006286536.1|  hypothetical protein CARUB_v10001652mg             210   7e-64   Capsella rubella
emb|CDX69796.1|  BnaA10g21450D                                          210   8e-64   
ref|XP_010417661.1|  PREDICTED: probable CCR4-associated factor 1...    209   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006410344.1|  hypothetical protein EUTSA_v10017059mg             209   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_008794330.1|  PREDICTED: probable CCR4-associated factor 1...    209   2e-63   Phoenix dactylifera
ref|XP_008220692.1|  PREDICTED: probable CCR4-associated factor 1...    208   3e-63   Prunus mume [ume]
ref|XP_010419649.1|  PREDICTED: probable CCR4-associated factor 1...    208   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002309331.1|  hypothetical protein POPTR_0006s20130g             208   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009144015.1|  PREDICTED: probable CCR4-associated factor 1...    208   6e-63   Brassica rapa
ref|XP_006399590.1|  hypothetical protein EUTSA_v10014350mg             207   6e-63   Eutrema salsugineum [saltwater cress]
ref|XP_011033459.1|  PREDICTED: probable CCR4-associated factor 1...    207   7e-63   Populus euphratica
ref|XP_007222518.1|  hypothetical protein PRUPE_ppa009848mg             207   9e-63   Prunus persica
emb|CDY12234.1|  BnaC04g12640D                                          207   9e-63   Brassica napus [oilseed rape]
ref|XP_008377668.1|  PREDICTED: probable CCR4-associated factor 1...    207   1e-62   Malus domestica [apple tree]
emb|CDX97069.1|  BnaC09g45560D                                          206   2e-62   
ref|XP_002279241.1|  PREDICTED: probable CCR4-associated factor 1...    205   5e-62   Vitis vinifera
emb|CAN68032.1|  hypothetical protein VITISV_022019                     205   7e-62   Vitis vinifera
ref|XP_010541576.1|  PREDICTED: probable CCR4-associated factor 1...    204   2e-61   Tarenaya hassleriana [spider flower]
gb|EYU32376.1|  hypothetical protein MIMGU_mgv1a026872mg                203   4e-61   Erythranthe guttata [common monkey flower]
emb|CDX70376.1|  BnaC03g04600D                                          202   7e-61   
ref|XP_001766532.1|  predicted protein                                  201   2e-60   
ref|XP_001755261.1|  predicted protein                                  201   3e-60   
ref|XP_004287117.1|  PREDICTED: probable CCR4-associated factor 1...    197   1e-58   Fragaria vesca subsp. vesca
ref|XP_009131188.1|  PREDICTED: probable CCR4-associated factor 1...    196   3e-58   Brassica rapa
emb|CDY12236.1|  BnaC04g12660D                                          189   3e-54   Brassica napus [oilseed rape]
ref|XP_005843563.1|  hypothetical protein CHLNCDRAFT_59811              186   3e-54   Chlorella variabilis
gb|ACL53982.1|  unknown                                                 185   4e-54   Zea mays [maize]
ref|XP_004954218.1|  PREDICTED: probable CCR4-associated factor 1...    185   4e-54   Setaria italica
ref|XP_002981023.1|  hypothetical protein SELMODRAFT_444748             185   5e-54   Selaginella moellendorffii
ref|XP_002982500.1|  hypothetical protein SELMODRAFT_179583             185   5e-54   Selaginella moellendorffii
dbj|BAK01540.1|  predicted protein                                      184   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002862886.1|  hypothetical protein ARALYDRAFT_920160             183   1e-53   
ref|XP_002452981.1|  hypothetical protein SORBIDRAFT_04g035960          184   2e-53   Sorghum bicolor [broomcorn]
ref|NP_001063181.1|  Os09g0416800                                       181   2e-52   
ref|XP_011395961.1|  putative CCR4-associated factor 1-like prote...    181   3e-52   Auxenochlorella protothecoides
ref|XP_006660627.1|  PREDICTED: probable CCR4-associated factor 1...    180   3e-52   Oryza brachyantha
ref|XP_002460215.1|  hypothetical protein SORBIDRAFT_02g024730          180   4e-52   Sorghum bicolor [broomcorn]
gb|EEC74173.1|  hypothetical protein OsI_09281                          179   9e-52   Oryza sativa Indica Group [Indian rice]
dbj|BAD19081.1|  putative CCR4-NOT transcription complex subunit 7      179   9e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048387.1|  Os02g0796300                                       179   1e-51   
ref|XP_005649974.1|  CCR4-associated factor                             179   1e-51   Coccomyxa subellipsoidea C-169
ref|NP_001136747.1|  uncharacterized protein LOC100216888               179   2e-51   Zea mays [maize]
ref|XP_008676671.1|  PREDICTED: uncharacterized protein LOC100216...    179   2e-51   
gb|KIY93169.1|  CCR4-NOT transcription complex subunit 7/8              175   4e-51   Monoraphidium neglectum
ref|NP_001132298.1|  CCR4-NOT transcription complex subunit 7 iso...    176   1e-50   
dbj|BAJ92910.1|  predicted protein                                      176   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002965900.1|  hypothetical protein SELMODRAFT_84624              174   5e-50   Selaginella moellendorffii
gb|EYU24605.1|  hypothetical protein MIMGU_mgv1a011876mg                174   8e-50   Erythranthe guttata [common monkey flower]
ref|XP_002890137.1|  hypothetical protein ARALYDRAFT_312582             174   1e-49   Arabidopsis lyrata subsp. lyrata
ref|NP_173044.1|  polynucleotidyl transferase, ribonuclease H-lik...    172   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003056015.1|  predicted protein                                  172   4e-49   Micromonas pusilla CCMP1545
ref|XP_007023404.1|  Polynucleotidyl transferase, ribonuclease H-...    171   4e-49   
ref|XP_003570299.1|  PREDICTED: probable CCR4-associated factor 1...    172   5e-49   Brachypodium distachyon [annual false brome]
ref|XP_006304066.1|  hypothetical protein CARUB_v10009915mg             171   9e-49   Capsella rubella
ref|XP_001697447.1|  CCR4-associated factor                             171   1e-48   Chlamydomonas reinhardtii
ref|XP_010932239.1|  PREDICTED: probable CCR4-associated factor 1...    170   3e-48   Elaeis guineensis
ref|XP_004138705.1|  PREDICTED: probable CCR4-associated factor 1...    169   3e-48   
ref|XP_003578122.1|  PREDICTED: probable CCR4-associated factor 1...    169   4e-48   Brachypodium distachyon [annual false brome]
ref|XP_010048148.1|  PREDICTED: probable CCR4-associated factor 1...    169   5e-48   Eucalyptus grandis [rose gum]
ref|XP_006648046.1|  PREDICTED: probable CCR4-associated factor 1...    169   6e-48   
gb|EMS59499.1|  putative CCR4-associated factor 1-like protein 7        168   2e-47   Triticum urartu
ref|XP_010497514.1|  PREDICTED: probable CCR4-associated factor 1...    165   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010476692.1|  PREDICTED: probable CCR4-associated factor 1...    165   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_004956826.1|  PREDICTED: probable CCR4-associated factor 1...    164   5e-46   Setaria italica
ref|XP_002950174.1|  hypothetical protein VOLCADRAFT_80930              164   1e-45   Volvox carteri f. nagariensis
ref|XP_010541577.1|  PREDICTED: probable CCR4-associated factor 1...    162   1e-45   Tarenaya hassleriana [spider flower]
gb|KCW53891.1|  hypothetical protein EUGRSUZ_J03104                     162   1e-45   Eucalyptus grandis [rose gum]
ref|XP_003074753.1|  Caf1 CCR4-associated (transcription) factor,...    163   1e-45   
ref|XP_001416204.1|  polyA tail-shortening ribonuclease, probable       163   2e-45   Ostreococcus lucimarinus CCE9901
ref|XP_002507260.1|  predicted protein                                  161   4e-45   Micromonas commoda
gb|KFK43832.1|  hypothetical protein AALP_AA1G179300                    161   4e-45   Arabis alpina [alpine rockcress]
ref|XP_006665053.1|  PREDICTED: probable CCR4-associated factor 1...    162   6e-45   Oryza brachyantha
gb|ACQ77596.1|  CCR4-NOT                                                159   8e-45   Dimocarpus longan [longan]
dbj|BAD09890.1|  putative CCR4-NOT transcription complex, subunit 7     161   9e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006416864.1|  hypothetical protein EUTSA_v10008404mg             160   1e-44   Eutrema salsugineum [saltwater cress]
emb|CDS05253.1|  Putative CCR4-NOT transcription complex subunit7       159   1e-44   Lichtheimia ramosa
gb|ADE10053.1|  CAF1 superfamily protein                                156   2e-44   Tremella fuciformis
gb|ABK21469.1|  unknown                                                 158   4e-44   Picea sitchensis
ref|XP_004354599.1|  CAF1 family protein                                162   4e-44   Cavenderia fasciculata
ref|XP_008796886.1|  PREDICTED: probable CCR4-associated factor 1...    159   4e-44   Phoenix dactylifera
emb|CDS11386.1|  Putative CCR4-NOT transcription complex subunit7       158   4e-44   Lichtheimia ramosa
ref|XP_007509231.1|  Caf1 CCR4-associated (transcription) factor 1      159   5e-44   Bathycoccus prasinos
emb|CEI89573.1|  Putative CCR4-NOT transcription complex subunit 7      158   6e-44   Rhizopus microsporus
emb|CDH53595.1|  caf1 family protein                                    159   7e-44   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEG62914.1|  Putative CCR4-NOT transcription complex subunit 7      159   7e-44   Rhizopus microsporus
ref|XP_009395283.1|  PREDICTED: probable CCR4-associated factor 1...    158   9e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010459127.1|  PREDICTED: probable CCR4-associated factor 1...    158   1e-43   Camelina sativa [gold-of-pleasure]
emb|CEP13830.1|  hypothetical protein                                   159   1e-43   Parasitella parasitica
gb|EPB85653.1|  CCR4-NOT transcription complex subunit 7                157   2e-43   Mucor circinelloides f. circinelloides 1006PhL
emb|CDH54244.1|  ccr4-not transcription complex subunit 7               158   2e-43   Lichtheimia corymbifera JMRC:FSU:9682
ref|NP_001140241.1|  uncharacterized protein LOC100272282               157   2e-43   Zea mays [maize]
gb|KIY68330.1|  CAF1-domain-containing protein                          158   3e-43   Cylindrobasidium torrendii FP15055 ss-10
gb|KDP38660.1|  hypothetical protein JCGZ_04013                         156   4e-43   Jatropha curcas
ref|XP_002444415.1|  hypothetical protein SORBIDRAFT_07g021610          157   4e-43   Sorghum bicolor [broomcorn]
ref|XP_009395282.1|  PREDICTED: probable CCR4-associated factor 1...    156   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001131670.1|  uncharacterized protein LOC100193030               156   4e-43   Zea mays [maize]
gb|ACL52816.1|  unknown                                                 156   4e-43   Zea mays [maize]
ref|XP_007877414.1|  hypothetical protein PFL1_01713                    157   5e-43   Anthracocystis flocculosa PF-1
ref|XP_009396102.1|  PREDICTED: probable CCR4-associated factor 1...    156   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT16865.1|  transcription complex                                   156   7e-43   Saccharum hybrid cultivar R570
ref|XP_009266106.1|  CCR4-NOT transcription complex subunit 7           156   8e-43   Wallemia ichthyophaga EXF-994
ref|XP_010262944.1|  PREDICTED: probable CCR4-associated factor 1...    155   9e-43   Nelumbo nucifera [Indian lotus]
ref|XP_003574542.1|  PREDICTED: probable CCR4-associated factor 1...    156   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_011006693.1|  PREDICTED: probable CCR4-associated factor 1...    155   2e-42   Populus euphratica
dbj|GAN07390.1|  CCR4 associated factor                                 155   2e-42   Mucor ambiguus
ref|XP_011006712.1|  PREDICTED: probable CCR4-associated factor 1...    155   2e-42   Populus euphratica
ref|XP_638651.1|  CAF1 family protein                                   157   2e-42   Dictyostelium discoideum AX4
gb|EFA83975.1|  CAF1 family protein                                     161   3e-42   Heterostelium album PN500
ref|XP_006956137.1|  ribonuclease CAF1                                  153   3e-42   Wallemia mellicola CBS 633.66
ref|XP_004497679.1|  PREDICTED: probable CCR4-associated factor 1...    154   4e-42   
ref|XP_009418496.1|  PREDICTED: probable CCR4-associated factor 1...    154   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007271716.1|  CAF1-domain-containing protein                     156   4e-42   Fomitiporia mediterranea MF3/22
ref|XP_010927524.1|  PREDICTED: probable CCR4-associated factor 1...    153   7e-42   Elaeis guineensis
gb|KJB06631.1|  hypothetical protein B456_001G037000                    152   9e-42   Gossypium raimondii
gb|KFH71636.1|  hypothetical protein MVEG_01932                         154   1e-41   Mortierella verticillata NRRL 6337
gb|ETS62597.1|  hypothetical protein PaG_03234                          154   1e-41   Moesziomyces aphidis DSM 70725
dbj|GAK65069.1|  ribonuclease CAF1                                      154   1e-41   Moesziomyces antarcticus
gb|AGV54478.1|  CCR4-associated factor 1-like protein 11                153   1e-41   Phaseolus vulgaris [French bean]
ref|XP_006680570.1|  hypothetical protein BATDEDRAFT_90073              152   1e-41   Batrachochytrium dendrobatidis JAM81
ref|XP_010246433.1|  PREDICTED: probable CCR4-associated factor 1...    152   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008779663.1|  PREDICTED: probable CCR4-associated factor 1...    152   2e-41   Phoenix dactylifera
gb|ESA18671.1|  hypothetical protein GLOINDRAFT_75970                   151   2e-41   
gb|KDP36143.1|  hypothetical protein JCGZ_08787                         152   2e-41   Jatropha curcas
emb|CBQ71168.1|  probable CCR4-NOT transcription complex, subunit 7     153   2e-41   Sporisorium reilianum SRZ2
ref|XP_008548219.1|  PREDICTED: CCR4-NOT transcription complex su...    152   3e-41   Microplitis demolitor
gb|KDN37229.1|  CAF1-domain-containing protein                          154   3e-41   Tilletiaria anomala UBC 951
emb|CCF48047.1|  probable CCR4-NOT transcription complex, subunit 7     152   3e-41   Ustilago hordei
ref|XP_008548220.1|  PREDICTED: CCR4-NOT transcription complex su...    152   3e-41   Microplitis demolitor
ref|XP_008548221.1|  PREDICTED: CCR4-NOT transcription complex su...    151   4e-41   Microplitis demolitor
ref|XP_006854720.1|  hypothetical protein AMTR_s00030p00236940          151   4e-41   
ref|XP_006384784.1|  CCR4-NOT transcription complex family protein      151   4e-41   Populus trichocarpa [western balsam poplar]
ref|XP_003554457.1|  PREDICTED: probable CCR4-associated factor 1...    151   5e-41   Glycine max [soybeans]
ref|XP_006361099.1|  PREDICTED: probable CCR4-associated factor 1...    150   6e-41   Solanum tuberosum [potatoes]
ref|XP_004337732.1|  ccr4associated factor, putative                    150   7e-41   Acanthamoeba castellanii str. Neff
gb|EKG06977.1|  CCR4 associated factor, putative                        152   7e-41   
gb|KIL59216.1|  hypothetical protein M378DRAFT_169624                   152   7e-41   
ref|XP_007346111.1|  CAF1-domain-containing protein                     152   8e-41   
gb|KDP27391.1|  hypothetical protein JCGZ_20215                         150   9e-41   
gb|KJB35417.1|  hypothetical protein B456_006G114000                    150   1e-40   
dbj|GAM18889.1|  hypothetical protein SAMD00019534_020640               152   1e-40   
gb|EXX67656.1|  Pop2p                                                   153   1e-40   
ref|XP_003521484.1|  PREDICTED: probable CCR4-associated factor 1...    150   1e-40   
ref|XP_812690.1|  CCR4 associated factor                                152   1e-40   
ref|XP_007027917.1|  Polynucleotidyl transferase                        150   1e-40   
ref|XP_007162950.1|  hypothetical protein PHAVU_001G193900g             150   1e-40   
ref|XP_011388715.1|  putative CCR4-NOT core exoribonuclease subun...    151   1e-40   
ref|XP_006659446.1|  PREDICTED: probable CCR4-associated factor 1...    150   1e-40   
ref|XP_003283707.1|  hypothetical protein DICPUDRAFT_20033              150   2e-40   
ref|XP_009372560.1|  PREDICTED: probable CCR4-associated factor 1...    150   2e-40   
gb|KIJ62736.1|  hypothetical protein HYDPIDRAFT_176502                  151   2e-40   
ref|XP_007370165.1|  CAF1-domain-containing protein                     152   2e-40   
ref|XP_010045176.1|  PREDICTED: probable CCR4-associated factor 1...    150   2e-40   
ref|XP_008387054.1|  PREDICTED: probable CCR4-associated factor 1...    149   2e-40   
gb|KIK97075.1|  hypothetical protein PAXRUDRAFT_825323                  151   3e-40   
gb|KIJ17908.1|  hypothetical protein PAXINDRAFT_111622                  151   3e-40   
ref|XP_003540260.1|  PREDICTED: probable CCR4-associated factor 1...    150   3e-40   
gb|KIM89183.1|  hypothetical protein PILCRDRAFT_813097                  150   4e-40   
gb|EST05943.1|  CCR4-NOT transcription complex, subunit 7               150   4e-40   
ref|XP_011299712.1|  PREDICTED: CCR4-NOT transcription complex su...    149   4e-40   
ref|XP_002473783.1|  predicted protein                                  147   4e-40   
emb|CDI55400.1|  probable CCR4-NOT transcription complex, subunit 7     149   5e-40   
ref|XP_816565.1|  CCR4 associated factor                                151   6e-40   
emb|CAN81811.1|  hypothetical protein VITISV_020892                     145   6e-40   
ref|XP_006568301.1|  PREDICTED: CCR4-NOT transcription complex su...    149   6e-40   
ref|XP_011299715.1|  PREDICTED: CCR4-NOT transcription complex su...    148   6e-40   
ref|XP_003396031.1|  PREDICTED: CCR4-NOT transcription complex su...    149   6e-40   
gb|EKF39493.1|  CCR4 associated factor, putative                        149   7e-40   
gb|KIK57152.1|  hypothetical protein GYMLUDRAFT_762307                  150   7e-40   
ref|XP_845183.1|  CCR4 associated factor                                150   7e-40   
ref|XP_006568302.1|  PREDICTED: CCR4-NOT transcription complex su...    148   7e-40   
ref|XP_009604779.1|  PREDICTED: probable CCR4-associated factor 1...    148   7e-40   
ref|XP_011501465.1|  PREDICTED: CCR4-NOT transcription complex su...    149   8e-40   
ref|XP_006854719.1|  hypothetical protein AMTR_s00030p00236350          148   8e-40   
gb|KDQ62591.1|  hypothetical protein JAAARDRAFT_171083                  149   9e-40   
ref|XP_011501464.1|  PREDICTED: CCR4-NOT transcription complex su...    149   9e-40   
ref|XP_003424661.1|  PREDICTED: CCR4-NOT transcription complex su...    148   9e-40   
ref|XP_007379942.1|  ribonuclease CAF1                                  147   9e-40   
ref|XP_003693870.1|  PREDICTED: CCR4-NOT transcription complex su...    149   1e-39   
gb|KDP38659.1|  hypothetical protein JCGZ_04012                         147   1e-39   
ref|XP_001601395.1|  PREDICTED: CCR4-NOT transcription complex su...    148   1e-39   
ref|XP_011299716.1|  PREDICTED: CCR4-NOT transcription complex su...    148   1e-39   
ref|XP_011299711.1|  PREDICTED: CCR4-NOT transcription complex su...    149   1e-39   
ref|XP_008206873.1|  PREDICTED: CCR4-NOT transcription complex su...    148   1e-39   
gb|KDQ25533.1|  hypothetical protein PLEOSDRAFT_51869                   148   1e-39   
ref|XP_003491312.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    149   1e-39   
ref|XP_009315491.1|  CCR4 associated factor                             149   1e-39   
gb|EMD40070.1|  hypothetical protein CERSUDRAFT_112283                  149   1e-39   
gb|KIR59674.1|  CCR4-NOT transcription complex subunit 7/8              147   1e-39   
ref|XP_011337289.1|  PREDICTED: CCR4-NOT transcription complex su...    148   1e-39   
ref|XP_011261446.1|  PREDICTED: CCR4-NOT transcription complex su...    148   1e-39   
ref|XP_568004.1|  ccr4-not transcription complex, subunit 7             147   1e-39   
gb|AFR94436.2|  CCR4-NOT transcription complex subunit 7/8              148   1e-39   
gb|KIR85314.1|  CCR4-NOT transcription complex subunit 7/8              147   1e-39   
ref|XP_003424663.1|  PREDICTED: CCR4-NOT transcription complex su...    149   1e-39   
gb|KGB78687.1|  ccr4-not transcription complex                          148   1e-39   
gb|KIR46241.1|  CCR4-NOT transcription complex subunit 7/8              147   1e-39   
gb|EGI59892.1|  CCR4-NOT transcription complex subunit 7                147   1e-39   
gb|EFN64855.1|  CCR4-NOT transcription complex subunit 7                147   1e-39   
gb|ACU19702.1|  unknown                                                 148   2e-39   
ref|XP_007319405.1|  hypothetical protein SERLADRAFT_449989             149   2e-39   
emb|CCC90786.1|  putative CCR4 associated factor                        149   2e-39   
ref|XP_009385031.1|  PREDICTED: probable CCR4-associated factor 1...    147   2e-39   
ref|XP_007015724.1|  Polynucleotidyl transferase, ribonuclease H-...    147   2e-39   
ref|XP_004251085.1|  PREDICTED: probable CCR4-associated factor 1...    147   2e-39   
ref|XP_008206772.1|  PREDICTED: CCR4-NOT transcription complex su...    148   2e-39   
ref|XP_007304643.1|  CAF1-domain-containing protein                     149   2e-39   
ref|XP_003193445.1|  ccr4-not transcription complex, subunit 7          147   2e-39   
gb|ABY89387.1|  chromatin assembly factor 1                             144   2e-39   
ref|XP_005707256.1|  CCR4-NOT transcription complex subunit 7/8         147   2e-39   
ref|XP_003539842.1|  PREDICTED: probable CCR4-associated factor 1...    147   2e-39   
ref|XP_001957405.1|  GF10398                                            147   2e-39   
ref|XP_001985184.1|  GH16922                                            148   2e-39   
emb|CCC48219.1|  putative CCR4 associated factor                        148   2e-39   
ref|XP_011160727.1|  PREDICTED: CCR4-NOT transcription complex su...    147   3e-39   
ref|XP_011179611.1|  PREDICTED: CCR4-NOT transcription complex su...    147   3e-39   
ref|XP_008037531.1|  CAF1-domain-containing protein                     148   3e-39   
ref|XP_008391953.1|  PREDICTED: probable CCR4-associated factor 1...    146   3e-39   
ref|XP_002084588.1|  GD12753                                            142   3e-39   
ref|XP_011200256.1|  PREDICTED: CCR4-NOT transcription complex su...    147   3e-39   
gb|KFH15232.1|  ccr4-associated factor family protein                   151   3e-39   
gb|KFH10767.1|  ccr4-associated factor family protein                   151   3e-39   
gb|KFG65290.1|  ccr4-associated factor family protein                   151   3e-39   
ref|XP_002365197.1|  CCR4-NOT transcription complex subunit, puta...    151   3e-39   
gb|ESS32038.1|  ccr4-associated factor family protein                   151   3e-39   
gb|EPR62786.1|  ccr4-associated factor family protein                   151   3e-39   
ref|XP_008883021.1|  ccr4-associated factor family protein              151   3e-39   
ref|XP_005182888.1|  PREDICTED: CCR4-NOT transcription complex su...    147   4e-39   
ref|XP_011179602.1|  PREDICTED: CCR4-NOT transcription complex su...    147   4e-39   
ref|XP_004522122.1|  PREDICTED: CCR4-NOT transcription complex su...    147   4e-39   
emb|CDI80060.1|  CCR4-NOT transcription complex subunit, putative       151   4e-39   
gb|KII86661.1|  hypothetical protein PLICRDRAFT_43301                   147   4e-39   
ref|XP_011200255.1|  PREDICTED: CCR4-NOT transcription complex su...    147   4e-39   
ref|XP_011160728.1|  PREDICTED: CCR4-NOT transcription complex su...    146   4e-39   
ref|XP_005182887.1|  PREDICTED: CCR4-NOT transcription complex su...    147   4e-39   
ref|XP_009349767.1|  PREDICTED: probable CCR4-associated factor 1...    146   4e-39   
ref|XP_011179593.1|  PREDICTED: CCR4-NOT transcription complex su...    147   5e-39   
ref|XP_004522121.1|  PREDICTED: CCR4-NOT transcription complex su...    147   5e-39   
ref|XP_005182886.1|  PREDICTED: CCR4-NOT transcription complex su...    147   5e-39   
ref|XP_011135448.1|  PREDICTED: CCR4-NOT transcription complex su...    146   5e-39   
ref|XP_011200254.1|  PREDICTED: CCR4-NOT transcription complex su...    147   6e-39   
emb|CCW66350.1|  unnamed protein product                                147   6e-39   
gb|AFK45276.1|  unknown                                                 144   6e-39   
ref|XP_011043248.1|  PREDICTED: probable CCR4-associated factor 1...    145   6e-39   
ref|XP_001972481.1|  GG13860                                            146   6e-39   
emb|CCW62005.1|  unnamed protein product                                147   6e-39   
ref|XP_010104797.1|  putative CCR4-associated factor 1-9-like pro...    146   6e-39   
ref|XP_002048516.1|  GJ14014                                            147   6e-39   
ref|XP_004522120.1|  PREDICTED: CCR4-NOT transcription complex su...    146   7e-39   
ref|XP_002024844.1|  GL17886                                            146   7e-39   
ref|XP_004241342.1|  PREDICTED: probable CCR4-associated factor 1...    145   7e-39   
ref|XP_002008770.1|  GI13677                                            146   8e-39   
ref|XP_003882920.1|  CCR4-NOT transcription complex,subunit 7-lik...    150   8e-39   
ref|XP_007008156.1|  hypothetical protein TREMEDRAFT_65998              145   8e-39   
emb|CCM05935.1|  predicted protein                                      147   8e-39   
gb|KIO05987.1|  hypothetical protein M404DRAFT_139412                   147   8e-39   
ref|XP_003703401.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    147   8e-39   
ref|XP_002523862.1|  ccr4-associated factor, putative                   145   9e-39   
ref|XP_002061857.1|  GK17222                                            145   9e-39   
emb|CBN76829.1|  conserved unknown protein                              148   1e-38   
emb|CEL51770.1|  CCR4-NOT transcription complex subunit 7 OS=Xeno...    147   1e-38   
dbj|GAA97487.1|  hypothetical protein E5Q_04165                         145   1e-38   
gb|EJT98783.1|  CCR4-NOT transcription complex subunit 7                146   1e-38   
ref|XP_006379358.1|  hypothetical protein POPTR_0009s16310g             145   1e-38   
ref|XP_001836043.2|  hypothetical protein CC1G_05036                    147   1e-38   
gb|KIP02893.1|  hypothetical protein PHLGIDRAFT_20367                   146   1e-38   
gb|EPS94721.1|  hypothetical protein FOMPIDRAFT_1026077                 146   2e-38   
gb|EMS21915.1|  CCR4-NOT transcription complex subunit 7/8              145   2e-38   
gb|ACO14594.1|  CCR4-NOT transcription complex subunit 7                146   2e-38   
ref|XP_007844903.1|  ccr4-not transcription complex subunit 7           146   2e-38   
ref|XP_004494232.1|  PREDICTED: probable CCR4-associated factor 1...    145   2e-38   
gb|KJB46419.1|  hypothetical protein B456_007G366900                    144   2e-38   
ref|NP_197617.1|  CCR4-associated factor 1B                             144   2e-38   
ref|XP_002271636.1|  PREDICTED: probable CCR4-associated factor 1...    144   2e-38   
ref|XP_002309398.1|  hypothetical protein POPTR_0006s22200g             144   3e-38   
ref|XP_008243475.1|  PREDICTED: probable CCR4-associated factor 1...    144   3e-38   
ref|XP_002389628.1|  hypothetical protein MPER_11217                    145   3e-38   
gb|AGG11686.1|  hypothetical protein                                    145   3e-38   
gb|AAN71585.1|  RH46192p                                                144   3e-38   
ref|NP_729775.1|  Pop2, isoform B                                       144   3e-38   
dbj|GAC74710.1|  mRNA deadenylase subunit                               141   3e-38   
gb|KHN82287.1|  CCR4-NOT transcription complex subunit 7                144   3e-38   
ref|NP_648538.1|  Pop2, isoform A                                       144   3e-38   
ref|XP_003033973.1|  hypothetical protein SCHCODRAFT_66866              145   3e-38   
ref|XP_002323399.1|  hypothetical protein POPTR_0016s07390g             144   3e-38   
emb|CDY35049.1|  BnaA06g10590D                                          143   4e-38   
ref|XP_011044042.1|  PREDICTED: probable CCR4-associated factor 1...    144   4e-38   
gb|KJB09109.1|  hypothetical protein B456_001G123600                    143   4e-38   
gb|EYU36042.1|  hypothetical protein MIMGU_mgv1a011524mg                143   4e-38   
gb|KDE04055.1|  hypothetical protein MVLG_05494                         145   4e-38   
ref|XP_009149028.1|  PREDICTED: probable CCR4-associated factor 1...    143   5e-38   
gb|EGU13456.1|  hypothetical protein RTG_00172                          150   5e-38   
ref|NP_001163429.1|  Pop2, isoform D                                    145   5e-38   
ref|XP_009802120.1|  PREDICTED: probable CCR4-associated factor 1...    143   5e-38   
ref|XP_009349269.1|  PREDICTED: probable CCR4-associated factor 1...    143   5e-38   
gb|AGG11497.1|  hypothetical protein                                    145   5e-38   
ref|NP_001287041.1|  Pop2, isoform E                                    145   6e-38   
gb|KDR17086.1|  CCR4-NOT transcription complex subunit 7                145   6e-38   
ref|XP_007202414.1|  hypothetical protein PRUPE_ppa009651mg             143   6e-38   
gb|KJB21739.1|  hypothetical protein B456_004G011500                    143   6e-38   
ref|XP_006400731.1|  hypothetical protein EUTSA_v10014297mg             143   7e-38   
ref|XP_006362860.1|  PREDICTED: probable CCR4-associated factor 1...    143   7e-38   
ref|XP_009545789.1|  Caf1 family RNase                                  144   7e-38   
ref|NP_588385.2|  CCR4-Not complex CAF1 family ribonuclease subun...    144   7e-38   
gb|KIK44361.1|  hypothetical protein CY34DRAFT_636777                   144   7e-38   
pdb|2P51|A  Chain A, Crystal Structure Of The S. Pombe Pop2p Dead...    144   8e-38   
gb|EPX73589.1|  CCR4-Not complex CAF1 family ribonulcease subunit...    144   9e-38   
ref|XP_011122519.1|  hypothetical protein AOL_s00079g342                146   1e-37   
ref|XP_007768705.1|  CAF1-domain-containing protein                     144   1e-37   
ref|XP_004140166.1|  PREDICTED: probable CCR4-associated factor 1...    142   1e-37   
ref|XP_001465663.1|  putative CCR4 associated factor                    144   1e-37   
gb|EPZ33260.1|  CCR4-NOT transcription complex subunit 7                142   1e-37   
ref|XP_001683314.1|  putative CCR4 associated factor                    144   1e-37   
ref|XP_007870377.1|  ribonuclease CAF1                                  142   1e-37   
gb|KIK26635.1|  hypothetical protein PISMIDRAFT_675520                  144   1e-37   
emb|CDY33367.1|  BnaC05g12160D                                          145   2e-37   
ref|XP_001565071.1|  putative CCR4 associated factor                    143   2e-37   
gb|ENN73721.1|  hypothetical protein YQE_09671                          142   2e-37   
ref|NP_190012.1|  putative CCR4-associated factor 1                     142   2e-37   
gb|ERL90972.1|  hypothetical protein D910_08314                         142   2e-37   
gb|AEE62054.1|  unknown                                                 142   2e-37   
ref|XP_010699154.1|  CCR4 associated factor, putative                   143   2e-37   
ref|XP_009123303.1|  PREDICTED: probable CCR4-associated factor 1...    141   2e-37   
gb|KGO77996.1|  Ribonuclease CAF1                                       145   2e-37   
emb|CDJ38010.1|  CCR4-NOT transcription complex subunit, putative       145   3e-37   
emb|CDY47299.1|  BnaA06g38950D                                          141   3e-37   
ref|XP_009369921.1|  PREDICTED: probable CCR4-associated factor 1...    141   3e-37   
emb|CDJ69320.1|  CCR4-NOT transcription complex subunit, putative       145   3e-37   
gb|EPY32963.1|  CCR4-NOT transcription complex subunit 7/8              142   3e-37   
gb|KJA27905.1|  hypothetical protein HYPSUDRAFT_157307                  142   3e-37   
dbj|BAM20457.1|  ccr4-associated factor                                 142   3e-37   
ref|XP_006292804.1|  hypothetical protein CARUB_v10019055mg             141   3e-37   
emb|CAN76920.1|  hypothetical protein VITISV_015622                     141   3e-37   
ref|XP_011113614.1|  hypothetical protein H072_7886                     144   3e-37   
ref|XP_003328623.1|  hypothetical protein PGTG_10582                    143   3e-37   
ref|XP_010525704.1|  PREDICTED: probable CCR4-associated factor 1...    141   4e-37   
ref|XP_007329866.1|  hypothetical protein AGABI1DRAFT_113727            142   4e-37   
gb|ABP35526.1|  CCR4-associated factor                                  141   4e-37   
ref|XP_004927882.1|  PREDICTED: CCR4-NOT transcription complex su...    141   4e-37   
gb|EPY20598.1|  CCR4-NOT transcription complex subunit 7/8              142   4e-37   
gb|EJT45179.1|  ccr4-not transcription complex, subunit 7               142   4e-37   
ref|XP_003635867.1|  CCR4-associated factor                             144   4e-37   
ref|XP_011088949.1|  PREDICTED: probable CCR4-associated factor 1...    141   4e-37   
gb|EGN98053.1|  hypothetical protein SERLA73DRAFT_169136                142   5e-37   
gb|KFK33873.1|  hypothetical protein AALP_AA5G071300                    140   5e-37   
ref|XP_002838769.1|  hypothetical protein                               144   5e-37   
ref|XP_975202.1|  PREDICTED: CCR4-NOT transcription complex subun...    141   5e-37   
gb|EYU28523.1|  hypothetical protein MIMGU_mgv1a011187mg                141   5e-37   
emb|CDY08688.1|  BnaC03g54940D                                          140   5e-37   
ref|XP_007412211.1|  hypothetical protein MELLADRAFT_72372              142   5e-37   
gb|EHJ70264.1|  hypothetical protein KGM_18080                          141   6e-37   
gb|EPY51232.1|  CCR4-Not complex CAF1 family ribonulcease subunit...    142   6e-37   
ref|XP_008342289.1|  PREDICTED: probable CCR4-associated factor 1...    142   6e-37   
ref|XP_002433119.1|  CCR4-NOT transcription complex subunit, puta...    142   7e-37   
ref|XP_007205684.1|  hypothetical protein PRUPE_ppa009650mg             140   7e-37   
gb|EKV12152.1|  CCR4-NOT core complex subunit Caf1, putative            144   7e-37   



>ref|XP_002272165.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010655010.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=274

 Score =   246 bits (628),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSIQIREVW+ NLEEEF LIR +VD++PFIAMDTEFPGIVLRPVGNFKNSNDY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIRGIVDEFPFIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQ+GLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQMGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF KN
Sbjct  121  LRQSGIDFMKN  131



>ref|XP_011082241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=272

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSIQIREVW  NL+EEF LIRE+VDDYP+IAMDTEFPG+VLRPVGNFKNS+D+
Sbjct  1    MSLLPKSDSIQIREVWADNLDEEFALIREIVDDYPYIAMDTEFPGVVLRPVGNFKNSSDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPDCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF +N
Sbjct  121  LRQSGIDFARN  131



>ref|XP_006356242.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=273

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSI IREVW+ NLEEEFDLIRE+VDDYPFIAMDTEFPG+VLRPVGNFKNSNDY
Sbjct  1    MSLLPKSDSIHIREVWNDNLEEEFDLIREIVDDYPFIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_004241682.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Solanum 
lycopersicum]
Length=274

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSI IREVW  NLEEEFDLIREVVDDYPFIAMDTEFPG+VLRPVGNFKNSNDY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEEEFDLIREVVDDYPFIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEDGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>gb|EYU24608.1| hypothetical protein MIMGU_mgv1a011718mg [Erythranthe guttata]
Length=272

 Score =   243 bits (621),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSIQIR+VW  NLEEEF+LIRE+VD YP+IAMDTEFPG+VLRPVG FKNS+DY
Sbjct  1    MSLLPKSDSIQIRDVWADNLEEEFELIREIVDAYPYIAMDTEFPGVVLRPVGTFKNSSDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNLNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF KN
Sbjct  121  LRQSGIDFAKN  131



>gb|KJB68026.1| hypothetical protein B456_010G222500 [Gossypium raimondii]
Length=274

 Score =   243 bits (621),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSI IREVWD N+EEEF LIRE+VDDYP++AMDTEFPGIVLRPVG FK+S DY
Sbjct  1    MSLLPKSDSIHIREVWDDNVEEEFALIREIVDDYPYVAMDTEFPGIVLRPVGYFKSSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKL+QLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLVQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>gb|KJB66334.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66335.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66336.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
Length=271

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK+S DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKSSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNF EF+ +EDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFCEFNVDEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_002527306.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF35058.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLL K DSIQIREVW+ NLEEEF LIRE+VD+Y +IAMDTEFPGIVLRPVGNFKNSN+Y
Sbjct  1    MSLLLKGDSIQIREVWNDNLEEEFSLIREIVDEYSYIAMDTEFPGIVLRPVGNFKNSNEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_009760590.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=275

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSI IREVW  NLE+EFDLIRE+VD+YP+IAMDTEFPG+VLRPVGNFKNSNDY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEQEFDLIREIVDEYPYIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_009605547.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
tomentosiformis]
Length=275

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK+DSI IREVW  NLEEEF LIREVVD++P+IAMDTEFPG+V+RPVGNFKNS DY
Sbjct  1    MSILPKTDSIHIREVWIDNLEEEFALIREVVDEFPYIAMDTEFPGVVIRPVGNFKNSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF KN
Sbjct  121  LRQSGIDFTKN  131



>ref|XP_006341359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   241 bits (616),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK+DSI IREVW  NLEEEF L+RE+VDD+PF+AMDTEFPG+V+RPVGNFKNSNDY
Sbjct  1    MSILPKTDSIHIREVWFDNLEEEFALMREIVDDFPFVAMDTEFPGVVIRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+ N
Sbjct  121  LRQSGIDFKMN  131



>gb|KDP41983.1| hypothetical protein JCGZ_27001 [Jatropha curcas]
Length=274

 Score =   241 bits (616),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLL K DSIQIREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNSNDY
Sbjct  1    MSLLLKGDSIQIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLK+IQLGLTFSDE+GNLPTCGT K+CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKMIQLGLTFSDEQGNLPTCGTGKFCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_004235935.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   241 bits (616),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK+DSI IREVW  NLEEEF L+RE+VDD+PF+AMDTEFPG+V+RPVGNFKNSNDY
Sbjct  1    MSILPKTDSIHIREVWFDNLEEEFALMREIVDDFPFVAMDTEFPGVVIRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+ N
Sbjct  121  LRQSGIDFKMN  131



>ref|XP_011020623.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK DSI IREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNSNDY
Sbjct  1    MSLLPKGDSIHIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSD++GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GID  KN
Sbjct  121  LRQSGIDLNKN  131



>ref|XP_002303842.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 ref|XP_006385927.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
 gb|EEE78821.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 gb|ERP63724.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
Length=274

 Score =   241 bits (614),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK DSI IREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNSNDY
Sbjct  1    MSLLPKGDSIHIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSD++GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GID  KN
Sbjct  121  LRQSGIDLNKN  131



>ref|XP_007023407.1| CCR4-associated factor 1 [Theobroma cacao]
 gb|EOY26029.1| CCR4-associated factor 1 [Theobroma cacao]
Length=356

 Score =   243 bits (621),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK DSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFKNS DY
Sbjct  1    MSLLPKGDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKNSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTC TDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCATDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_007023408.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007023409.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26030.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26031.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYPF+AMDTEFPGIVLRPVGNFKNS D+
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPFVAMDTEFPGIVLRPVGNFKNSYDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLT SD++GNLPTCGTDKYCIWQFNF EF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTLSDDQGNLPTCGTDKYCIWQFNFCEFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>gb|KHG18085.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=300

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSI IREVWD N+EEEF LIR++VDDYP++AMDTEFPGIVLRPVG FK+S DY
Sbjct  27   MSLLPKSDSIHIREVWDDNVEEEFALIRDIVDDYPYVAMDTEFPGIVLRPVGYFKSSYDY  86

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKL+QLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  87   HYQTLKDNVDMLKLVQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  146

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  147  LRQSGIDFKKN  157



>ref|XP_011034532.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLL K DSI IREVW+ NLEEEF  IRE+VDD+P+IAMDTEFPGIVLRPVGNFKNSNDY
Sbjct  1    MSLLLKGDSILIREVWNDNLEEEFAHIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNLNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_010275748.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPKSDSI IREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK S+DY
Sbjct  1    MSILPKSDSIHIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKTSSDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLK NVD+LKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREF+ +EDVFA+DSIEL
Sbjct  61   HYQTLKANVDLLKLIQLGLTFSDEAGNLPTCGTDKYCVWQFNFREFNVSEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_007215794.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
 gb|EMJ16993.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
Length=274

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M LLPK DSIQIREVW+ N EEEF LIR++VDDYP++AMDTEFPGIVLRPVGNFKNS DY
Sbjct  1    MKLLPKPDSIQIREVWNDNFEEEFALIRKIVDDYPYVAMDTEFPGIVLRPVGNFKNSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDK+CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKHCIWQFNFREFNLNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_009793121.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
sylvestris]
Length=275

 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK++SI IREVW  NLEEEF LIREVVD++P+IAMDTEFPG+V+RPVGNFKNS DY
Sbjct  1    MSILPKTESILIREVWIDNLEEEFALIREVVDEFPYIAMDTEFPGVVIRPVGNFKNSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF KN
Sbjct  121  LRQSGIDFTKN  131



>ref|XP_007023405.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY26027.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=194

 Score =   236 bits (601),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFK   DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKYICDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_011073341.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Sesamum 
indicum]
Length=270

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDS+QIREVW  NL+EEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKN+NDY
Sbjct  1    MSLLPKSDSVQIREVWAGNLDEEFALIREIVDEYPYIAMDTEFPGIVLRPVGNFKNANDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLK+NV++LKLIQLGLTFSDEKGNLPTCGTDK+CIWQFNFREF+P+EDVFA+DSIEL
Sbjct  61   HYQTLKENVNLLKLIQLGLTFSDEKGNLPTCGTDKFCIWQFNFREFNPDEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GID  +N
Sbjct  121  LSQSGIDLVRN  131



>ref|XP_007023403.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26025.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFK   DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKYICDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_008228784.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228785.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228786.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
Length=274

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M LLPK DSIQIREVW+ N EEEF LIR+++DDYP++AMDTEFPGIVLRPVGNFKN+ DY
Sbjct  1    MKLLPKPDSIQIREVWNDNFEEEFALIRKIIDDYPYVAMDTEFPGIVLRPVGNFKNNYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDK+CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKHCIWQFNFREFNLNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_009594641.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=275

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKSDSI IREVW  NLE+EFDLIRE+VD+YP+IAMDTEFPG+VLRPVGNFKNSNDY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEQEFDLIREIVDEYPYIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKY IWQFNF +F+PNEDV+A+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYYIWQFNFCDFNPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_011082251.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=276

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLL K DSIQIREVW  NL+EEF LI+E+VDDYP+IAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLAKGDSIQIREVWADNLDEEFALIKEIVDDYPYIAMDTEFPGVVLRPVGNFKNSSDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLPTCGT+K CIWQFNF EF+PNEDVFA+DS+EL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPTCGTNKQCIWQFNFCEFNPNEDVFANDSVEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF KN
Sbjct  121  LRQSGIDFVKN  131



>gb|KJB07590.1| hypothetical protein B456_001G031500 [Gossypium raimondii]
Length=274

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPKS+SI IREVWD NL  EF+LIRE+VDDYPFIAMDTEFPGIVLRP+GNFK+S DY
Sbjct  1    MSILPKSESIHIREVWDENLNCEFELIREIVDDYPFIAMDTEFPGIVLRPIGNFKSSFDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLK NVD+LKLIQLGLTFSD KGNLPTCGTDKYC+WQFNFREFDPNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDAKGNLPTCGTDKYCVWQFNFREFDPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GIDF+KN
Sbjct  121  LSQSGIDFQKN  131



>ref|XP_010265638.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
 ref|XP_010265639.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+L K DSI IREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK S+DY
Sbjct  1    MSILSKGDSIHIREVWNDNLEEEFVLIREIVDDYPYIAMDTEFPGIVLRPVGNFKTSSDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREF+ +EDVFA+DSIEL
Sbjct  61   HYQTLKANVDMLKLIQLGLTFSDEAGNLPTCGTDKYCVWQFNFREFNVSEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LR+ GIDF+KN
Sbjct  121  LRESGIDFKKN  131



>gb|EPS71126.1| hypothetical protein M569_03633, partial [Genlisea aurea]
Length=268

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK+DSIQIREVW  NLE+EFDLIR +VD+YP+IAMDTEFPG+VLRP+GNFKNS+DY
Sbjct  1    MSLLPKTDSIQIREVWADNLEQEFDLIRGIVDEYPYIAMDTEFPGVVLRPIGNFKNSSDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVD+LKLIQLGLT SDEKGNLP+ GTDK CIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTLSDEKGNLPSFGTDKRCIWQFNFREFNPNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF  N
Sbjct  121  LRQSGIDFVMN  131



>ref|XP_003526204.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN NDY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESTCIWQFNFREFNISEDIFASDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN+
Sbjct  121  LRQCGIDFKKNS  132



>gb|KHN07034.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=274

 Score =   234 bits (596),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN NDY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESTCIWQFNFREFNISEDIFASDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN+
Sbjct  121  LRQCGIDFKKNS  132



>ref|XP_002515442.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF46891.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   234 bits (596),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS++PK DSI IREVW+ NLEEEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN NDY
Sbjct  1    MSIIPKGDSIHIREVWNDNLEEEFTLIREIVDQFNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>ref|XP_006427595.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 ref|XP_006427596.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40835.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40836.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
Length=274

 Score =   234 bits (596),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIEL
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GI+F KN
Sbjct  121  LKQSGINFTKN  131



>gb|KDO42998.1| hypothetical protein CISIN_1g023991mg [Citrus sinensis]
Length=274

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIEL
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GI+F KN
Sbjct  121  LKQSGINFTKN  131



>gb|KHG00404.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=274

 Score =   233 bits (595),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPKS+SI IREVWD NL  EF+LIR++VDDYPFIAMDTEFPGIVLRP+GNFK+S DY
Sbjct  1    MSILPKSESIHIREVWDENLNCEFELIRDIVDDYPFIAMDTEFPGIVLRPIGNFKSSFDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLK NVD+LKLIQLGLTFSD KGNLPTCGTDKYC+WQFNFREFDPNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDAKGNLPTCGTDKYCVWQFNFREFDPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GIDF+KN
Sbjct  121  LSQSGIDFQKN  131



>ref|XP_006465196.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
Length=274

 Score =   233 bits (595),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIEL
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GI+F KN
Sbjct  121  LKQSGINFTKN  131



>gb|KHN29617.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=265

 Score =   233 bits (594),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN NDY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESPCIWQFNFREFNVSEDIFASDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN+
Sbjct  121  LRQCGIDFKKNS  132



>ref|XP_003522433.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   233 bits (594),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN NDY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESPCIWQFNFREFNVSEDIFASDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN+
Sbjct  121  LRQCGIDFKKNS  132



>emb|CDO98220.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPKS+S+QIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRPVGNFK++ D+
Sbjct  1    MSLLPKSESVQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPVGNFKSNTDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLP CG D KYC WQFNFREF+PNEDVFA+DSIE
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPKCGVDNKYCTWQFNFREFNPNEDVFANDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ G DF KN
Sbjct  121  LLRQSGFDFAKN  132



>ref|XP_009354185.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=274

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M LLPK DSI IREVW+ NLEEEF LIR++VDDYP++AMDTEFPGIV+RPVGNFKNS DY
Sbjct  1    MPLLPKIDSIHIREVWNDNLEEEFALIRKIVDDYPYVAMDTEFPGIVIRPVGNFKNSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE+GN P+CGTDK CIWQFNFREF+ N+DVF+SDSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNFPSCGTDKQCIWQFNFREFNLNKDVFSSDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_008375521.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008375525.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M LLPK DSI IREVW+ NLEEEF LIR++VDDYP++AMDTEFPGIV+RPVGNFKN  DY
Sbjct  1    MPLLPKIDSIHIREVWNDNLEEEFALIRKIVDDYPYVAMDTEFPGIVIRPVGNFKNGYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE+GN P+CGTDK CIWQFNFREF+ NEDVF+SDSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNFPSCGTDKQCIWQFNFREFNLNEDVFSSDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>gb|EPS59819.1| hypothetical protein M569_14984, partial [Genlisea aurea]
Length=275

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS  P SDSIQIREVWD NLEEE  LIRE+VD YP+IAMDTEFPG+V+RPVGNFKN++DY
Sbjct  1    MSNFPDSDSIQIREVWDANLEEEMALIREIVDQYPYIAMDTEFPGVVIRPVGNFKNTDDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+P+ED FA+DS++L
Sbjct  61   NYQTLKDNVDLLKLIQLGLTFSDEHGNLPTCGTDKHCIWQFNFREFNPSEDAFAADSVQL  120

Query  556  LRQCGIDFEKNT  591
            LRQ GIDF  N+
Sbjct  121  LRQSGIDFAANS  132



>ref|XP_004305482.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   231 bits (589),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M LLPK+DSIQIREVW+ NL+EEF+LIR++VDDYP++AMDTEFPGIV RPVGNF+NS DY
Sbjct  1    MPLLPKNDSIQIREVWNDNLDEEFELIRKIVDDYPYVAMDTEFPGIVCRPVGNFRNSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTL+DNVD+LKLIQLGLTFSDE+GNLPTCGTD+ CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLRDNVDVLKLIQLGLTFSDEEGNLPTCGTDQQCIWQFNFREFNLNEDVFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_009801027.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
 ref|XP_009801028.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=274

 Score =   230 bits (587),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPKSDSIQIREVW  NLEEEF LIRE+VD YP+IAMDTEFPG+VLRPVGNFK+ N+Y
Sbjct  1    MSVLPKSDSIQIREVWSNNLEEEFALIREIVDAYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG+++YCIWQFNFREFD + D+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGSERYCIWQFNFREFDTSADIFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GIDF+KN
Sbjct  121  LMQSGIDFKKN  131



>gb|KDP33530.1| hypothetical protein JCGZ_07101 [Jatropha curcas]
Length=275

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            MS++PK+D SIQIREVW+ NLEEEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN ND
Sbjct  1    MSIIPKNDDSIQIREVWNDNLEEEFALIREIVDQFNYVAMDTEFPGVVLRPVGNFKNIND  60

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSIE
Sbjct  61   YNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQCGIDF+KN
Sbjct  121  LLRQCGIDFKKN  132



>ref|XP_010089956.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB38652.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=276

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 122/133 (92%), Gaps = 2/133 (2%)
 Frame = +1

Query  196  MSLLPKSD--SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSN  369
            MS+L K D  SIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFKN N
Sbjct  1    MSILTKGDGDSIQIREVWNDNLEEEFALIREIVDKYNYVAMDTEFPGVVLRPVGNFKNIN  60

Query  370  DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSI  549
            DY+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSI
Sbjct  61   DYNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSI  120

Query  550  ELLRQCGIDFEKN  588
            ELLRQCGIDF+KN
Sbjct  121  ELLRQCGIDFKKN  133



>ref|XP_010665982.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Beta 
vulgaris subsp. vulgaris]
Length=272

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
             + L    DSI IREVW++NLEEEF  IRE+VDDYP++AMD+EFPG+V+RPVGNFKN  D
Sbjct  2    SLGLTKSDDSIHIREVWNHNLEEEFGYIREIVDDYPYVAMDSEFPGVVIRPVGNFKNITD  61

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            Y+Y+TLK+NVDMLKLIQLGLTFSDEKGNLPTCGTDK+CIWQFNFREFD  EDV+ASDSIE
Sbjct  62   YNYKTLKENVDMLKLIQLGLTFSDEKGNLPTCGTDKFCIWQFNFREFDVGEDVYASDSIE  121

Query  553  LLRQCGIDFEKNT  591
            LL+QCGIDFEKN+
Sbjct  122  LLKQCGIDFEKNS  134



>ref|XP_007136961.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 ref|XP_007136962.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08955.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08956.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
Length=273

 Score =   228 bits (582),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS++PK DS+QIREVW+ NL+EEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN NDY
Sbjct  1    MSIIPKGDSVQIREVWNDNLDEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG++  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGSESPCIWQFNFREFNISEDIFASDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN+
Sbjct  121  LRQCGIDFKKNS  132



>gb|KHG16599.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=270

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS LPK +S+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN NDY
Sbjct  1    MSGLPKGESVHIREVWNDNLEEEFALIREIVDSYNYVAMDTEFPGVVLRPVGTFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD +CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSFCIWQFNFREFNLSEDIFASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>gb|KJB68416.1| hypothetical protein B456_010G244300 [Gossypium raimondii]
Length=274

 Score =   228 bits (581),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS LPK +S+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN NDY
Sbjct  1    MSGLPKGESVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGTFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD +CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSFCIWQFNFREFNLSEDIFASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>gb|EYU21723.1| hypothetical protein MIMGU_mgv1a019889mg [Erythranthe guttata]
Length=272

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 123/135 (91%), Gaps = 3/135 (2%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL+PKS+S+QIREVW +NL+EEFDLIRE+VD+YP+IAMDTEFPGIVLRPVG F+++NDY
Sbjct  1    MSLMPKSESVQIREVWAHNLDEEFDLIREIVDEYPYIAMDTEFPGIVLRPVGTFRSANDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC---GTDKYCIWQFNFREFDPNEDVFASDS  546
            HYQTLKDNV++LKLIQLGLTFSDE GNLP C   G +++CIWQFNFREFDPNEDVFA+DS
Sbjct  61   HYQTLKDNVNLLKLIQLGLTFSDENGNLPECSGAGKNRHCIWQFNFREFDPNEDVFANDS  120

Query  547  IELLRQCGIDFEKNT  591
            IELL + GID  +NT
Sbjct  121  IELLSRSGIDLARNT  135



>ref|XP_002324905.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
 gb|EEF03470.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
Length=277

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  208  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQT  387
            PK DSIQIREVW+ NLEEEF LIRE+VD +  +AMDTEFPG+VLRPVGNFKN +DY+YQT
Sbjct  8    PKEDSIQIREVWNDNLEEEFALIREIVDQFNHVAMDTEFPGVVLRPVGNFKNISDYNYQT  67

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED+FASDSIELLRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQC  127

Query  568  GIDFEKNT  591
            GIDF+KN+
Sbjct  128  GIDFKKNS  135



>ref|XP_009620266.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=274

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS LPKSDSIQIREVW  NLEEEF LIRE+VD YP+IAMDTEFPG+VLRPVGNFK+ N+Y
Sbjct  1    MSALPKSDSIQIREVWSDNLEEEFALIREIVDAYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLP CG+++YCIWQFNFREFD + D+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPICGSERYCIWQFNFREFDTSADIFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GIDF+KN
Sbjct  121  LMQSGIDFKKN  131



>ref|XP_011036659.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  208  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQT  387
            PK DSIQIREVW+ NLEEEF LIRE+VD +  +AMDTEFPG+VLRPVGNFKN +DY+YQT
Sbjct  8    PKEDSIQIREVWNDNLEEEFALIREIVDQFNHVAMDTEFPGVVLRPVGNFKNISDYNYQT  67

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED+FASDSIELLRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQC  127

Query  568  GIDFEKNT  591
            GIDF+KN+
Sbjct  128  GIDFKKNS  135



>ref|XP_010063560.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063561.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063562.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063564.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 gb|KCW70795.1| hypothetical protein EUGRSUZ_F03953 [Eucalyptus grandis]
Length=281

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  KS+SIQIR+VWD NL+EEF  IRE+VDDYP++AMDTEFPGIV+RPVGNFKNS+++
Sbjct  1    MSLSAKSESIQIRDVWDDNLDEEFARIREIVDDYPYVAMDTEFPGIVVRPVGNFKNSSEF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLK+NVDMLKLIQLGLTFSDE+GNLPTCG+DK CIWQFNFREF+ NED FA DSIEL
Sbjct  61   HYQTLKENVDMLKLIQLGLTFSDERGNLPTCGSDKCCIWQFNFREFNANEDFFADDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GIDF+KN
Sbjct  121  LKQSGIDFKKN  131



>ref|XP_008336906.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   227 bits (578),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            KMS  PKSDSI IREVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSXFPKSDSIHIREVWSDNLEEEFKLIRSVVEEYQYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIE
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIE  140

Query  553  LLRQCGIDFEKN  588
            LL Q G+DF KN
Sbjct  141  LLSQSGMDFVKN  152



>ref|XP_008445259.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Cucumis 
melo]
Length=274

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DSIQIREVW+ NLEEEF LIR +VD + +IAMDTEFPG+VLRP+G FKN ND+
Sbjct  1    MSILPKGDSIQIREVWNANLEEEFALIRAIVDKFNYIAMDTEFPGVVLRPLGTFKNINDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLKDNV+MLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+   D+FASDSIEL
Sbjct  61   NYRTLKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFQKN  131



>ref|XP_004138704.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Cucumis sativus]
 ref|XP_004160759.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Cucumis sativus]
 gb|KGN62988.1| hypothetical protein Csa_2G382610 [Cucumis sativus]
Length=274

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DSIQIREVW+ NLEEEF LIR +VD + +IAMDTEFPG+VLRP+G FKN ND+
Sbjct  1    MSILPKGDSIQIREVWNANLEEEFALIRAIVDKFNYIAMDTEFPGVVLRPLGTFKNINDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLKDNV+MLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+   D+FASDSIEL
Sbjct  61   NYRTLKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFQKN  131



>ref|XP_004501372.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501373.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501374.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X3 [Cicer arietinum]
 ref|XP_004501375.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X4 [Cicer arietinum]
Length=271

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+  K DS+QIREVW+ NL+EEF LIRE+VD + FIAMDTEFPG+VLRPVGNFKN NDY
Sbjct  1    MSVSSKGDSVQIREVWNDNLDEEFALIREIVDQFNFIAMDTEFPGVVLRPVGNFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLP CGTD  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPNCGTDSSCIWQFNFREFNVSEDIFASDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN+
Sbjct  121  LRQCGIDFKKNS  132



>ref|XP_009358471.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   226 bits (576),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            KMS  PKSDSI IREVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSTFPKSDSIHIREVWSDNLEEEFKLIRNVVEEYRYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIE
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIE  140

Query  553  LLRQCGIDFEKN  588
            LL Q G+DF KN
Sbjct  141  LLSQSGMDFVKN  152



>ref|XP_003530297.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Glycine max]
 ref|XP_003530298.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Glycine max]
 gb|KHN04172.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=277

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 2/131 (2%)
 Frame = +1

Query  202  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHY  381
            +L KSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    VLAKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  382  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--TDKYCIWQFNFREFDPNEDVFASDSIEL  555
            QTLKDNVDMLKLIQLGLTFSDE GNLPTCG  +   CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPTCGDESGTCCIWQFNFREFNVNEDVFANDSIEL  123

Query  556  LRQCGIDFEKN  588
            LRQ GIDF++N
Sbjct  124  LRQSGIDFKRN  134



>gb|ACU24625.1| unknown [Glycine max]
Length=277

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 2/131 (2%)
 Frame = +1

Query  202  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHY  381
            +L KSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    VLAKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  382  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--TDKYCIWQFNFREFDPNEDVFASDSIEL  555
            QTLKDNVDMLKLIQLGLTFSDE GNLPTCG  +   CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPTCGDESGTCCIWQFNFREFNVNEDVFANDSIEL  123

Query  556  LRQCGIDFEKN  588
            LRQ GIDF++N
Sbjct  124  LRQSGIDFKRN  134



>gb|KJB55043.1| hypothetical protein B456_009G061200 [Gossypium raimondii]
Length=274

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DS+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG+FKN +DY
Sbjct  1    MSVLPKGDSVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGSFKNISDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD  CIWQFNF EF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSSCIWQFNFCEFNISEDIFASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>ref|XP_002309667.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
 gb|EEE93190.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
Length=277

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  208  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQT  387
            PK +SIQIREVW+ NLEEEF LIRE+VD + F+AMDTEFPG+VLRPVGNFKN NDY+YQT
Sbjct  8    PKEESIQIREVWNDNLEEEFALIREIVDQFNFVAMDTEFPGVVLRPVGNFKNINDYNYQT  67

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D+FASDSIELLRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTKDIFASDSIELLRQC  127

Query  568  GIDFEKN  588
            GIDF+ N
Sbjct  128  GIDFKMN  134



>ref|XP_010532089.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010532090.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
Length=274

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLEEEF LIR +V+D+P++AMDTEFPGIV RPVG FK SNDY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRRIVEDFPYVAMDTEFPGIVCRPVGTFKTSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD N D+FA DSI+L
Sbjct  61   NYETLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLNSDIFARDSIDL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF KN
Sbjct  121  LRQSGIDFAKN  131



>ref|XP_010532091.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Tarenaya hassleriana]
Length=275

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLEEEF LIR +V+D+P++AMDTEFPGIV RPVG FK SNDY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRRIVEDFPYVAMDTEFPGIVCRPVGTFKTSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD N D+FA DSI+L
Sbjct  61   NYETLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLNSDIFARDSIDL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF KN
Sbjct  121  LRQSGIDFAKN  131



>ref|XP_010048831.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW81224.1| hypothetical protein EUGRSUZ_C02596 [Eucalyptus grandis]
Length=274

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+L KSDS++IREVW+YNLE+EF  IRE+VDDYP+IAMDTEFPG+VLRPVGNFK+S++Y
Sbjct  1    MSVLSKSDSVEIREVWEYNLEDEFSFIREIVDDYPYIAMDTEFPGMVLRPVGNFKSSSEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLK NVD+LKLIQLGLTF+DEKGNLPTCGTDKY +WQFNFREF+ NEDV+A DSI+L
Sbjct  61   NYQTLKANVDLLKLIQLGLTFADEKGNLPTCGTDKYYVWQFNFREFNLNEDVYAHDSIDL  120

Query  556  LRQCGIDFEKN  588
            L Q GI+F+KN
Sbjct  121  LSQSGINFKKN  131



>ref|XP_006857184.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
 gb|ERN18651.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
Length=274

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK+++I IREVW  NLE+EF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS+D+
Sbjct  1    MSILPKNETILIREVWGDNLEDEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSSDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NVDMLKLIQLGLTFSDE GNLPTCGTDK+ IWQFNFREF+  EDV+A+DSIEL
Sbjct  61   HYKTLKANVDMLKLIQLGLTFSDEDGNLPTCGTDKFYIWQFNFREFNVLEDVYANDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFKKN  131



>ref|XP_010648684.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010648686.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=273

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+ PK++S+ IREVW+ NLE EF LIRE+VD YP+IAMDTEFPG+VLRP+G FKN NDY
Sbjct  1    MSISPKTESVLIREVWNENLESEFALIREIVDKYPYIAMDTEFPGVVLRPMGTFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSD  GNLPTCGTDK CIWQFNFREFD  EDVFASDSI++
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDANGNLPTCGTDKLCIWQFNFREFDVTEDVFASDSIQM  120

Query  556  LRQCGIDFEKN  588
            L++CG+DF+KN
Sbjct  121  LQECGMDFKKN  131



>ref|XP_007135810.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
 gb|ESW07804.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
Length=283

 Score =   224 bits (570),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 119/137 (87%), Gaps = 8/137 (6%)
 Frame = +1

Query  202  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHY  381
            +LPKSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILPKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  382  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--------TDKYCIWQFNFREFDPNEDVFA  537
            QTLKDNVDMLKLIQLGLTFSDE GNLPTC         +   CIWQFNFREF+ NEDVFA
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEYGNLPTCAGAGDVDEESHSCCIWQFNFREFNVNEDVFA  123

Query  538  SDSIELLRQCGIDFEKN  588
            +DSIELLRQ GIDF+KN
Sbjct  124  NDSIELLRQSGIDFKKN  140



>ref|XP_007011965.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
 gb|EOY29584.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
Length=274

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPKS+SI IREVW+ NL  E +LI+  VD+YP+IAMDTEFPGIVLRP+GNFK+S +Y
Sbjct  1    MSILPKSESIHIREVWEENLGSEIELIKNTVDEYPYIAMDTEFPGIVLRPIGNFKSSFEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLK NVD+LKLIQLGLTFSD+KGNLPTCGTDK+C+WQFNFREFDPNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDDKGNLPTCGTDKFCVWQFNFREFDPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GIDF+KN
Sbjct  121  LSQSGIDFKKN  131



>ref|XP_007202386.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
 gb|EMJ03585.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
Length=295

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  21   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  80

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIE
Sbjct  81   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIE  140

Query  553  LLRQCGIDFEKN  588
            LL Q G+DF+KN
Sbjct  141  LLSQSGMDFKKN  152



>ref|XP_008242960.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Prunus mume]
Length=295

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  21   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  80

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIE
Sbjct  81   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIE  140

Query  553  LLRQCGIDFEKN  588
            LL Q G+DF+KN
Sbjct  141  LLSQSGMDFKKN  152



>gb|KHF99352.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
 gb|KHG05538.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=327

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            +MS+LPK DS+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG+FKN +D
Sbjct  53   EMSILPKGDSVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGSFKNISD  112

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLP+CGTD  CIWQFNF EF+ +ED+FASDSIE
Sbjct  113  YNYQTLKDNVDMLKLIQLGLTFSDENGNLPSCGTDSSCIWQFNFCEFNISEDIFASDSIE  172

Query  553  LLRQCGIDFEKN  588
            LLRQCGIDF+KN
Sbjct  173  LLRQCGIDFKKN  184



>ref|XP_006483458.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO67487.1| hypothetical protein CISIN_1g023967mg [Citrus sinensis]
Length=274

 Score =   223 bits (567),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKS-DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            MS+LPK  D IQIREVW+ NLEEEF LIRE+VD Y +IAMDTEFPG+VLRPVG FKN ND
Sbjct  1    MSVLPKGGDEIQIREVWNDNLEEEFALIREIVDKYNYIAMDTEFPGVVLRPVGAFKNIND  60

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D+FASDS+E
Sbjct  61   YNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNLIDDIFASDSVE  120

Query  553  LLRQCGIDFEKN  588
            LL QCGIDF+KN
Sbjct  121  LLHQCGIDFKKN  132



>emb|CDP10211.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M++LP  DSI IREVW+ NLE+EF LIRE+VDDYP+IAMDTEFPG+VLRP+G++KN  D+
Sbjct  1    MTVLPSHDSIHIREVWNDNLEDEFALIREIVDDYPYIAMDTEFPGVVLRPLGDYKNFTDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            H++TLK NVD+LKLIQLGLTFSDEKGNLPTCGT KYC+WQFNFREF+PNEDV+A DSIEL
Sbjct  61   HFKTLKANVDLLKLIQLGLTFSDEKGNLPTCGTGKYCVWQFNFREFNPNEDVYAHDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LR+ G DF+KN 
Sbjct  121  LRRSGFDFKKNV  132



>ref|XP_004507083.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=277

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 2/131 (2%)
 Frame = +1

Query  202  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHY  381
            +LPKSD IQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK+S DYHY
Sbjct  4    ILPKSDLIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKSSYDYHY  63

Query  382  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--TDKYCIWQFNFREFDPNEDVFASDSIEL  555
            QTLKDNVDMLKLIQLGLTFSDE GNLP  G   D++CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPKIGDDDDRFCIWQFNFREFNVNEDVFANDSIEL  123

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  124  LRQSGIDFKKN  134



>ref|XP_008242959.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Prunus mume]
Length=307

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  33   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  92

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIE
Sbjct  93   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIE  152

Query  553  LLRQCGIDFEKN  588
            LL Q G+DF+KN
Sbjct  153  LLSQSGMDFKKN  164



>gb|AFK43307.1| unknown [Lotus japonicus]
Length=274

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 117/127 (92%), Gaps = 1/127 (1%)
 Frame = +1

Query  208  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQT  387
            PK++SIQIREVW+ NLE+EF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS+DYHYQT
Sbjct  6    PKAESIQIREVWNENLEQEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSHDYHYQT  65

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            LKDNVDMLKLIQLGLTFSDE+GNLP+C     CIWQFNFREF+ NEDVFA+DSIELLRQ 
Sbjct  66   LKDNVDMLKLIQLGLTFSDEEGNLPSCDGSS-CIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  568  GIDFEKN  588
            GIDF KN
Sbjct  125  GIDFSKN  131



>ref|XP_003604226.1| Ribonuclease CAF1 [Medicago truncatula]
Length=277

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 2/131 (2%)
 Frame = +1

Query  202  LLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            +LP++D SIQIREVW  NLEEEF +IRE+VDDYPFIAMDTEFPGIVLRPVGNFK++ DYH
Sbjct  4    ILPQNDDSIQIREVWSDNLEEEFAVIREIVDDYPFIAMDTEFPGIVLRPVGNFKSNYDYH  63

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIEL  555
            YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG  D++CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  64   YQTLKDNVDMLKLIQLGLTFSDEHGNLPTCGEDDRFCIWQFNFREFNVNEDVFANDSIEL  123

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  124  LRQSGIDFKKN  134



>ref|XP_006356929.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK+DSIQIREVW  NLEEEF LIR++VDDYP+IAMDTEFPG+VLRPVGNFK+ N+Y
Sbjct  1    MSVLPKTDSIQIREVWSDNLEEEFALIRQIVDDYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDML LIQLGLTFSDE GNLPTCG++ Y IWQFNFREFD + D+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLNLIQLGLTFSDENGNLPTCGSEYYYIWQFNFREFDTSADIFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GIDF+KN
Sbjct  121  LIQSGIDFKKN  131



>ref|XP_008354337.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            KMS  P  DSI IREVW  NLEEEF LIR+VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSSFPNRDSIHIREVWSDNLEEEFKLIRKVVEEYRYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIE
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIE  140

Query  553  LLRQCGIDFEKN  588
            LL Q G+DF KN
Sbjct  141  LLSQSGMDFVKN  152



>ref|XP_008344039.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS  P  DSI IREVW  NLEEEF LIR+VV++Y ++AMDTEFPGIVLRPVG FK+S DY
Sbjct  1    MSSFPNRDSIHIREVWSDNLEEEFKLIRKVVEEYRYVAMDTEFPGIVLRPVGTFKDSYDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIEL
Sbjct  61   HYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q G+DF KN
Sbjct  121  LSQSGMDFVKN  131



>ref|XP_011039582.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  208  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQT  387
            PK +SIQIREVW+ NL+EEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN NDY+YQT
Sbjct  8    PKEESIQIREVWNDNLQEEFALIREIVDQFNYVAMDTEFPGVVLRPVGNFKNINDYNYQT  67

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK CIWQFNFREF+  +D+FASDSIELLRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKSCIWQFNFREFNVTKDIFASDSIELLRQC  127

Query  568  GIDFEKN  588
            GIDF+ N
Sbjct  128  GIDFKMN  134



>emb|CAN79806.1| hypothetical protein VITISV_031504 [Vitis vinifera]
Length=270

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +PK++S+ IREVW+ NLE EF LIRE+VD YP+IAMDTEFPG+VLRP+G FKN NDY+YQ
Sbjct  1    MPKTESVLIREVWNENLESEFALIREIVDKYPYIAMDTEFPGVVLRPMGTFKNINDYNYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TLKDNVDMLKLIQLGLTFSD  GNLPTCGTDK CIWQFNFREFD  EDVFASDSI++L++
Sbjct  61   TLKDNVDMLKLIQLGLTFSDANGNLPTCGTDKLCIWQFNFREFDVTEDVFASDSIQMLQE  120

Query  565  CGIDFEKN  588
            CG+DF+KN
Sbjct  121  CGMDFKKN  128



>ref|XP_010532085.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=274

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLEEEF LIR++V+D+P++AMDTEFPGIV +PVG FK SNDY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRKIVEDFPYVAMDTEFPGIVCKPVGTFKTSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD   D+FA DSIEL
Sbjct  61   NYKTLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLTSDIFARDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GIDF KN
Sbjct  121  LHQSGIDFAKN  131



>ref|XP_003531734.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Glycine max]
 ref|XP_006585611.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Glycine max]
Length=281

 Score =   221 bits (562),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 118/135 (87%), Gaps = 6/135 (4%)
 Frame = +1

Query  202  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHY  381
            +L KSDSIQIREVW+ NLEEEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILAKSDSIQIREVWNDNLEEEFALIREIVDNYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  382  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDK------YCIWQFNFREFDPNEDVFASD  543
            QTLKDNVDMLKLIQLGLTFSDE GNLP CG D        CIWQFNFREF+ NEDVFA+D
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPMCGGDDEESDTCCCIWQFNFREFNVNEDVFAND  123

Query  544  SIELLRQCGIDFEKN  588
            SIELLRQ GIDF++N
Sbjct  124  SIELLRQSGIDFKRN  138



>gb|AFK45143.1| unknown [Lotus japonicus]
Length=272

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+L K DS+QIREVW+ NLEEEF LIRE+VDD+ ++AMDTEFPG+VLRP+GNFKN NDY
Sbjct  1    MSILQKGDSVQIREVWNDNLEEEFALIREIVDDFSYVAMDTEFPGVVLRPLGNFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTETPCIWQFNFREFNVSEDIFASDSIEL  120

Query  556  LRQCGIDFEK  585
            LRQ GID +K
Sbjct  121  LRQSGIDLKK  130



>gb|KJB06630.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
 gb|KJB06632.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=273

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DS+QIR+VW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSVLPKGDSVQIRKVWNDNLEEEFVLIREIVDTYNYVAMDTEFPGVVLRPVGTFKNVSDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLK NVDMLKLIQLGLTFSD  GNLPTCGTD +CIWQFNFREF+ +ED+F SDSIEL
Sbjct  61   NYQTLKGNVDMLKLIQLGLTFSDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIEL  120

Query  556  LRQCGIDFEKN  588
            L QCGIDF+KN
Sbjct  121  LLQCGIDFKKN  131



>ref|XP_009363839.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=273

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK DSIQIREVWD NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG FKN N++
Sbjct  1    MSLLPKGDSIQIREVWDDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGAFKNINEF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLKDNVDMLKLIQLGLTFSDE GNLPT GT+ + IWQFNFREF+ +ED+FASDSI+L
Sbjct  61   HYKTLKDNVDMLKLIQLGLTFSDENGNLPTLGTENHYIWQFNFREFNVSEDIFASDSIDL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>ref|XP_004291948.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   220 bits (561),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DSI+IREVW+ NLEEEF +IR +VD Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSILPKEDSIRIREVWNDNLEEEFHIIRGIVDKYNYVAMDTEFPGVVLRPVGAFKNISDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+ + IWQFNFREF+  ED+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTENFFIWQFNFREFNVTEDIFAADSIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN+
Sbjct  121  LRQCGIDFKKNS  132



>ref|XP_003603309.1| Ribonuclease CAF1 [Medicago truncatula]
 gb|ACJ84747.1| unknown [Medicago truncatula]
 gb|AFK46979.1| unknown [Medicago truncatula]
Length=275

 Score =   220 bits (561),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            L K DSIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFK+ ND++YQ
Sbjct  8    LQKGDSIQIREVWNDNLEEEFVLIREIVDKYNYVAMDTEFPGVVLRPVGNFKHINDFNYQ  67

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TLKDNVDMLKLIQLGLTFSDE GNLPTCGTD  CIWQFNFREF+ +ED+FA+DSIELLRQ
Sbjct  68   TLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSPCIWQFNFREFNVSEDIFAADSIELLRQ  127

Query  565  CGIDFEKNT  591
            CGIDF+KN+
Sbjct  128  CGIDFKKNS  136



>ref|XP_010092187.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB50413.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=277

 Score =   220 bits (561),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M  LPK+DSI IREVW+ NL+EEF LIR++VD YP++AMDTEFPGIVLRPVGNFKNS D+
Sbjct  1    MPELPKTDSIHIREVWNDNLDEEFALIRDIVDQYPYVAMDTEFPGIVLRPVGNFKNSYDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCG-TDKYCIWQFNFREFDPNEDVFASDSIE  552
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CG + +YCIWQFNFREF+ NEDVFA+DSIE
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEHGNLPACGASGEYCIWQFNFREFNVNEDVFANDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ GID +KN
Sbjct  121  LLRQSGIDLKKN  132



>ref|XP_006450304.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
 gb|ESR63544.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
Length=449

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 123/139 (88%), Gaps = 2/139 (1%)
 Frame = +1

Query  175  KFWVDWKMSLLPKS-DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  351
            KF V  +MS+LPK  D IQIREVW+ NLEEEF LIRE+VD Y +IAMDTEFPG+VLRPVG
Sbjct  170  KFAV-LEMSVLPKGGDEIQIREVWNDNLEEEFALIREIVDKYNYIAMDTEFPGVVLRPVG  228

Query  352  NFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDV  531
             FKN NDY+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D+
Sbjct  229  AFKNINDYNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNLIDDI  288

Query  532  FASDSIELLRQCGIDFEKN  588
            FASDS+ELL QCGIDF+KN
Sbjct  289  FASDSVELLHQCGIDFKKN  307



>ref|XP_009366159.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            KMS  P  DSI I+EVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSSFPNRDSIHIKEVWSDNLEEEFKLIRSVVEEYRYVAMDTEFPGIVLRPVGTFKDSFD  80

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  552
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIE
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIE  140

Query  553  LLRQCGIDFEKN  588
            LL Q G+DF KN
Sbjct  141  LLSQSGMDFVKN  152



>ref|XP_010537879.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=277

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK DS+QI EVW+ NLEEEF LIR++VDD+P+++MDTEFPGIV R VG FK SNDY
Sbjct  1    MSLLPKDDSVQICEVWNDNLEEEFALIRQIVDDFPYVSMDTEFPGIVCRSVGIFKTSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NV+MLKLIQ+GLTFSDE GNLPTCGTDK+CIWQFN REFDPN D+++ DSIEL
Sbjct  61   HYETLKLNVNMLKLIQIGLTFSDENGNLPTCGTDKHCIWQFNLREFDPNSDIYSQDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF KN
Sbjct  121  LRQSGIDFTKN  131



>ref|XP_010556071.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Tarenaya 
hassleriana]
Length=276

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+L K DSI IREVW+ NLEEEF LIREVVD Y ++AMDTEFPG+VLRP+G FKN  DY
Sbjct  1    MSVLLKDDSILIREVWNDNLEEEFTLIREVVDTYNYVAMDTEFPGVVLRPLGTFKNIADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+ ++DV+AS+SI+L
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEHGNLPTCGTDKFCIWQFNFREFNLSQDVYASESIDL  120

Query  556  LRQCGIDFEKN  588
            L QCGIDF KN
Sbjct  121  LHQCGIDFNKN  131



>gb|ACU20942.1| unknown [Glycine max]
Length=281

 Score =   218 bits (554),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 117/135 (87%), Gaps = 6/135 (4%)
 Frame = +1

Query  202  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHY  381
            +L KSDSIQIREVW+ NLEEEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILAKSDSIQIREVWNDNLEEEFALIREIVDNYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  382  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDK------YCIWQFNFREFDPNEDVFASD  543
            QTLKDNVDMLK IQLGLTFSDE GNLP CG D        CIWQFNFREF+ NEDVFA+D
Sbjct  64   QTLKDNVDMLKPIQLGLTFSDEHGNLPMCGGDDEESDTCCCIWQFNFREFNVNEDVFAND  123

Query  544  SIELLRQCGIDFEKN  588
            SIELLRQ GIDF++N
Sbjct  124  SIELLRQSGIDFKRN  138



>gb|ACJ84891.1| unknown [Medicago truncatula]
Length=275

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            L K DSIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFK+ ND++YQ
Sbjct  8    LQKGDSIQIREVWNDNLEEEFVLIREIVDKYNYVAMDTEFPGVVLRPVGNFKHINDFNYQ  67

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TLKDNV MLKLIQLGLTFSDE GNLPTCGTD  CIWQFNFREF+ +ED+FA+DSIELLRQ
Sbjct  68   TLKDNVYMLKLIQLGLTFSDENGNLPTCGTDSPCIWQFNFREFNVSEDIFAADSIELLRQ  127

Query  565  CGIDFEKNT  591
            CGIDF+KN+
Sbjct  128  CGIDFKKNS  136



>ref|XP_010942117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            S+LPKS+++QIREVW+ NL+ EF LIRE+VDD+PF+AMDTEFPGIV RP+GNFK S+D++
Sbjct  3    SILPKSETVQIREVWNDNLDAEFSLIREIVDDFPFVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT + C+WQFNFREFD   D+FASDSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDEFGNLPTCGTGRGCVWQFNFREFDAQRDIFASDSIELL  122

Query  559  RQCGIDFEKN  588
            RQ GIDF+KN
Sbjct  123  RQSGIDFKKN  132



>ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=282

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 3/134 (2%)
 Frame = +1

Query  196  MSL-LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            MSL LPKSDSIQIREVW  NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS D
Sbjct  7    MSLILPKSDSIQIREVWSDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYD  66

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDS  546
            YHYQTLKDNVDMLKLIQLG T SDE GNLP      D++C+WQFNFREF+ +EDVFA+DS
Sbjct  67   YHYQTLKDNVDMLKLIQLGFTLSDEDGNLPNFDDADDRFCVWQFNFREFNVSEDVFANDS  126

Query  547  IELLRQCGIDFEKN  588
            IELLRQ GIDF+KN
Sbjct  127  IELLRQSGIDFKKN  140



>ref|XP_010048142.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 ref|XP_010048359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80304.1| hypothetical protein EUGRSUZ_C01665 [Eucalyptus grandis]
 gb|KCW80609.1| hypothetical protein EUGRSUZ_C01976 [Eucalyptus grandis]
Length=274

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M++  K DSI IREVW+ NLEEEF LIREVVD + ++AMDTEFPG+V RPVGNFKN +DY
Sbjct  1    MAVPLKDDSIDIREVWNDNLEEEFALIREVVDRFSYVAMDTEFPGVVSRPVGNFKNISDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y TLK+NVDMLKLIQLGLTFSDE GNLPTCGTDKYCIWQFNFREF+  ED+FA DSIEL
Sbjct  61   NYLTLKNNVDMLKLIQLGLTFSDENGNLPTCGTDKYCIWQFNFREFNVTEDMFAGDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LR+CGIDF+KNT
Sbjct  121  LRECGIDFKKNT  132



>ref|NP_178193.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 ref|NP_849915.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 sp|Q9SAI2.1|CAF1F_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 6 [Arabidopsis 
thaliana]
 gb|AAF14666.1|AC011713_14 Similar to gb|U21855 CCR4-associated factor 1 (CAF1) from Mus 
musculus. ESTs gb|AAA394972, gb|AA585812 and gb|H77015 come 
from this gene [Arabidopsis thaliana]
 gb|AAL49916.1| putative CCR4-associated factorCCR4-associated factor [Arabidopsis 
thaliana]
 gb|AAM20381.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEE36448.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
 gb|AEE36449.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=274

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NL+EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSIEL
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFALDSIEL  120

Query  556  LRQCGIDFEKNT  591
            L+Q GID  KNT
Sbjct  121  LKQSGIDLAKNT  132



>ref|NP_001185452.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 gb|AEE36450.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=286

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NL+EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSIEL
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFALDSIEL  120

Query  556  LRQCGIDFEKNT  591
            L+Q GID  KNT
Sbjct  121  LKQSGIDLAKNT  132



>ref|XP_009417447.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            S+LPK++++QIREVW  NLE+EF LIRE+VDD+PF+AMDTEFPGIV RP+GNF+ S+D++
Sbjct  3    SILPKNETVQIREVWSNNLEQEFALIREIVDDFPFVAMDTEFPGIVCRPLGNFRTSSDFN  62

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NVDMLKLIQLGLT SDE G+LPTCGTD+ C+WQFNFREFD   DVFASDSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTLSDEHGSLPTCGTDRGCVWQFNFREFDIQRDVFASDSIELL  122

Query  559  RQCGIDFEKN  588
            RQ GIDF+KN
Sbjct  123  RQSGIDFKKN  132



>ref|XP_010472873.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=274

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGTDKYCIWQFNFREFD + D+FA DSIEL
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIEL  120

Query  556  LRQCGIDFEKNT  591
            L+Q GID  KNT
Sbjct  121  LKQSGIDLAKNT  132



>ref|XP_006294779.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
 gb|EOA27677.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
Length=275

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD   D+FA+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIFATDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ GIDF KN
Sbjct  121  LLRQSGIDFAKN  132



>gb|ACN40154.1| unknown [Picea sitchensis]
Length=274

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LP+SDS+ IREVW  NL EEF LIRE+VDDYP+IAMDTEFPGIV+RPVGNFK ++++
Sbjct  1    MSILPQSDSLIIREVWADNLVEEFALIREIVDDYPYIAMDTEFPGIVVRPVGNFKTASEF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY TLK NVD+L LIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+ ++D++ASDSIEL
Sbjct  61   HYYTLKSNVDVLNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYASDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GIDF+KN
Sbjct  121  LQQSGIDFKKN  131



>ref|XP_006473977.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO59415.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
 gb|KDO59416.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
Length=274

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPKS+SI IREVW+ NLE EF LIR++VDDYP+IAMDTEFPGIVLR +GNFK+S++Y
Sbjct  1    MSILPKSESIHIREVWNDNLEHEFSLIRDIVDDYPYIAMDTEFPGIVLRSIGNFKSSSEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQ LK NVD+LKLIQLGLTF+DE GNLP CGTDKYC+WQFNFREF P+EDV+A DSI+L
Sbjct  61   NYQNLKVNVDLLKLIQLGLTFTDENGNLPKCGTDKYCLWQFNFREFSPDEDVYAYDSIKL  120

Query  556  LRQCGIDFEKN  588
            L + GIDF+KN
Sbjct  121  LSRSGIDFKKN  131



>ref|XP_010691601.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Beta 
vulgaris subsp. vulgaris]
Length=274

 Score =   215 bits (548),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS++ KSDS+ IREVW+ NLE+EF LIR++VD YPF+AMDTEFPGIVLR VG F+N+ D+
Sbjct  1    MSVVLKSDSVHIREVWEENLEQEFGLIRDIVDAYPFVAMDTEFPGIVLRAVGEFENNTDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLKDNVDMLKLIQLGLTFSDE+GNLPTCGT+++CIWQFNF EF+ NEDVFA DSI+L
Sbjct  61   NYRTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTEQFCIWQFNFCEFNLNEDVFAHDSIQL  120

Query  556  LRQCGIDFEKN  588
            LRQ GIDF+KN
Sbjct  121  LRQSGIDFQKN  131



>ref|XP_011073532.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=271

 Score =   215 bits (547),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            LPK+D IQIREVW+ NLE+EF LIR++VD YP++AMDTEFPG+VLRPVGNF + N Y+YQ
Sbjct  4    LPKNDQIQIREVWNDNLEQEFALIRDIVDGYPYVAMDTEFPGVVLRPVGNFNHINQYNYQ  63

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FA+DSIELLRQ
Sbjct  64   TLKDNVDMLKLIQLGLTFSDENGNLPTCGTNTCCIWQFNFREFNVSEDIFANDSIELLRQ  123

Query  565  CGIDFEKN  588
             GIDF+KN
Sbjct  124  SGIDFKKN  131



>ref|XP_008378874.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008343758.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=271

 Score =   215 bits (547),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLLPK+DSIQIREVW+ NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG FKN N++
Sbjct  1    MSLLPKADSIQIREVWNDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGAFKNINEF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLKDNVDMLKLIQLGLTFSDE G+LPT  T+ + IWQFNFREF+ +ED+FASDSI+L
Sbjct  61   HYKTLKDNVDMLKLIQLGLTFSDENGDLPTLATENHYIWQFNFREFNVSEDIFASDSIDL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>ref|XP_006302671.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
 gb|EOA35569.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
Length=274

 Score =   215 bits (547),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNF EFD + D+FA DSIEL
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFGEFDLDSDIFAVDSIEL  120

Query  556  LRQCGIDFEKNT  591
            L+Q GID  KNT
Sbjct  121  LKQSGIDLAKNT  132



>ref|XP_002881215.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57474.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNENLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD   D++A+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ GIDF KN
Sbjct  121  LLRQSGIDFAKN  132



>gb|ABK22659.1| unknown [Picea sitchensis]
Length=284

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPKSDSI IREVW  NLEEEF+LI E+VDDYP +AMDTEFPGIV+RP+G FK   D+
Sbjct  1    MSILPKSDSIHIREVWADNLEEEFNLINEIVDDYPLVAMDTEFPGIVVRPLGKFKTVQDF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TL+ NVD+LKLIQLGLTFSDE GNLP+CGTD+YC+WQFNFREF+  ED +ASDSIEL
Sbjct  61   NYETLRSNVDVLKLIQLGLTFSDEDGNLPSCGTDRYCVWQFNFREFNIWEDAYASDSIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQ GIDF+KN+
Sbjct  121  LRQSGIDFKKNS  132



>emb|CDY63973.1| BnaC02g46620D [Brassica napus]
Length=274

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NL EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLHEEMDLIRQVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSI+L
Sbjct  61   HYETLKLNVNILSIIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIDL  120

Query  556  LRQCGIDFEKNT  591
            L+Q GIDF KNT
Sbjct  121  LKQSGIDFAKNT  132



>ref|XP_010414034.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGADSKYCIWQFNFREFDLESDIFATDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ GIDF KN
Sbjct  121  LLRQSGIDFAKN  132



>ref|XP_010469632.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGADNKYCIWQFNFREFDLESDIFATDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ GIDF KN
Sbjct  121  LLRQSGIDFAKN  132



>ref|XP_010911571.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=133

 Score =   209 bits (531),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            S+LPK++++QIREVW+ N++ EF LIRE+VDD+P++AMDTEFP IV RP+GNFK S+D++
Sbjct  3    SILPKNETVQIREVWNDNVDAEFALIREIVDDFPYVAMDTEFPAIVARPLGNFKTSSDFN  62

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT   C+WQFNFREFD + D+FASDSIELL
Sbjct  63   YATLKFNVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFDVHHDIFASDSIELL  122

Query  559  RQCGIDFEKN  588
            RQ GIDF+KN
Sbjct  123  RQSGIDFKKN  132



>ref|XP_004160761.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7-like [Cucumis sativus]
Length=274

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK +SI IREVW+ NLEEEF LIR++VD + +IAMDTEFPG+V+RPVG+FKN N+Y
Sbjct  1    MSILPKGESINIREVWNDNLEEEFALIRDIVDQFNYIAMDTEFPGVVVRPVGSFKNINEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TL++NVD LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D++ASDSIEL
Sbjct  61   NYRTLRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIEL  120

Query  556  LRQCGIDFEK  585
            LR+CGIDF+K
Sbjct  121  LRECGIDFQK  130



>ref|XP_009128391.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDY53227.1| BnaA02g19410D [Brassica napus]
Length=274

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NL EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLLEEMDLIRQVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSI+L
Sbjct  61   HYETLKLNVNILSIIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIDL  120

Query  556  LRQCGIDFEKNT  591
            L+Q GIDF KNT
Sbjct  121  LKQSGIDFAKNT  132



>ref|XP_004138706.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cucumis 
sativus]
 gb|KGN62986.1| Ccr4-associated factor [Cucumis sativus]
Length=274

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK +SI IREVW+ NLEEEF LIR++VD + +IAMDTEFPG+V+RPVG+FKN N+Y
Sbjct  1    MSILPKGESINIREVWNDNLEEEFALIRDIVDQFNYIAMDTEFPGVVVRPVGSFKNINEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TL++NVD LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D++ASDSIEL
Sbjct  61   NYRTLRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIEL  120

Query  556  LRQCGIDFEK  585
            LR+CGIDF+K
Sbjct  121  LRECGIDFQK  130



>ref|XP_008445257.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7 [Cucumis melo]
Length=274

 Score =   213 bits (542),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK +SI IREVW+ NLEEEF LIR++VD + +IAMDTEFPG+V+RPVG+FKN N+Y
Sbjct  1    MSILPKGESINIREVWNDNLEEEFALIRDIVDQFNYIAMDTEFPGVVVRPVGSFKNINEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TL++NVD LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D++ASDSIEL
Sbjct  61   NYRTLRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIEL  120

Query  556  LRQCGIDFEK  585
            LR+CGIDF+K
Sbjct  121  LRECGIDFQK  130



>ref|NP_565735.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9SKZ2.2|CAF1G_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 7 [Arabidopsis 
thaliana]
 gb|AAK93623.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAD15397.2| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAN13153.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEC08630.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=275

 Score =   213 bits (542),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD   D++A+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ GIDF KN
Sbjct  121  LLRQSGIDFVKN  132



>ref|XP_010929136.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            S+LPK++++QIREVW+ N++ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S+D++
Sbjct  3    SILPKNETVQIREVWNDNVDAEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT   C+WQFNFREFD + D+FASDSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFDVHHDIFASDSIELL  122

Query  559  RQCGIDFEKN  588
            RQ GIDF+KN
Sbjct  123  RQSGIDFKKN  132



>ref|XP_006368924.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
 gb|ERP65493.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
Length=242

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLL K DSI IREVW+ NLEEEF  IRE+VDD+P+IAMDTEFPGIVLRPVGNFKNSNDY
Sbjct  1    MSLLLKGDSILIREVWNDNLEEEFAHIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NED+  S  I L
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNEDLLMSSGIVL  120



>ref|XP_008799630.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            S+LPKS+++QIREVW+ NL+ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S+D++
Sbjct  3    SILPKSETVQIREVWNDNLDAEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT + C+WQFNFREFD   D+FASDSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDEFGNLPTCGTGRGCVWQFNFREFDVQCDIFASDSIELL  122

Query  559  RQCGIDFEKN  588
            RQ GIDF+KN
Sbjct  123  RQSGIDFKKN  132



>gb|ABK24400.1| unknown [Picea sitchensis]
Length=274

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LP+SDS+ IREVW  NL EEF LIRE+VDDYP+IAMDTEFPGIV+RPVGNFK ++++
Sbjct  1    MSILPQSDSLIIREVWADNLMEEFALIREIVDDYPYIAMDTEFPGIVVRPVGNFKTASEF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY TLK NVD+L LIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+ ++D++A DSIEL
Sbjct  61   HYYTLKSNVDILNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYAIDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GIDF+KN
Sbjct  121  LQQSGIDFKKN  131



>ref|XP_006389834.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
 gb|ESQ27120.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
Length=274

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NL+EE DLIREVVDD+P++AMDTEFPGIV+RPV  FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVMAFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGT+KYCIWQFNFREFD + D++A DSI+L
Sbjct  61   HYETLKMNVNILKIIQLGLTFSNEQGNLPTCGTEKYCIWQFNFREFDVDSDIYALDSIDL  120

Query  556  LRQCGIDFEKNT  591
            L+Q GIDF KNT
Sbjct  121  LKQSGIDFAKNT  132



>ref|XP_009399558.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            S+LPKS++++IREVW  NLE EF LIRE+VDD+P++AMDTEFPGIV RP+G F+ S+D++
Sbjct  3    SILPKSETVEIREVWSDNLEAEFSLIREIVDDFPYVAMDTEFPGIVCRPLGCFRTSSDFN  62

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGTD+ C+WQFNFREFD   DVFA+DSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDELGNLPTCGTDRGCVWQFNFREFDMQLDVFATDSIELL  122

Query  559  RQCGIDFEKN  588
            RQ GIDF+KN
Sbjct  123  RQSGIDFKKN  132



>ref|XP_010491786.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=279

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED+FAS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIFASESIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN 
Sbjct  121  LRQCGIDFKKNV  132



>ref|XP_006453661.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
 gb|ESR66901.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
Length=274

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPKS+SI IREVW+ NLE EF LIR++VDDYP+IAMDTEFPGIVLR +GNFK+S++Y
Sbjct  1    MSILPKSESIHIREVWNDNLEHEFSLIRDIVDDYPYIAMDTEFPGIVLRSIGNFKSSSEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQ LK NVD+LKLIQLGLTF+DE GNLP  GTDKYC+WQFNFREF P+EDV+A DSI+L
Sbjct  61   NYQNLKVNVDLLKLIQLGLTFTDENGNLPKYGTDKYCLWQFNFREFSPDEDVYAYDSIKL  120

Query  556  LRQCGIDFEKN  588
            L + GIDF+KN
Sbjct  121  LSRSGIDFKKN  131



>ref|XP_009390565.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            S+LPK++++QIREVW  NL  EF LIRE+VDD+P++AMDTEFPGIV RP+GNF+ S++++
Sbjct  3    SILPKNETVQIREVWSDNLAAEFALIREIVDDFPYVAMDTEFPGIVCRPLGNFRTSSEFN  62

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NVDMLKLIQLGLTFSD+ GNLPTCGTD+ C+WQFNFREFD  +DVFASDSI+LL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDQLGNLPTCGTDRGCVWQFNFREFDIQQDVFASDSIDLL  122

Query  559  RQCGIDFEKN  588
            RQ GIDF+KN
Sbjct  123  RQSGIDFQKN  132



>ref|XP_010429900.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
 ref|XP_010429901.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGTD KYCIWQFNFREFD + D+FA DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTDNKYCIWQFNFREFDLDSDIFAVDSIE  120

Query  553  LLRQCGIDFEKNT  591
            LL+Q GID  KNT
Sbjct  121  LLKQSGIDLAKNT  133



>ref|XP_010510101.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW  NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWYDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGPDNKYCIWQFNFREFDLESDIFATDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ GIDF KN
Sbjct  121  LLRQSGIDFAKN  132



>emb|CDY39943.1| BnaC06g40210D [Brassica napus]
Length=275

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW  NL+EE DLIREVVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWSDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTD KYCIWQFNFREFD + D+FA DSI+
Sbjct  61   HYETLKLNVNILNIIQLGLTFSNEQGNLPTCGTDSKYCIWQFNFREFDLDSDIFAVDSID  120

Query  553  LLRQCGIDFEKNT  591
            LL+Q GIDF KNT
Sbjct  121  LLKQSGIDFAKNT  133



>ref|XP_004250764.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
 ref|XP_004250765.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DSI+IREVW  NLE+EF LIR++VDDYP+IAMDTEFPG+VLRPVGNFK+ N+Y
Sbjct  1    MSVLPKIDSIKIREVWSDNLEKEFALIRQIVDDYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDML LIQLGLTFSDE GNLPTC ++ Y +WQFNFREFD   ++FA+DSIEL
Sbjct  61   NYQTLKDNVDMLNLIQLGLTFSDENGNLPTCESEYYYVWQFNFREFDTKANIFANDSIEL  120

Query  556  LRQCGIDFEKN  588
            L Q GIDF+KN
Sbjct  121  LIQSGIDFKKN  131



>ref|XP_002871445.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47704.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>ref|XP_009106716.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDX87343.1| BnaA07g35300D [Brassica napus]
Length=275

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW  NL+EE DLIREVVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWSDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTD KYCIWQFNFREFD + D+FA DSI+
Sbjct  61   HYETLKLNVNILNIIQLGLTFSNEQGNLPTCGTDNKYCIWQFNFREFDLDSDIFAVDSID  120

Query  553  LLRQCGIDFEKNT  591
            LL+Q GIDF KNT
Sbjct  121  LLKQSGIDFAKNT  133



>ref|NP_196657.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LEU4.1|CAF1J_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 10 [Arabidopsis 
thaliana]
 emb|CAB96851.1| CCR4-ASSOCIATED FACTOR-like protein [Arabidopsis thaliana]
 gb|AAN13040.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AED91615.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=277

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>gb|AAK92792.1| putative CCR4-associated factor [Arabidopsis thaliana]
Length=277

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>ref|XP_009122009.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 ref|XP_009122010.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
Length=280

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVW+ NL EEF LIRE+VD YPFIAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWNNNLVEEFALIREIVDKYPFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN 
Sbjct  121  LRQCGIDFKKNV  132



>ref|XP_010453129.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010453130.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=278

 Score =   210 bits (535),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN 
Sbjct  121  LRQCGIDFKKNV  132



>ref|XP_006286536.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
 gb|EOA19434.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
Length=282

 Score =   210 bits (535),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>emb|CDX69796.1| BnaA10g21450D [Brassica napus]
Length=278

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVW+ NL EEF LIRE+VD YPFIAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWNNNLLEEFALIREIVDKYPFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN 
Sbjct  121  LRQCGIDFKKNV  132



>ref|XP_010417661.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIE  552
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGT +KYCIWQFNFREFD + D+FA DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTNNKYCIWQFNFREFDLDSDIFAVDSIE  120

Query  553  LLRQCGIDFEKNT  591
            LL+Q GID  KNT
Sbjct  121  LLKQSGIDLAKNT  133



>ref|XP_006410344.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
 gb|ESQ51797.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
Length=276

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+L P+ DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RP+G FK + +Y
Sbjct  1    MTLFPEDDSIQIREVWNENLESEMALIREVVDDFPFVAMDTEFPGIVCRPIGTFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSI  549
            HY+TLK NV++LK+IQLGLTFSD+KGNLPTCG    K+CIWQFNFR+FD N D+FA DSI
Sbjct  61   HYETLKTNVNLLKMIQLGLTFSDDKGNLPTCGGSDKKHCIWQFNFRDFDLNSDIFAHDSI  120

Query  550  ELLRQCGIDFEKN  588
            ELLRQ GIDF KN
Sbjct  121  ELLRQSGIDFVKN  133



>ref|XP_008794330.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            S+LPK++++QIREVW+ N++ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S+D++
Sbjct  3    SILPKNETVQIREVWNDNVDVEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT   C+WQFNFREFD + D+FA+DSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFDVHHDIFATDSIELL  122

Query  559  RQCGIDFEKN  588
            RQ GID +KN
Sbjct  123  RQSGIDLKKN  132



>ref|XP_008220692.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Prunus 
mume]
Length=274

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DSIQIREVW  NL+EEF +IRE+V+ Y ++AMDTEFPG+VLRPVG FKN NDY
Sbjct  1    MSILPKGDSIQIREVWSDNLDEEFAIIREIVEKYNYVAMDTEFPGVVLRPVGAFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSD+ G LP   T    IWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDKNGKLPDLDTQNQYIWQFNFREFNVSEDIFASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>ref|XP_010419649.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010419650.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=277

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLP CGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPKCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN 
Sbjct  121  LRQCGIDFKKNV  132



>ref|XP_002309331.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
 gb|EEE92854.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
Length=269

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS++   D + IR+VW YNLE+EF LI  +VDD+P+IAMDTEFPGIVLRPVG+ K  +DY
Sbjct  1    MSVVHNKDLVVIRDVWKYNLEKEFKLILNIVDDFPYIAMDTEFPGIVLRPVGSVKTGSDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLK NVD+LKLIQLGLT SDEKGNLPTCGTDKYC+WQFNF +F+PNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTLSDEKGNLPTCGTDKYCVWQFNFCDFNPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKNT  591
            L Q GIDF KN 
Sbjct  121  LSQSGIDFVKNA  132



>ref|XP_009144015.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brassica 
rapa]
 emb|CDY64914.1| BnaA05g35260D [Brassica napus]
Length=276

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSL  K DSIQIREVW  NLE E  LIR++VDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWHDNLESEMALIRDIVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSI  549
            HY+TL+ NV++LK+IQLGLTFSDE+GNLPTCG D  KYCIWQFNFREFD + D+FA DSI
Sbjct  61   HYETLRTNVNLLKMIQLGLTFSDERGNLPTCGPDDSKYCIWQFNFREFDLSSDIFAHDSI  120

Query  550  ELLRQCGIDFEKN  588
            ELLRQ GIDF+KN
Sbjct  121  ELLRQSGIDFDKN  133



>ref|XP_006399590.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 ref|XP_006399591.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41043.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41044.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
Length=277

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVW  NL EEF LIRE+VD Y +IAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWSENLVEEFALIREIVDKYSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN 
Sbjct  121  LRQCGIDFKKNV  132



>ref|XP_011033459.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=269

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+    D + IR+VW+YNLE+EF+LI  +VDD+P+IAMDTEFPGIVLRPVG+ K  +DY
Sbjct  1    MSVQDNKDLVVIRDVWNYNLEKEFELILNIVDDFPYIAMDTEFPGIVLRPVGSVKTGSDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLK NVD+LKLIQLGLT SDEKGNLPTCGTDKYC+WQFNF +F+PNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTLSDEKGNLPTCGTDKYCVWQFNFCDFNPNEDVYANDSIEL  120

Query  556  LRQCGIDFEKNT  591
            L Q GIDF KN 
Sbjct  121  LSQSGIDFVKNA  132



>ref|XP_007222518.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
 gb|EMJ23717.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
Length=274

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DSIQIREVW  NL+EEF +IRE+V  Y ++AMDTEFPG+VLRPVG FKN NDY
Sbjct  1    MSILPKGDSIQIREVWSDNLDEEFAIIREIVGTYNYVAMDTEFPGVVLRPVGAFKNINDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSD+ G LP   T    IWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDKNGKLPDLDTQNQYIWQFNFREFNVSEDIFASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>emb|CDY12234.1| BnaC04g12640D [Brassica napus]
Length=276

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLL K DSIQIREVW  NLE E  LIR++VDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLLLKDDSIQIREVWHDNLESEMALIRDIVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSI  549
            HY+TL+ NV++LK+IQLGLTFSDE+GNLPTCG D  KYCIWQFNFREFD + D+FA DSI
Sbjct  61   HYETLRTNVNLLKMIQLGLTFSDERGNLPTCGPDDKKYCIWQFNFREFDLSSDIFAHDSI  120

Query  550  ELLRQCGIDFEKN  588
            ELLRQ GIDF+ N
Sbjct  121  ELLRQSGIDFDNN  133



>ref|XP_008377668.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=273

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+LPK DSI+IREVW+ NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG+FKN N++
Sbjct  1    MSILPKGDSIEIREVWNDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGDFKNINEF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLKDNVDMLKLIQLGLTF DE GNLPT  T+   IWQFNFREF+ +ED++ASDSIEL
Sbjct  61   NYKTLKDNVDMLKLIQLGLTFFDENGNLPTLSTENQYIWQFNFREFNVSEDIYASDSIEL  120

Query  556  LRQCGIDFEKN  588
            LRQCGIDF+KN
Sbjct  121  LRQCGIDFKKN  131



>emb|CDX97069.1| BnaC09g45560D [Brassica napus]
Length=280

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVW+ NL EEF LIRE+VD Y FIAMDTEFPG+VL+PV  FK +ND 
Sbjct  1    MAETLKEDSIMIREVWNDNLLEEFALIREIVDKYTFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+C+WQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCVWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN 
Sbjct  121  LRQCGIDFKKNV  132



>ref|XP_002279241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=270

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS +  +D+  IR+VWD NLE+E  LIR ++DDYP+IAMDTEFPG+VLR VGNFKN+N+Y
Sbjct  1    MSDVLVNDTFHIRDVWDDNLEDEIRLIRGLLDDYPYIAMDTEFPGVVLRSVGNFKNNNEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            ++QTLK NVD+LKLIQLGLTFSDE GN PTCGT++YC+WQFNFREF+ NEDVFA DSIEL
Sbjct  61   NFQTLKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GIDF+KN
Sbjct  121  LKQSGIDFKKN  131



>emb|CAN68032.1| hypothetical protein VITISV_022019 [Vitis vinifera]
Length=270

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS +  +D+  IR+VWD NLE+E  LIR ++DDYP+IAMDTEFPG+VLR VGNFKN+N+Y
Sbjct  1    MSDVLVNDTFHIRDVWDDNLEDEIRLIRGLLDDYPYIAMDTEFPGVVLRSVGNFKNNNEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            ++QTLK NVD+LKLIQLGLTFSDE GN PTCGT++YC+WQFNFREF+ NEDVFA DSIEL
Sbjct  61   NFQTLKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GIDF+KN
Sbjct  121  LKQSGIDFKKN  131



>ref|XP_010541576.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X1 [Tarenaya hassleriana]
Length=275

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MSLL K DSI IREVW+ NLEEEF LIR+VV    ++AMDTEFPG+VLRP+G FKN ++Y
Sbjct  1    MSLL-KDDSILIREVWNDNLEEEFALIRDVVVTCSYVAMDTEFPGVVLRPLGPFKNISEY  59

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+P+ED++ ++SI+L
Sbjct  60   NYKTLKENVDMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNPSEDIYVNESIDL  119

Query  556  LRQCGIDFEKN  588
            L QCGIDF+KN
Sbjct  120  LHQCGIDFKKN  130



>gb|EYU32376.1| hypothetical protein MIMGU_mgv1a026872mg [Erythranthe guttata]
Length=272

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS LPK+DS+ IREVW+ NLE+EF LIR++VD+YP++AMDTEFPG+VLRP+G+F + ++Y
Sbjct  1    MSELPKNDSVTIREVWNDNLEQEFALIRDIVDNYPYVAMDTEFPGVVLRPLGSFNHIHEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTC  +  CIWQFNFREF+ +ED+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTC-DNTCCIWQFNFREFNVSEDIFANDSIEL  119

Query  556  LRQCGIDFEKN  588
            LR+ GIDF+KN
Sbjct  120  LRESGIDFKKN  130



>emb|CDX70376.1| BnaC03g04600D [Brassica napus]
Length=276

 Score =   202 bits (515),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVW+ NL EEF LIRE+VD + ++AMDTEFPG+VL+PV  FK++ND 
Sbjct  1    MAETLKEDSITIREVWNDNLLEEFALIREIVDKFTYVAMDTEFPGVVLKPVETFKHNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+C+WQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDEDGNLPTCGTDKFCVWQFNFREFNIGEDIYASESIEL  120

Query  556  LRQCGIDFEKNT  591
            LRQCGIDF+KN 
Sbjct  121  LRQCGIDFKKNV  132



>ref|XP_001766532.1| predicted protein [Physcomitrella patens]
 gb|EDQ68597.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS++    S++IREVW  NLE+EF+LIR++VD+YP++AMDTEFPG+V+RPVG FKNS +Y
Sbjct  1    MSIVANGGSLRIREVWADNLEDEFELIRDIVDEYPYVAMDTEFPGVVVRPVGTFKNSAEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTL+ NVDMLKLIQLGLTFSDE G LP CG+   C+WQFNFREF+  EDV+A DSIEL
Sbjct  61   HYQTLRANVDMLKLIQLGLTFSDENGVLPRCGSRDSCVWQFNFREFNLREDVYAHDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GIDF++N
Sbjct  121  LKQSGIDFQRN  131



>ref|XP_001755261.1| predicted protein [Physcomitrella patens]
 gb|EDQ79741.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS++    S++IREVW  NLE+EF+LIR++VD+YP++AMDTEFPG+V+RPVG FKNS +Y
Sbjct  1    MSIVANGGSLRIREVWADNLEDEFELIRDIVDEYPYVAMDTEFPGVVVRPVGTFKNSAEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HYQTL+ NVDMLKLIQLGLTFSDE G LP CG+   C+WQFNFREF+  EDV+A DSIEL
Sbjct  61   HYQTLRANVDMLKLIQLGLTFSDENGVLPRCGSRDSCVWQFNFREFNLREDVYAHDSIEL  120

Query  556  LRQCGIDFEKN  588
            L+Q GIDF++N
Sbjct  121  LKQSGIDFQQN  131



>ref|XP_004287117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS + KSD + IREVW+ N++ EF+LIR +VD+YP+IAMDTEFPGIV R +G FKNS DY
Sbjct  1    MSFVMKSDDVLIREVWNDNVDAEFELIRNIVDEYPYIAMDTEFPGIVSRALGTFKNSFDY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTLK NVD+LKLIQLGLTFSDE GNLPTCGTDKYC+WQFNF  F+ NED++A +SIEL
Sbjct  61   NYQTLKLNVDLLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFCNFNLNEDMYAPESIEL  120

Query  556  LRQCGIDFEKN  588
            L   G+DF+KN
Sbjct  121  LTHSGMDFKKN  131



>ref|XP_009131188.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 emb|CDX78405.1| BnaA03g03170D [Brassica napus]
Length=278

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   K DSI IREVW+ NL EEF LIRE+VD + ++AMDTEFPG+VL+PV  FK++ND 
Sbjct  1    MAETLKEDSITIREVWNDNLLEEFALIREIVDKFTYVAMDTEFPGVVLKPVETFKHNNDL  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIE  552
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCG  DK+C+WQFNFREF+  ED++AS+SIE
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDEDGNLPTCGADDKFCVWQFNFREFNIGEDIYASESIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQCGIDF+KN
Sbjct  121  LLRQCGIDFKKN  132



>emb|CDY12236.1| BnaC04g12660D [Brassica napus]
Length=412

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M++  + DSIQIREVW  NLE E DLIREVVDD+P+++MDTEFPGIV RP+ N K   +Y
Sbjct  1    MTMFLQGDSIQIREVWSDNLEAEMDLIREVVDDFPYVSMDTEFPGIVFRPLENIKTITEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            HY+TL+ NV+++K+IQLGLTFS+E GNLPTCG+DKYCIWQFNF +FDP   +   +SI+L
Sbjct  61   HYKTLRTNVNLMKMIQLGLTFSNESGNLPTCGSDKYCIWQFNFCDFDPVCSISNPESIKL  120

Query  556  LRQCGIDFEKN  588
            LR  GIDF+KN
Sbjct  121  LRDSGIDFKKN  131



>ref|XP_005843563.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
 gb|EFN51461.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
Length=290

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 1/127 (1%)
 Frame = +1

Query  208  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQT  387
            P  D++++REVW  NLE+E  LIR+VVDDYPF+AMDTEFPG+V RPVG+FKNS +YHYQT
Sbjct  14   PGGDTLRVREVWQDNLEQEMKLIRDVVDDYPFLAMDTEFPGVVARPVGSFKNSGEYHYQT  73

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            L+ NVDMLKLIQLGLTF+D +GNLP     + C+WQFNF+EF  ++D++A DSIELL+Q 
Sbjct  74   LRLNVDMLKLIQLGLTFTDAEGNLPRI-NGELCVWQFNFKEFRLSDDMYAQDSIELLKQS  132

Query  568  GIDFEKN  588
            GIDF +N
Sbjct  133  GIDFAQN  139



>gb|ACL53982.1| unknown [Zea mays]
 gb|AFW73867.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
Length=287

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 6/141 (4%)
 Frame = +1

Query  187  DWKMSLLPKSD-----SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  351
            D   +++PK D     S++IREVW  NLEEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  5    DLTATVIPKPDGADDESVEIREVWADNLEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  64

Query  352  NFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNED  528
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFDDARD  124

Query  529  VFASDSIELLRQCGIDFEKNT  591
            +FASDSIELLR+ GIDF +N 
Sbjct  125  IFASDSIELLRRSGIDFRRNA  145



>ref|XP_004954218.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=287

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 108/141 (77%), Gaps = 6/141 (4%)
 Frame = +1

Query  187  DWKMSLLPKSD-----SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  351
            D   +++PK D     S++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG
Sbjct  5    DPTAAVIPKPDGGDDESVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVG  64

Query  352  NFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNED  528
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G D + C+WQFNFREFD   D
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGADRRRCVWQFNFREFDDARD  124

Query  529  VFASDSIELLRQCGIDFEKNT  591
            +FASDSIELLR+ GIDF +N 
Sbjct  125  IFASDSIELLRRSGIDFRRNA  145



>ref|XP_002981023.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
 gb|EFJ17724.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
Length=285

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS  PK  S++IR+VW  NLEEE   IR +VD++P +AMDTEFPG+V+RPVGNF++  +Y
Sbjct  1    MSKFPKGGSLRIRDVWASNLEEEISFIRSIVDEFPLLAMDTEFPGVVVRPVGNFRSCAEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTL++NV+MLKLIQLGLTF D  GNLP C T +YC+WQFNFREF+  EDV A DSI+L
Sbjct  61   NYQTLRENVNMLKLIQLGLTFCDADGNLPRCNTGEYCVWQFNFREFNIREDVCAQDSIDL  120

Query  556  LRQCGIDFEKN  588
            L   GIDF KN
Sbjct  121  LCHSGIDFAKN  131



>ref|XP_002982500.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
 gb|EFJ16253.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
Length=287

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS  PK  S++IR+VW  NLEEE   IR +VD++P +AMDTEFPG+V+RPVGNF++  +Y
Sbjct  1    MSKFPKGGSLRIRDVWASNLEEEISFIRSIVDEFPLLAMDTEFPGVVVRPVGNFRSCAEY  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
            +YQTL++NV+MLKLIQLGLTF D  GNLP C T +YC+WQFNFREF+  EDV A DSI+L
Sbjct  61   NYQTLRENVNMLKLIQLGLTFCDADGNLPRCNTGEYCVWQFNFREFNIREDVCAQDSIDL  120

Query  556  LRQCGIDFEKN  588
            L   GIDF KN
Sbjct  121  LCHSGIDFAKN  131



>dbj|BAK01540.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
            K D ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWAENLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTFKSNADFNYATL  67

Query  391  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            K NVDMLKLIQLGLTFSDE+G LP  G D + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPDGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  568  GIDFEKNT  591
            GIDF ++ 
Sbjct  128  GIDFARHA  135



>ref|XP_002862886.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39145.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  271  LIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEK  450
            LIREVVDD+PF+AMDTEFPGIV RPVG FK + +YHY+TLK NV++LK+IQLGLTFSDEK
Sbjct  3    LIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEYHYETLKTNVNILKMIQLGLTFSDEK  62

Query  451  GNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKN  588
            GNLPTCGTD KYCIWQFNFREFD   D++A+DSIELLRQ GIDF KN
Sbjct  63   GNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQSGIDFAKN  109



>ref|XP_002452981.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
 gb|EES05957.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
Length=288

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 107/142 (75%), Gaps = 7/142 (5%)
 Frame = +1

Query  187  DWKMSLLPKSD------SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPV  348
            D   +++PK D      S++IREVW  NLEEEF LIR++VD++PF+AMDTEFPGIV RPV
Sbjct  5    DLTATMIPKPDEADDDESVEIREVWADNLEEEFALIRDIVDEFPFVAMDTEFPGIVCRPV  64

Query  349  GNFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNE  525
            G F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   
Sbjct  65   GAFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFDDAR  124

Query  526  DVFASDSIELLRQCGIDFEKNT  591
            D+FASDSIELLR+ GIDF +N 
Sbjct  125  DIFASDSIELLRRSGIDFRRNA  146



>ref|NP_001063181.1| Os09g0416800 [Oryza sativa Japonica Group]
 dbj|BAD28924.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD29264.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAF25095.1| Os09g0416800 [Oryza sativa Japonica Group]
 gb|EAZ09108.1| hypothetical protein OsI_31373 [Oryza sativa Indica Group]
 gb|EAZ44741.1| hypothetical protein OsJ_29372 [Oryza sativa Japonica Group]
 dbj|BAG89495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94386.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
            K D ++IREVW+ NLE EF +IRE+VDD+P++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWEDNLEAEFAVIREIVDDFPYVAMDTEFPGVVCRPLGTFKSNADFNYATL  67

Query  391  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            K NVDMLKLIQLGLTFS+E G LP+ G + + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSNEHGGLPSLGPEGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  568  GIDFEKNT  591
            GIDF +++
Sbjct  128  GIDFTRHS  135



>ref|XP_011395961.1| putative CCR4-associated factor 1-like protein 7 [Auxenochlorella 
protothecoides]
 gb|KFM23091.1| putative CCR4-associated factor 1-like protein 7 [Auxenochlorella 
protothecoides]
Length=293

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 104/127 (82%), Gaps = 1/127 (1%)
 Frame = +1

Query  208  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQT  387
            P  D++++REVW +NLEEE  LIRE++ D+P++AMDTEFPG+V +PVGNFK S ++HYQ 
Sbjct  19   PDGDTLRVREVWQHNLEEEMQLIRELISDFPYLAMDTEFPGVVAKPVGNFKKSREFHYQM  78

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            L+ NV+MLK+IQLGLTFSD  GNLP    ++ C+WQFNFREF  N+D++A DSIELL+Q 
Sbjct  79   LRLNVNMLKMIQLGLTFSDHLGNLPRI-NNELCVWQFNFREFRLNDDIYAQDSIELLKQS  137

Query  568  GIDFEKN  588
            GIDF +N
Sbjct  138  GIDFAQN  144



>ref|XP_006660627.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=280

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
            K D ++IREVW  NLE EF +IR++VD +P++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWADNLEAEFLVIRDIVDRFPYVAMDTEFPGVVCRPLGTFKSAADFNYATL  67

Query  391  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            K NVDMLKLIQLGLTFSDE+G LP  G + + C+WQFNFR FDP  DV ASDSIELLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPEGRPCVWQFNFRGFDPRNDVAASDSIELLRRS  127

Query  568  GIDFEKNT  591
            GIDF +++
Sbjct  128  GIDFARHS  135



>ref|XP_002460215.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
 gb|EER96736.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
Length=279

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
            K + ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K + +++Y TL
Sbjct  8    KPEDVEIREVWADNLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKTAAEFNYATL  67

Query  391  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            K NVDMLKLIQLGLTFSDE G LP  G D + C+WQFNFR FDP  DV ASDSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDEHGGLPALGADGRPCVWQFNFRGFDPRTDVAASDSIDLLRRS  127

Query  568  GIDFEKNT  591
            GIDF ++ 
Sbjct  128  GIDFSRHA  135



>gb|EEC74173.1| hypothetical protein OsI_09281 [Oryza sativa Indica Group]
Length=295

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  28   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  87

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GI
Sbjct  88   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGI  147

Query  574  DFEKNT  591
            DF +N+
Sbjct  148  DFRRNS  153



>dbj|BAD19081.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD19282.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
Length=293

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  26   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  85

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GI
Sbjct  86   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGI  145

Query  574  DFEKNT  591
            DF +N+
Sbjct  146  DFRRNS  151



>ref|NP_001048387.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAF10301.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAG88128.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99633.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57976.1| hypothetical protein OsJ_08719 [Oryza sativa Japonica Group]
Length=295

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  28   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  87

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GI
Sbjct  88   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGI  147

Query  574  DFEKNT  591
            DF +N+
Sbjct  148  DFRRNS  153



>ref|XP_005649974.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
 gb|EIE25430.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
Length=284

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 4/133 (3%)
 Frame = +1

Query  190  WKMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSN  369
            WK       + +++REVW  NL+EE ++IR VVDDYPF+AMDTEFPG+V RPVG FKNS 
Sbjct  7    WKTK---SGEDLRVREVWQENLDEELEIIRNVVDDYPFLAMDTEFPGVVARPVGPFKNSG  63

Query  370  DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSI  549
            +YHYQTL+ NVDMLKLIQLGLTFSD KG LP     + C+WQFNFREF  +ED+FA DSI
Sbjct  64   EYHYQTLRCNVDMLKLIQLGLTFSDAKGELPRW-KGELCVWQFNFREFKQSEDMFAQDSI  122

Query  550  ELLRQCGIDFEKN  588
            ELL+  GIDF +N
Sbjct  123  ELLKDSGIDFARN  135



>ref|NP_001136747.1| uncharacterized protein LOC100216888 [Zea mays]
 gb|ACF82526.1| unknown [Zea mays]
 gb|AFW64146.1| hypothetical protein ZEAMMB73_273082 [Zea mays]
Length=287

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +1

Query  187  DWKMSLLPK-----SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  351
            D   +++PK      +S++IREVW  N+EEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  5    DLTATVIPKLGEADDESVEIREVWADNMEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  64

Query  352  NFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNED  528
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPVLGAGRRRCVWQFNFREFDDARD  124

Query  529  VFASDSIELLRQCGIDFEKNT  591
            +FASDSIELLR+ GID   N 
Sbjct  125  IFASDSIELLRRSGIDLRLNA  145



>ref|XP_008676671.1| PREDICTED: uncharacterized protein LOC100216888 isoform X1 [Zea 
mays]
Length=308

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +1

Query  187  DWKMSLLPK-----SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  351
            D   +++PK      +S++IREVW  N+EEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  67   DLTATVIPKLGEADDESVEIREVWADNMEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  126

Query  352  NFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNED  528
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D
Sbjct  127  AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPVLGAGRRRCVWQFNFREFDDARD  186

Query  529  VFASDSIELLRQCGIDFEKNT  591
            +FASDSIELLR+ GID   N 
Sbjct  187  IFASDSIELLRRSGIDLRLNA  207



>gb|KIY93169.1| CCR4-NOT transcription complex subunit 7/8 [Monoraphidium neglectum]
Length=217

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
            K +++++REVWD NLE E  +IR ++D+YP++AMDTEFPG+V RPVGNFK+S +YHY+ L
Sbjct  15   KGETLRVREVWDDNLEAELVIIRSILDEYPYVAMDTEFPGVVARPVGNFKSSREYHYRAL  74

Query  391  KDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCG  570
            K NVDMLKLIQLGLTF+D +GNLP C   ++ +WQFNFR F   EDV+A DSIELL+Q G
Sbjct  75   KLNVDMLKLIQLGLTFTDAQGNLPVC-NGEHTVWQFNFRGFRLAEDVYAQDSIELLKQSG  133

Query  571  IDFEK  585
            IDF +
Sbjct  134  IDFSQ  138



>ref|NP_001132298.1| CCR4-NOT transcription complex subunit 7 isoform 1 [Zea mays]
 gb|ACF81091.1| unknown [Zea mays]
 gb|ACG42346.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
 tpg|DAA61464.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 1 [Zea 
mays]
 tpg|DAA61465.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 2 [Zea 
mays]
Length=279

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
            K + ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K++ +++Y TL
Sbjct  8    KPEDVEIREVWADNLETEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKSAAEFNYATL  67

Query  391  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            K NVDMLKLIQLGLT SDE G LP  G D + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTLSDEHGGLPALGPDGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  568  GIDFEKNT  591
            GIDF ++ 
Sbjct  128  GIDFSRHA  135



>dbj|BAJ92910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            + ++IREVW  NLE EF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  22   EPVEIREVWADNLEAEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  81

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
            NVDML LIQLGLTFS   G LP  G   + C+WQFNFREFD   D+FA+DSIELLR  GI
Sbjct  82   NVDMLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRHSGI  141

Query  574  DFEKNT  591
            DF +N 
Sbjct  142  DFRRNA  147



>ref|XP_002965900.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
 ref|XP_002983145.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ15954.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ33320.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
Length=274

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 106/132 (80%), Gaps = 5/132 (4%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS + K  +++IREVW  NLEEEF LIRE+VDD+P++AMDTEFPG+V+RP+G FK     
Sbjct  1    MSAVSKGTTLRIREVWAENLEEEFKLIREIVDDFPYLAMDTEFPGVVVRPIG-FKAGT--  57

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYC-IWQFNFREFDPNEDVFASDSIE  552
             YQ L+ NVD+LKLIQLGLTFSDE GNLPT G+ +   +WQFNFREF+  EDV+A DSIE
Sbjct  58   -YQMLRANVDLLKLIQLGLTFSDEDGNLPTFGSTRESYLWQFNFREFNIKEDVYAHDSIE  116

Query  553  LLRQCGIDFEKN  588
            LL+Q GIDF+KN
Sbjct  117  LLKQSGIDFQKN  128



>gb|EYU24605.1| hypothetical protein MIMGU_mgv1a011876mg [Erythranthe guttata]
Length=268

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M L P +DSI  REVW  NL++EF++IR ++DDY  +AMDTEFPG++L+P+  F N+N+ 
Sbjct  1    MYLQPPADSIDFREVWAENLDKEFEIIRSIIDDYYCVAMDTEFPGVILKPLRIFPNTNEE  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCG-TDKYCIWQFNFREFDPNEDVFASDSIE  552
            +YQ LK+NV+ +KLIQLGLT ++EKG+LPTCG T  + +WQFNFR+F+P+ED++ SDSI 
Sbjct  61   NYQCLKENVNTMKLIQLGLTLTNEKGDLPTCGETGLFIVWQFNFRDFNPSEDIYNSDSIH  120

Query  553  LLRQCGIDFEKNT  591
            LLR CGIDFEK+ 
Sbjct  121  LLRGCGIDFEKHV  133



>ref|XP_002890137.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66396.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 102/129 (79%), Gaps = 4/129 (3%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ----  384
            D+I+IREVW++NLEEE  LI + +DD+P++AMDTEFPG+V + V    + N  HY+    
Sbjct  12   DTIEIREVWNHNLEEEMALIEQAIDDFPYVAMDTEFPGVVCKTVTANPSPNPKHYEFNYE  71

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TLK NV+MLKLIQLGLT SDEKGNLPTCGT+K CIWQFNFREF+   D+FA DSI+LLR+
Sbjct  72   TLKTNVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFNLKSDMFAMDSIQLLRE  131

Query  565  CGIDFEKNT  591
              ID EKNT
Sbjct  132  SYIDLEKNT  140



>ref|NP_173044.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 ref|NP_973838.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9S9P2.1|CAF1B_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAF18489.1|AC010924_2 Similar to gi|Q60809 CCR4-associated factor 1 (CAF1) from Mus 
musculus. EST gb|Z26822 comes from this gene [Arabidopsis thaliana]
 gb|AAL86000.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 gb|AAM45088.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 dbj|BAH19897.1| AT1G15920 [Arabidopsis thaliana]
 gb|AEE29383.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AEE29384.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=286

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 102/130 (78%), Gaps = 6/130 (5%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSN------DYH  378
            D+I+IREVW++NLE+E  LI + +DD+P++AMDTEFPGIV + V    N N      +Y+
Sbjct  12   DTIEIREVWNHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPNPYSIHYEYN  71

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y TLK NV+MLKLIQLGLT SDEKGNLPTCGT+K CIWQFNFREF+   D+FA DSIELL
Sbjct  72   YDTLKANVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFNVISDMFALDSIELL  131

Query  559  RQCGIDFEKN  588
            R+  ID EKN
Sbjct  132  RKSAIDLEKN  141



>ref|XP_003056015.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59391.1| predicted protein [Micromonas pusilla CCMP1545]
Length=279

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = +1

Query  214  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLK  393
            SD++  REVW+ NL+EE  +IRE++DD+PF+AMDTEFPG+V RPVGN+K  +++ YQTL+
Sbjct  5    SDNLLTREVWEGNLDEELAVIREIIDDFPFVAMDTEFPGVVARPVGNYKLQSEHQYQTLR  64

Query  394  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
             NVDMLK+IQLGLT +D +GNLP  G + YC+WQFNFREF+  ED++A DSIELL+  GI
Sbjct  65   CNVDMLKIIQLGLTLTDARGNLPLIG-NFYCLWQFNFREFNLKEDLYAQDSIELLKHSGI  123

Query  574  DFEKN  588
            +F+ N
Sbjct  124  NFQAN  128



>ref|XP_007023404.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY26026.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
Length=236

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  310  MDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  489
            MDTEFPG+VLRP+GNFK   DY+YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCI
Sbjct  1    MDTEFPGVVLRPLGNFKYICDYNYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCI  60

Query  490  WQFNFREFDPNEDVFASDSIELLRQCGIDFEKN  588
            WQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN
Sbjct  61   WQFNFREFNVNEDVFANDSIELLRQSGIDFKKN  93



>ref|XP_003570299.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=295

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  223  IQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKDNV  402
            ++IREVW  NLE EF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK NV
Sbjct  30   VEIREVWADNLEAEFALIRDVVDEFPFVAMDTEFPGIVCRPVGVFRSPADYNYATLKANV  89

Query  403  DMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDF  579
            DML LIQLGLTFS   G LP  G   + C+WQFNFREFD   D+FA+DSIELLR  GI+F
Sbjct  90   DMLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFDDARDIFATDSIELLRHSGINF  149

Query  580  EKNT  591
              N 
Sbjct  150  RLNA  153



>ref|XP_006304066.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
 gb|EOA36964.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
Length=289

 Score =   171 bits (434),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = +1

Query  196  MSLLP----KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKN  363
            MS +P    + DSI+IREVW++NLEEE  LI + +DD+PF+AMDTEFPGIV + V    +
Sbjct  1    MSQVPNPKDEDDSIEIREVWNHNLEEEMALIEQAIDDFPFVAMDTEFPGIVCKTVTANPS  60

Query  364  SN----DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNED  528
             N    +Y+Y+TLK NV+MLKLIQLGLT SDE+GNLPTCGT +K CIWQFNFREF+   D
Sbjct  61   PNPKHYEYNYETLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSD  120

Query  529  VFASDSIELLRQCGIDFEKN  588
            +FA DSI+LLR   IDFEKN
Sbjct  121  MFAMDSIQLLRDSNIDFEKN  140



>ref|XP_001697447.1| CCR4-associated factor [Chlamydomonas reinhardtii]
 gb|EDP00109.1| CCR4-associated factor [Chlamydomonas reinhardtii]
Length=300

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
             + P  D++++REVW  N+E EF L+R++V+DYP+IAMDTEFPG+V +P+G FK+S +Y 
Sbjct  20   GITPAGDTLRVREVWADNMEVEFALLRDIVEDYPYIAMDTEFPGVVAKPIGTFKSSREYL  79

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            Y+ LK NVDMLKLIQLGLT +D KG LP     + C+WQFNF+ F  ++DV+A DSIELL
Sbjct  80   YKALKMNVDMLKLIQLGLTLTDAKGTLPRAANGELCVWQFNFKGFKLSDDVYAQDSIELL  139

Query  559  RQCGIDF  579
            +Q GIDF
Sbjct  140  KQSGIDF  146



>ref|XP_010932239.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=270

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +1

Query  196  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            MS+  KSD S++IREVW  NLE EF +IRE+VD+YPFIAMDTEFPG+ + PV  FKN +D
Sbjct  1    MSIPAKSDESVEIREVWADNLEVEFAVIREIVDEYPFIAMDTEFPGVAITPVRAFKNISD  60

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLP--TCGTDKYCIWQFNFREFDPNEDVFASDS  546
             HYQTL+ NVD+L LIQ+G+TFSD  G LP    G    C+WQFNFREFDP+ DV   DS
Sbjct  61   QHYQTLRANVDLLHLIQVGITFSDASGCLPPSPSGGGLRCVWQFNFREFDPDRDVSNPDS  120

Query  547  IELLRQCGIDFEKN  588
            I+LLR+ GIDF KN
Sbjct  121  IDLLRRSGIDFVKN  134



>ref|XP_004138705.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Cucumis sativus]
 ref|XP_004160760.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Cucumis sativus]
Length=236

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  310  MDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  489
            MDTEFPG+VLRP+G FKN ND++Y+TLKDNV+MLKLIQLGLTFSDE GNLPTCGTDK+CI
Sbjct  1    MDTEFPGVVLRPLGTFKNINDFNYRTLKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCI  60

Query  490  WQFNFREFDPNEDVFASDSIELLRQCGIDFEKN  588
            WQFNFREF+   D+FASDSIELLRQCGIDF+KN
Sbjct  61   WQFNFREFNIGSDIFASDSIELLRQCGIDFQKN  93



>ref|XP_003578122.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=279

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
            K D ++IREVW  NLE EF +IRE+VDDYP++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDDVEIREVWAENLEAEFAVIREIVDDYPYVAMDTEFPGVVCRPLGTFKSAADFNYATL  67

Query  391  KDNVDMLKLIQLGLTFSDEK-GNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            K NVDMLKLIQLGLTFSDE+ G        + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPGGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  568  GIDFEKNT  591
            GIDF ++ 
Sbjct  128  GIDFARHA  135



>ref|XP_010048148.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80311.1| hypothetical protein EUGRSUZ_C01670 [Eucalyptus grandis]
Length=281

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = +1

Query  193  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLR--PVGNFKNS  366
            KM +    +S+ IREVW++NLEEEF LI E+VD + ++A+D EFPG+V R   + N KN 
Sbjct  5    KMPMPLTDESLVIREVWNHNLEEEFALIGEIVDKFNYVAVDAEFPGVVFRLPSLENIKNM  64

Query  367  NDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDS  546
             DY+YQT+K+NVD LKLIQLGLTF D++GNLPTCGTDKYCIWQFNFR FD  +D F   S
Sbjct  65   RDYNYQTMKNNVDKLKLIQLGLTFLDDEGNLPTCGTDKYCIWQFNFRGFDVTKDEFDGGS  124

Query  547  IELLRQCGIDFEKN  588
            IE L + GIDF+KN
Sbjct  125  IEWLHERGIDFKKN  138



>ref|XP_006648046.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=297

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +1

Query  241  WDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVDMLKLI  420
            W  NLE+EF LIR+VVD +PF+AMDTEFPGIV RPVG F++S DY+Y TLK NVDML LI
Sbjct  38   WADNLEKEFALIRDVVDKFPFVAMDTEFPGIVCRPVGAFRSSADYNYATLKANVDMLHLI  97

Query  421  QLGLTFSDEKGNLPTCG-TDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNT  591
            QLGLTFS  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GIDF +N 
Sbjct  98   QLGLTFSGPRGELPVMGDGRRRCVWQFNFREFDDAHDIFASDSIELLRRSGIDFRRNA  155



>gb|EMS59499.1| putative CCR4-associated factor 1-like protein 7 [Triticum urartu]
Length=294

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            + ++IREVW  NLE EF +IR+VVDDYP+IAMDTEFPGIV RP+G+F+++++Y+Y TLK 
Sbjct  20   EGVEIREVWANNLEAEFAVIRDVVDDYPYIAMDTEFPGIVCRPLGSFRSNDEYNYATLKA  79

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
            NVDML LIQLGLT SDE G LP  GT  + C WQFNFR FDP  D   +DSI+LLR  GI
Sbjct  80   NVDMLSLIQLGLTLSDENGALPARGTGGRPCAWQFNFRGFDPRSDPANADSIDLLRNSGI  139

Query  574  DFEKNT  591
            DF++ T
Sbjct  140  DFDRFT  145



>ref|XP_010497514.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=287

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 100/129 (78%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSN----DYHYQ  384
            ++I+IREVW +NLE+E  LI + +DD+P++AMDTEFPGIV + V    N N    +Y+Y 
Sbjct  14   NTIEIREVWSHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPNPKHYEYNYG  73

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLR  561
            TLK NV+MLKLIQLGLT SDE+GNLPTCGT+K  CIWQFNFREF+   D+FA DSI LLR
Sbjct  74   TLKTNVNMLKLIQLGLTLSDERGNLPTCGTNKRQCIWQFNFREFNLKSDMFAMDSINLLR  133

Query  562  QCGIDFEKN  588
               IDFEKN
Sbjct  134  GSNIDFEKN  142



>ref|XP_010476692.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 5/130 (4%)
 Frame = +1

Query  214  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSN----DYHY  381
            +++I+IREVW +NLE E  LI + +DD+P++AMDTEFPGIV + V    N N    +Y+Y
Sbjct  14   NNTIEIREVWSHNLEAEMALIEKSIDDFPYVAMDTEFPGIVCKTVTTNPNPNPKHYEYNY  73

Query  382  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELL  558
             TLK NV+MLKLIQLGLT SDE+GNLPTCGT +K CIWQFNFREF+   D+FA DSI LL
Sbjct  74   GTLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSINLL  133

Query  559  RQCGIDFEKN  588
            R   IDFEKN
Sbjct  134  RGSNIDFEKN  143



>ref|XP_004956826.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=279

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
            K D ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K++ +++Y TL
Sbjct  8    KPDDVEIREVWADNLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKSAAEFNYATL  67

Query  391  KDNVDMLKLIQLGLTFSDEK-GNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            K NVDMLKLIQLGLTFSDE  G        + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDEHGGLPALGPGGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  568  GIDFEKN  588
            GIDF ++
Sbjct  128  GIDFARH  134



>ref|XP_002950174.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
 gb|EFJ48842.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
Length=320

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  202  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHY  381
            L    +++++REVW+ NLE EF LIR+ VD YP++AMDTEFPG+V +P+G FK+S +Y Y
Sbjct  6    LTATGETLRVREVWEDNLEAEFTLIRDFVDQYPYVAMDTEFPGVVAKPLGPFKSSREYLY  65

Query  382  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLR  561
            + LK NVDMLKLIQLGLTF+D KGNLP     + C+WQFNF+ F   +DV+A DSIELL+
Sbjct  66   RALKMNVDMLKLIQLGLTFTDAKGNLPRA-NGELCVWQFNFKGFRLADDVYAQDSIELLK  124

Query  562  QCGIDFEKN  588
            Q GIDF  +
Sbjct  125  QSGIDFATH  133



>ref|XP_010541577.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X2 [Tarenaya hassleriana]
Length=238

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  310  MDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  489
            MDTEFPG+VLRP+G FKN ++Y+Y+TLK+NVDMLKLIQLGLTFSDE GNLPTCGTDK+CI
Sbjct  1    MDTEFPGVVLRPLGPFKNISEYNYKTLKENVDMLKLIQLGLTFSDEDGNLPTCGTDKFCI  60

Query  490  WQFNFREFDPNEDVFASDSIELLRQCGIDFEKN  588
            WQFNFREF+P+ED++ ++SI+LL QCGIDF+KN
Sbjct  61   WQFNFREFNPSEDIYVNESIDLLHQCGIDFKKN  93



>gb|KCW53891.1| hypothetical protein EUGRSUZ_J03104, partial [Eucalyptus grandis]
Length=240

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 20/130 (15%)
 Frame = +1

Query  199  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYH  378
            SLLPKSDSI IR+V + NLE+EF+LIR +V+DY ++AMDTEFPG+VLRPVG+F++ NDYH
Sbjct  2    SLLPKSDSIHIRKVCNDNLEQEFELIRAIVNDYLYVAMDTEFPGVVLRPVGSFQSPNDYH  61

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  558
            YQTLKDNV++LKLI+LGLT  DEK NLPTC TD                    +DSIELL
Sbjct  62   YQTLKDNVNLLKLIRLGLTLFDEKENLPTCRTD--------------------NDSIELL  101

Query  559  RQCGIDFEKN  588
            +QCGIDF KN
Sbjct  102  KQCGIDFRKN  111



>ref|XP_003074753.1| Caf1 CCR4-associated (transcription) factor, putative (IC) [Ostreococcus 
tauri]
Length=275

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  214  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLK  393
            + +++ R+VW +NL+EE  LIRE+V  YPF+AMDTEFPGIV RPVG+FK+ +++ YQTL+
Sbjct  5    ASNLRTRDVWAHNLDEECTLIREIVSAYPFVAMDTEFPGIVARPVGSFKHQSEFQYQTLR  64

Query  394  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCG  570
             NVDMLKLIQLGLTF+D  GNLP    D Y CIWQFNFREF   ++++A DSIELL+  G
Sbjct  65   CNVDMLKLIQLGLTFTDADGNLPL--IDGYHCIWQFNFREFSLKDELYAQDSIELLKHSG  122

Query  571  IDF  579
            IDF
Sbjct  123  IDF  125



>ref|XP_001416204.1| polyA tail-shortening ribonuclease, probable [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94497.1| polyA tail-shortening ribonuclease, probable [Ostreococcus lucimarinus 
CCE9901]
Length=276

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS      ++  R+VW +NL+EE  LIREVV +YP++AMDTEFPG+V RPVG+FK+  ++
Sbjct  1    MSSALTPSTLHTRDVWAHNLDEECALIREVVCNYPYVAMDTEFPGVVARPVGSFKHQAEF  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  555
             YQTL+ NVD+LKLIQLGLTFSD  GNLP     ++CIWQFNF+EF+  ++++A DSIEL
Sbjct  61   QYQTLRCNVDLLKLIQLGLTFSDGAGNLPVV-DGRFCIWQFNFKEFNVKDELYAQDSIEL  119

Query  556  LRQCGIDF  579
            L++ GIDF
Sbjct  120  LKESGIDF  127



>ref|XP_002507260.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68518.1| predicted protein [Micromonas sp. RCC299]
Length=273

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = +1

Query  214  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLK  393
            +D++  REVW  NL+EE  +IR ++D+YP+IAMDTEFPG+V RPVG ++  +DY YQTL+
Sbjct  8    NDNLLTREVWGSNLDEELAIIRNLIDEYPYIAMDTEFPGVVARPVGTYR--SDYQYQTLR  65

Query  394  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
             NVD+LKLIQLG+T +D  GNLP      YC+WQFNFREFD  ED++A DSIELL+  GI
Sbjct  66   CNVDLLKLIQLGITLTDGDGNLPLI-AGHYCVWQFNFREFDLKEDMYAQDSIELLKHSGI  124

Query  574  DFEKN  588
            DF+ N
Sbjct  125  DFDAN  129



>gb|KFK43832.1| hypothetical protein AALP_AA1G179300 [Arabis alpina]
Length=272

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            MS+  +  SI+IR+VWD N+E+E  LI + VDD+P++AMDTEFPGIV + V    +    
Sbjct  1    MSVDDEDSSIEIRQVWDKNVEQELSLISQYVDDFPYVAMDTEFPGIVCKSVTVDPSPRRN  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIE  552
             Y++LK NV+ML LIQLGLT SD++GNLPTCGT +K C+WQFNFREF+   D+FA DSIE
Sbjct  61   CYESLKTNVNMLNLIQLGLTLSDDQGNLPTCGTNNKQCVWQFNFREFNLKTDMFAIDSIE  120

Query  553  LLRQCGIDFEKN  588
            LLRQ G+DF KN
Sbjct  121  LLRQSGMDFAKN  132



>ref|XP_006665053.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=300

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +1

Query  241  WDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVDMLKLI  420
            W  NLE+EF LIR+VVD +PF+AMDTEFP IV RP+G F++S DY+Y TLK NVDML LI
Sbjct  41   WADNLEKEFVLIRDVVDGFPFVAMDTEFPSIVCRPIGAFRSSADYNYATLKANVDMLHLI  100

Query  421  QLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNT  591
            QLGLTFS  +G LP  G D + C+WQFNF EFD   D+FASDSIELLR+ G+DF +N 
Sbjct  101  QLGLTFSGPRGELPALGDDRRRCVWQFNFCEFDDARDIFASDSIELLRRSGLDFRRNA  158



>gb|ACQ77596.1| CCR4-NOT [Dimocarpus longan]
Length=199

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 4/127 (3%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLR---PVGNFKNSNDYHYQT  387
            D+I+IREVWD+NLE EF+LIR+V+D YP+I+MDTEFPGI+ R   P  + +  +D HY+ 
Sbjct  9    DTIKIREVWDFNLESEFELIRQVIDHYPYISMDTEFPGIIYRSSKPYHSQRQPSD-HYEL  67

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            LK NVD L LIQ+GLT SD  GNLP  GTD   IWQFNFR+FD   D  A DSI+LLR+ 
Sbjct  68   LKSNVDALNLIQVGLTLSDSSGNLPDLGTDNQFIWQFNFRDFDVASDAHAPDSIDLLRRQ  127

Query  568  GIDFEKN  588
            GIDFE+N
Sbjct  128  GIDFERN  134



>dbj|BAD09890.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD09904.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 gb|EAZ42877.1| hypothetical protein OsJ_27470 [Oryza sativa Japonica Group]
 dbj|BAG96259.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97485.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98767.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            + ++IREVW  NLE E   IR+ VD YP++AMDTEFPGIV RPVGNF+ +++++Y  L+ 
Sbjct  14   EGVEIREVWAGNLEAEIAAIRDEVDRYPYVAMDTEFPGIVCRPVGNFRTTDEFNYANLEA  73

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
            NV+MLKLIQLGLT SDE G+LP  GT  + CIWQFNFR FDP  D   +DSI++LR CGI
Sbjct  74   NVNMLKLIQLGLTLSDEGGDLPRRGTGGRRCIWQFNFRGFDPRTDPSNADSIQMLRTCGI  133

Query  574  DFEK  585
            DF++
Sbjct  134  DFDR  137



>ref|XP_006416864.1| hypothetical protein EUTSA_v10008404mg [Eutrema salsugineum]
 gb|ESQ35217.1| hypothetical protein EUTSA_v10008404mg [Eutrema salsugineum]
Length=284

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 5/134 (4%)
 Frame = +1

Query  202  LLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKN--SND  372
            ++PK D SI+IREVW+ NL  E  LI + ++ +P++AMDTEFPGIV + V   +N   N+
Sbjct  1    MVPKEDDSIEIREVWNENLGAEMSLISQAINHFPYVAMDTEFPGIVCKTVTTDENPKRNE  60

Query  373  YH-YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDS  546
            ++ Y++L+ NV+ML LIQLGLT SDE+GNLPTCGT+ K C+WQFNFREF+   DVFA DS
Sbjct  61   FNCYESLRTNVNMLNLIQLGLTLSDEQGNLPTCGTNNKQCVWQFNFREFNLKTDVFAMDS  120

Query  547  IELLRQCGIDFEKN  588
            IELLRQ GIDF KN
Sbjct  121  IELLRQSGIDFAKN  134



>emb|CDS05253.1| Putative CCR4-NOT transcription complex subunit7 [Absidia idahoensis 
var. thermophila]
Length=253

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +  SDS  IREVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G F+ S+DYHYQ
Sbjct  1    MHASDSNYIREVWADNLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGTFRTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TL+ NVD+LK+IQLG+TF+DE GNLP       C WQFNF+ F+  +D++A DSIELL +
Sbjct  61   TLRCNVDLLKIIQLGVTFADEHGNLPR----NVCTWQFNFK-FNIADDMYAQDSIELLTK  115

Query  565  CGIDFEKN  588
             GIDF+K+
Sbjct  116  SGIDFQKH  123



>gb|ADE10053.1| CAF1 superfamily protein [Tremella fuciformis]
Length=159

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = +1

Query  208  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQT  387
            P+S    I EVW  NLE EF  +R  +D YP+++MDTEFPGIV+RP+GNFK  +DYH+QT
Sbjct  7    PESKDYGIHEVWADNLETEFAAMRAAIDQYPYVSMDTEFPGIVVRPIGNFKTGSDYHFQT  66

Query  388  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  567
            ++ NVD+LK+IQLG+T SDE+GN P   T     WQFNF  F+ +ED++A DSIELLR  
Sbjct  67   MRTNVDVLKIIQLGITLSDEQGNSPEVST-----WQFNF-AFNLSEDMYAPDSIELLRNS  120

Query  568  GIDFEKN  588
            GIDF++N
Sbjct  121  GIDFKRN  127



>gb|ABK21469.1| unknown [Picea sitchensis]
Length=236

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  310  MDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  489
            MDTEFPGIV+RPVGNFK ++++HY TLK NVD+L LIQLGLTFSDE GNLP CGTDKYCI
Sbjct  1    MDTEFPGIVVRPVGNFKTASEFHYYTLKSNVDVLNLIQLGLTFSDEDGNLPRCGTDKYCI  60

Query  490  WQFNFREFDPNEDVFASDSIELLRQCGIDFEKN  588
            WQFNFREF+ ++D++ASDSIELL+Q GIDF+KN
Sbjct  61   WQFNFREFNLDKDMYASDSIELLQQSGIDFKKN  93



>ref|XP_004354599.1| CAF1 family protein [Dictyostelium fasciculatum]
 gb|EGG16215.1| CAF1 family protein [Dictyostelium fasciculatum]
Length=405

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 100/124 (81%), Gaps = 5/124 (4%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            D+ +IREVW +NLEEE  LIRE+VDDY +IAMDTEFPGIV RPVG+F+  +DYHYQTL+ 
Sbjct  10   DTDEIREVWAHNLEEEMALIRELVDDYNYIAMDTEFPGIVTRPVGSFRTPSDYHYQTLRL  69

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGID  576
            NVD+LK+IQLGLTFSD  GNL +      C WQFNF+ F+ NED++A DSI+LL + GI+
Sbjct  70   NVDLLKIIQLGLTFSDSDGNLAS----NTCTWQFNFK-FNLNEDMYAQDSIDLLSRSGIE  124

Query  577  FEKN  588
            F+KN
Sbjct  125  FKKN  128



>ref|XP_008796886.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=270

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = +1

Query  196  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSND  372
            MS+  K+D +++IREVW  NLE E  +IR++VD YPF+AMDTEFPG+ + PV  FK+  D
Sbjct  1    MSIPAKTDDAVEIREVWADNLEAEITVIRDIVDQYPFVAMDTEFPGVAITPVRAFKDIAD  60

Query  373  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPT--CGTDKYCIWQFNFREFDPNEDVFASDS  546
             +YQTL+ NVD+L LIQ+G TFSD  G LP    G  + C+WQFNFREFD + DV   DS
Sbjct  61   KNYQTLRANVDLLHLIQIGFTFSDAAGRLPLSPSGGGRRCVWQFNFREFDVDHDVANPDS  120

Query  547  IELLRQCGIDFEKN  588
            I+LLR+ GIDF+KN
Sbjct  121  IDLLRRSGIDFKKN  134



>emb|CDS11386.1| Putative CCR4-NOT transcription complex subunit7 [Absidia idahoensis 
var. thermophila]
Length=253

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +  +DS  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G F+ S+DYHYQ
Sbjct  1    MHANDSAYIKEVWSENLEEEMAHLRDLVEEYPYLAMDTEFPGVVARPIGTFRTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TL+ NVD+LK+IQLG+TF+DE GNLP       C WQFNF+ F  +ED++A DSIELL +
Sbjct  61   TLRCNVDVLKIIQLGITFADEHGNLPR----NICTWQFNFK-FSLSEDMYAQDSIELLTK  115

Query  565  CGIDFEKN  588
             GIDF+K+
Sbjct  116  SGIDFKKH  123



>ref|XP_007509231.1| Caf1 CCR4-associated (transcription) factor 1 [Bathycoccus prasinos]
 emb|CCO19688.1| Caf1 CCR4-associated (transcription) factor 1 [Bathycoccus prasinos]
Length=273

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +1

Query  214  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLK  393
            S ++  REVW  NL+EE  +IR++V  +P+IAMDTEFPG+V RPVG FK  +++HYQTLK
Sbjct  5    SYNLLTREVWSDNLDEEVAIIRKLVQAFPYIAMDTEFPGVVARPVGAFKQQSEFHYQTLK  64

Query  394  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
             NVDMLKLIQLGLT +D  GNLP     +YC+WQFNF EF+  +D++A DSIELL+Q GI
Sbjct  65   CNVDMLKLIQLGLTLTDANGNLPII-DGRYCLWQFNFGEFNLKDDMYARDSIELLKQSGI  123

Query  574  DF  579
            DF
Sbjct  124  DF  125



>emb|CEI89573.1| Putative CCR4-NOT transcription complex subunit 7 [Rhizopus microsporus]
Length=253

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +P +D   I+EVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G+FK S+DYHYQ
Sbjct  1    MPVNDVKYIKEVWAENLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGSFKTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+ F   +D++A DSIELL +
Sbjct  61   TLRCNVDLLKIIQLGVTFADQHGNLP----GNVCTWQFNFK-FSLTDDMYAQDSIELLTK  115

Query  565  CGIDFEKN  588
             GIDF+K+
Sbjct  116  SGIDFKKH  123



>emb|CDH53595.1| caf1 family protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=302

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +  +DS  IREVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G F+ S+DYHYQ
Sbjct  1    MHANDSNYIREVWADNLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGTFRTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TL+ NVD+LK+IQLG+TF+DE GNLP       C WQFNF+ F+  +D++A DSIELL +
Sbjct  61   TLRCNVDLLKIIQLGVTFADEHGNLPR----NVCTWQFNFK-FNIADDMYAQDSIELLTK  115

Query  565  CGIDFEKN  588
             GIDF+K+
Sbjct  116  SGIDFQKH  123



>emb|CEG62914.1| Putative CCR4-NOT transcription complex subunit 7 [Rhizopus microsporus]
Length=291

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +P +D   I+EVW  NLEEE   +R++V+DYP++AMDTEFPG+V RP+G+FK S+DYHYQ
Sbjct  1    MPVNDVKYIKEVWAENLEEEMAYLRDLVEDYPYLAMDTEFPGVVARPIGSFKTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+ F   +D++A DSIELL +
Sbjct  61   TLRCNVDLLKIIQLGVTFADQHGNLP----GNVCTWQFNFK-FSLTDDMYAQDSIELLTK  115

Query  565  CGIDFEKN  588
             GIDF+K+
Sbjct  116  SGIDFKKH  123



>ref|XP_009395283.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   158 bits (399),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +1

Query  205  LPKSD---SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            + KSD    ++IR+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MSKSDDDAGVEIRDVWADNLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIE  552
            +Y  L+ NVD+L LIQLGLTFSD +GNLP   T  +  +WQFNFREFD + D+   DSI+
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDAEGNLPATATGGRPIVWQFNFREFDVDRDISNPDSID  120

Query  553  LLRQCGIDFEKN  588
            LLR+  IDF++N
Sbjct  121  LLRKSDIDFKRN  132



>ref|XP_010459127.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 99/131 (76%), Gaps = 7/131 (5%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSN------DYH  378
            ++I+IREVW +NLE E   I + +DD+P++AMDTEFPGIV + V    N N      +Y+
Sbjct  14   NTIEIREVWHHNLEAEMARIEQYIDDFPYVAMDTEFPGIVCKTVTTNPNPNPNPKHYEYN  73

Query  379  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIEL  555
            Y+TLK NV+MLKLIQLGLT SDE+GNLPTCGT +K CIWQFNFREF+   D+FA DSI L
Sbjct  74   YETLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSINL  133

Query  556  LRQCGIDFEKN  588
            LR   IDFEKN
Sbjct  134  LRGSNIDFEKN  144



>emb|CEP13830.1| hypothetical protein [Parasitella parasitica]
Length=302

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 102/128 (80%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +P +D+  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G FK S+DYHYQ
Sbjct  1    MPVNDAKYIKEVWAENLEEEMAYLRDLVEEYPYLAMDTEFPGVVARPIGTFKTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+ F+ ++D++A DSIELL +
Sbjct  61   TLRCNVDLLKIIQLGVTFADQYGNLP----GNICTWQFNFK-FNLSDDMYAQDSIELLTK  115

Query  565  CGIDFEKN  588
             GIDF+K+
Sbjct  116  SGIDFKKH  123



>gb|EPB85653.1| CCR4-NOT transcription complex subunit 7 [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=253

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 102/128 (80%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +P +D+  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G FK S+DYHYQ
Sbjct  1    MPVNDAKYIKEVWAENLEEEMAHLRDLVEEYPYLAMDTEFPGVVARPIGTFKTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+ F+ ++D++A DSIELL +
Sbjct  61   TLRCNVDLLKIIQLGVTFADQYGNLP----GNICTWQFNFK-FNLSDDMYAQDSIELLTK  115

Query  565  CGIDFEKN  588
             GIDF+K+
Sbjct  116  SGIDFKKH  123



>emb|CDH54244.1| ccr4-not transcription complex subunit 7 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=303

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +  +DS  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G F+ S+DYHYQ
Sbjct  1    MHANDSAYIKEVWSENLEEEMAHLRDLVEEYPYLAMDTEFPGVVARPIGTFRTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            TL+ NVD+LK+IQLG+TF+DE GN+P       C WQFNF+ F  +ED++A DSIELL +
Sbjct  61   TLRCNVDVLKIIQLGITFADEHGNIPR----NICTWQFNFK-FSLSEDMYAQDSIELLTK  115

Query  565  CGIDFEKN  588
             GIDF+K+
Sbjct  116  SGIDFKKH  123



>ref|NP_001140241.1| uncharacterized protein LOC100272282 [Zea mays]
 gb|ACF83416.1| unknown [Zea mays]
 gb|ACG35731.1| CCR4-NOT transcription complex subunit 8 [Zea mays]
 tpg|DAA48917.1| TPA: CCR4-NOT transcription complex subunit 8 [Zea mays]
Length=286

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 5/134 (4%)
 Frame = +1

Query  196  MSLLPKS----DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKN  363
            M+ LP +    D+++IREVW  NLEEEF +IR VVD YP++AMDTEFPG V+ P   ++ 
Sbjct  1    MAALPPAAEDPDAVEIREVWASNLEEEFAVIRAVVDVYPYVAMDTEFPGFVVTPSAEYRF  60

Query  364  SNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFAS  540
            + D +Y  L+ NV++LKLIQLGLT S+  G LP CGT  + CIWQFNFR FDP+ D  +S
Sbjct  61   TCDRNYAALEGNVNVLKLIQLGLTLSNGAGALPPCGTGGRRCIWQFNFRGFDPHTDPSSS  120

Query  541  DSIELLRQCGIDFE  582
            DSI+LLR+ GIDF+
Sbjct  121  DSIDLLRRSGIDFD  134



>gb|KIY68330.1| CAF1-domain-containing protein [Cylindrobasidium torrendii FP15055 
ss-10]
Length=329

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 98/122 (80%), Gaps = 7/122 (6%)
 Frame = +1

Query  226  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVD  405
            +IR+VW  NLE E  +IR+V+D YP+IAMDTEFPG+V RP+GNF+ S+DYHYQT++ NVD
Sbjct  3    RIRDVWSPNLEAEMQVIRDVIDKYPYIAMDTEFPGVVARPIGNFRTSSDYHYQTMRCNVD  62

Query  406  MLKLIQLGLTFSDEKGNLPT-CGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFE  582
            +LK+IQ+G+TF+DE GN P  C T     WQFNFR F  NED+FA DSIELL++ G+DF+
Sbjct  63   LLKIIQVGITFADEDGNSPPECST-----WQFNFR-FSINEDMFAPDSIELLQKSGLDFQ  116

Query  583  KN  588
            ++
Sbjct  117  RH  118



>gb|KDP38660.1| hypothetical protein JCGZ_04013 [Jatropha curcas]
Length=263

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 99/128 (77%), Gaps = 3/128 (2%)
 Frame = +1

Query  211  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTL  390
             SDSI I+EVW++NLEEEF  IR +V+D+P+IA+DTEFPG +L+   N  +S    Y  +
Sbjct  2    SSDSITIKEVWEHNLEEEFVRIRAIVEDFPYIALDTEFPGFLLQRNQNV-DSTTSDYMIV  60

Query  391  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSIELLRQ  564
            ++NV++ +LIQLGLTFSDE+GNLPTC TD  KYC+WQFNFREFDPN       SI+LL++
Sbjct  61   QNNVNLCRLIQLGLTFSDERGNLPTCETDSTKYCVWQFNFREFDPNLHCKVEKSIKLLKE  120

Query  565  CGIDFEKN  588
             GIDF+KN
Sbjct  121  SGIDFQKN  128



>ref|XP_002444415.1| hypothetical protein SORBIDRAFT_07g021610 [Sorghum bicolor]
 gb|EES13910.1| hypothetical protein SORBIDRAFT_07g021610 [Sorghum bicolor]
Length=286

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            D+++IREVW  NLEEEF +IR VVD YP++AMDTEFPG V++P   ++ + D +Y  L+ 
Sbjct  12   DAVEIREVWAGNLEEEFAVIRAVVDAYPYVAMDTEFPGFVVKPSAEYRFTCDRNYAALEG  71

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
            NV++LKLIQLGLT S+  G LP CGT  + CIWQFNFR FDP+ D  ++DSI+LLR+ GI
Sbjct  72   NVNVLKLIQLGLTLSNGAGALPPCGTGGRGCIWQFNFRGFDPHTDPSSNDSIDLLRRSGI  131

Query  574  DFEK  585
            DF++
Sbjct  132  DFDR  135



>ref|XP_009395282.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 4/132 (3%)
 Frame = +1

Query  205  LPKSD---SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            + KSD    ++ R+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MSKSDDAAGVEFRDVWADNLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIE  552
            +Y  L+ NVD+L LIQLGLTFSD +GNLP   T  +  +WQFNFREFD + D+   DSI+
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDAEGNLPASATGGRPIVWQFNFREFDVDRDISNPDSID  120

Query  553  LLRQCGIDFEKN  588
            LLR+  IDF++N
Sbjct  121  LLRKSDIDFKRN  132



>ref|NP_001131670.1| uncharacterized protein LOC100193030 [Zea mays]
 gb|ACF80187.1| unknown [Zea mays]
 gb|ACG39078.1| CCR4-NOT transcription complex subunit 8 [Zea mays]
 gb|ACN28229.1| unknown [Zea mays]
 gb|AFW62305.1| CCR4-NOT transcription complex subunit 8 [Zea mays]
Length=280

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +1

Query  214  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLK  393
            + +++IREVW  NLEEEF++IR+VVD YP++ MDTEFPG V++P+  ++ + D  Y  L+
Sbjct  5    APAVEIREVWASNLEEEFEVIRDVVDAYPYVGMDTEFPGFVVQPIAEYRFTCDRIYAGLE  64

Query  394  DNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCG  570
             NV++LKLIQLGLTFS+E G LP CGT  + CIWQFNFR F+P+ D ++ DSI+LLR+ G
Sbjct  65   GNVNVLKLIQLGLTFSNEAGTLPPCGTGGQCCIWQFNFRGFNPHTDPYSPDSIDLLRRSG  124

Query  571  IDFE  582
            IDF+
Sbjct  125  IDFD  128



>gb|ACL52816.1| unknown [Zea mays]
Length=280

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +1

Query  214  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLK  393
            + +++IREVW  NLEEEF++IR+VVD YP++ MDTEFPG V++P+  ++ + D  Y  L+
Sbjct  5    APAVEIREVWASNLEEEFEVIRDVVDAYPYVGMDTEFPGFVVQPIAEYRFTCDRIYAGLE  64

Query  394  DNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCG  570
             NV++LKLIQLGLTFS+E G LP CGT  + CIWQFNFR F+P+ D ++ DSI+LLR+ G
Sbjct  65   GNVNVLKLIQLGLTFSNEAGTLPPCGTGGQCCIWQFNFRGFNPHTDPYSPDSIDLLRRSG  124

Query  571  IDFE  582
            IDF+
Sbjct  125  IDFD  128



>ref|XP_007877414.1| hypothetical protein PFL1_01713 [Pseudozyma flocculosa PF-1]
 gb|EPQ30814.1| hypothetical protein PFL1_01713 [Pseudozyma flocculosa PF-1]
Length=326

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 5/121 (4%)
 Frame = +1

Query  226  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVD  405
            +IREVW  NLE E  L+RE +D YP++AMDTEFPGIV RP+G FK S+DYHYQTL+ NVD
Sbjct  4    RIREVWAENLESEMALLRETIDKYPYVAMDTEFPGIVARPIGTFKGSSDYHYQTLRCNVD  63

Query  406  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEK  585
            +LKLIQLG+T  DE GNLP     + C WQFNFR F  NED+ A DS++LL + G+DF++
Sbjct  64   LLKLIQLGITLCDENGNLPP----EVCTWQFNFR-FSVNEDMCAPDSLDLLTKAGLDFDR  118

Query  586  N  588
            +
Sbjct  119  H  119



>ref|XP_009396102.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +1

Query  196  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY  375
            M+   ++ +++IR+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MAKTAEAAAVEIRDVWAENLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  376  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC-GTDKYCIWQFNFREFDPNEDVFASDSIE  552
            +Y  L+ NVD+L LIQLGLTFSD  GN P    + +  +WQFNFREFD + D+   DSI+
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDADGNFPASPDSARPIVWQFNFREFDVDGDISNPDSID  120

Query  553  LLRQCGIDFEKN  588
            LL++ GIDF +N
Sbjct  121  LLQKSGIDFARN  132



>gb|AGT16865.1| transcription complex [Saccharum hybrid cultivar R570]
Length=286

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKD  396
            D+++IREVW  NLEEEF +IR VVD YP++AMDTEFPG V++P   ++ + D +Y  L+ 
Sbjct  12   DAVEIREVWAGNLEEEFAVIRAVVDAYPYVAMDTEFPGFVVKPSAEYRFTCDRNYAALEG  71

Query  397  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  573
            NV++LKLIQLGLT S+  G LP CGT  + CIWQFNFR FDP+ D  ++DSI+LLR+ GI
Sbjct  72   NVNVLKLIQLGLTLSNGAGALPPCGTGGRGCIWQFNFRGFDPHTDPSSNDSIDLLRRSGI  131

Query  574  DFEK  585
            DF++
Sbjct  132  DFDR  135



>ref|XP_009266106.1| CCR4-NOT transcription complex subunit 7 [Wallemia ichthyophaga 
EXF-994]
 gb|EOR03889.1| CCR4-NOT transcription complex subunit 7 [Wallemia ichthyophaga 
EXF-994]
Length=306

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 99/120 (83%), Gaps = 6/120 (5%)
 Frame = +1

Query  226  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVD  405
            QIREVW  NL+ E D++RE+VD YP+++MDTEFPG+V RP+GNFKNS+DYHYQTL+ NVD
Sbjct  4    QIREVWADNLDAELDILRELVDRYPYVSMDTEFPGVVARPIGNFKNSSDYHYQTLRCNVD  63

Query  406  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEK  585
            +LK+IQLG+T +D +GN+P     +Y  WQFNF+ F+ N+D++A DSIELL + GI+F++
Sbjct  64   LLKIIQLGITIADAEGNMP-----EYPTWQFNFK-FNLNDDMYAPDSIELLTKSGINFKR  117



>ref|XP_010262944.1| PREDICTED: probable CCR4-associated factor 1 homolog 9 [Nelumbo 
nucifera]
Length=278

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 97/141 (69%), Gaps = 8/141 (6%)
 Frame = +1

Query  178  FWVDWKMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGN-  354
            F VD   +L P    I IREVW  NLE EF+LI++V+D YP+I+MDTEFPGIV  P  N 
Sbjct  2    FSVDSDSNLKP----IVIREVWSDNLESEFELIQDVIDQYPYISMDTEFPGIVFYPTDNS  57

Query  355  ---FKNSNDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNE  525
               + +    HY  LK NVD LKLIQ+GLTFSD  GNLP  GT    IW+FNFR+FD + 
Sbjct  58   GKFYHHKPSEHYLVLKSNVDYLKLIQVGLTFSDADGNLPDLGTGNRYIWEFNFRDFDVSR  117

Query  526  DVFASDSIELLRQCGIDFEKN  588
            D +A DSIELLRQ GIDFEKN
Sbjct  118  DAYAPDSIELLRQQGIDFEKN  138



>ref|XP_003574542.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=294

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = +1

Query  217  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPV-GNFKNSNDYHYQTLK  393
            D ++IREVW  N++ EF +IRE++DDY ++AMDTEFPG+V RPV GN++ +++Y+Y TLK
Sbjct  20   DGVEIREVWADNVDAEFAVIREIIDDYRYVAMDTEFPGVVCRPVGGNYRTNDEYNYVTLK  79

Query  394  DNVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCG  570
             NVDML LIQLGLT  DE G LP  GT  + C WQFNFR FDP  D   +DSI+LLR+ G
Sbjct  80   ANVDMLSLIQLGLTLCDESGALPPRGTGGRPCAWQFNFRGFDPRSDPANADSIDLLRKSG  139

Query  571  IDFEK  585
            IDF++
Sbjct  140  IDFDR  144



>ref|XP_011006693.1| PREDICTED: probable CCR4-associated factor 1 homolog 11 [Populus 
euphratica]
Length=277

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDY---  375
            + +S  I IREVW +NLE EF+LIR+++D++PFI+MDTEFPG+V RP  +  N+ +Y   
Sbjct  1    MEESKEIVIREVWSWNLESEFELIRDLIDEFPFISMDTEFPGVVFRPPVDPTNNRNYFRQ  60

Query  376  -----HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFAS  540
                 HY+ LK NVD L LIQ+GLT SD KGNLP  GT+   IW+FNFR+FD   D  A 
Sbjct  61   LKPSDHYKILKSNVDALNLIQVGLTLSDAKGNLPDLGTENRFIWEFNFRDFDVERDSHAP  120

Query  541  DSIELLRQCGIDFEKN  588
            DS+ELLR+ GIDFE+N
Sbjct  121  DSVELLRRQGIDFERN  136



>dbj|GAN07390.1| CCR4 associated factor [Mucor ambiguus]
Length=308

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = +1

Query  205  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSNDYHYQ  384
            +P +D+  I+EVW  NLEEE   +R++V++YP++AMDTEFPG+V RP+G FK S+DYHYQ
Sbjct  1    MPVNDAKYIKEVWAENLEEEMAHLRDLVEEYPYLAMDTEFPGVVARPIGTFKTSSDYHYQ  60

Query  385  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR-EFDPN---EDVFASDSIE  552
            TL+ NVD+LK+IQLG+TF+D+ GNLP       C WQFNF+    PN   +D++A DSIE
Sbjct  61   TLRCNVDLLKIIQLGVTFADQYGNLP----GNICTWQFNFKFNLSPNTCRDDMYAQDSIE  116

Query  553  LLRQCGIDFEKN  588
            LL + GIDF+K+
Sbjct  117  LLTKSGIDFKKH  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160