BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038K07

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN61312.1|  hypothetical protein VITISV_013386                     342   3e-116   Vitis vinifera
gb|KDO49099.1|  hypothetical protein CISIN_1g0029001mg                  343   5e-115   Citrus sinensis [apfelsine]
ref|XP_004230861.1|  PREDICTED: coatomer subunit gamma                  355   4e-113   Solanum lycopersicum
ref|XP_006365093.1|  PREDICTED: coatomer subunit gamma-like             355   5e-113   Solanum tuberosum [potatoes]
ref|XP_010423748.1|  PREDICTED: coatomer subunit gamma-like             341   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_009609407.1|  PREDICTED: coatomer subunit gamma                  353   3e-112   Nicotiana tomentosiformis
ref|XP_009795130.1|  PREDICTED: coatomer subunit gamma                  350   2e-111   Nicotiana sylvestris
emb|CDO97061.1|  unnamed protein product                                350   3e-111   Coffea canephora [robusta coffee]
ref|XP_009605957.1|  PREDICTED: coatomer subunit gamma                  350   6e-111   Nicotiana tomentosiformis
ref|XP_003606893.1|  Coatomer subunit gamma                             349   7e-111   Medicago truncatula
ref|XP_009800885.1|  PREDICTED: coatomer subunit gamma-like             349   7e-111   Nicotiana sylvestris
gb|EPS63349.1|  coatomer subunit gamma                                  348   1e-110   Genlisea aurea
ref|XP_002305424.1|  hypothetical protein POPTR_0004s16090g             348   2e-110   Populus trichocarpa [western balsam poplar]
ref|XP_006856032.1|  hypothetical protein AMTR_s00059p00069290          348   3e-110   Amborella trichopoda
ref|XP_011048655.1|  PREDICTED: coatomer subunit gamma-like isofo...    347   6e-110   Populus euphratica
ref|XP_003541056.1|  PREDICTED: coatomer subunit gamma-2-like           347   7e-110   Glycine max [soybeans]
gb|KHN25367.1|  Coatomer subunit gamma                                  347   8e-110   Glycine soja [wild soybean]
ref|XP_010254880.1|  PREDICTED: coatomer subunit gamma-2                347   8e-110   Nelumbo nucifera [Indian lotus]
ref|XP_010530844.1|  PREDICTED: coatomer subunit gamma-like             346   1e-109   Tarenaya hassleriana [spider flower]
gb|KHN39778.1|  Coatomer subunit gamma-2                                346   2e-109   Glycine soja [wild soybean]
ref|XP_008447037.1|  PREDICTED: coatomer subunit gamma                  345   2e-109   Cucumis melo [Oriental melon]
ref|XP_004150412.1|  PREDICTED: coatomer subunit gamma-like             345   2e-109   Cucumis sativus [cucumbers]
ref|XP_003537872.1|  PREDICTED: coatomer subunit gamma-2-like           345   2e-109   Glycine max [soybeans]
ref|XP_010690898.1|  PREDICTED: coatomer subunit gamma                  345   3e-109   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB47487.1|  hypothetical protein B456_008G028500                    342   3e-109   Gossypium raimondii
ref|XP_008787310.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    345   3e-109   Phoenix dactylifera
ref|XP_009374177.1|  PREDICTED: coatomer subunit gamma                  345   3e-109   Pyrus x bretschneideri [bai li]
ref|XP_004507423.1|  PREDICTED: coatomer subunit gamma-like             345   3e-109   
ref|XP_008375923.1|  PREDICTED: coatomer subunit gamma                  345   4e-109   Malus domestica [apple tree]
ref|XP_002313799.1|  hypothetical protein POPTR_0009s11800g             344   5e-109   Populus trichocarpa [western balsam poplar]
ref|XP_009345731.1|  PREDICTED: coatomer subunit gamma-like             344   6e-109   Pyrus x bretschneideri [bai li]
gb|KHG07840.1|  hypothetical protein F383_13405                         344   7e-109   Gossypium arboreum [tree cotton]
ref|XP_010548052.1|  PREDICTED: coatomer subunit gamma-like             344   8e-109   Tarenaya hassleriana [spider flower]
gb|KJB79199.1|  hypothetical protein B456_013G037600                    344   9e-109   Gossypium raimondii
ref|XP_008236878.1|  PREDICTED: coatomer subunit gamma                  344   9e-109   Prunus mume [ume]
ref|XP_007200317.1|  hypothetical protein PRUPE_ppa001186mg             343   9e-109   Prunus persica
ref|XP_008783467.1|  PREDICTED: coatomer subunit gamma-2                343   1e-108   Phoenix dactylifera
gb|EYU42621.1|  hypothetical protein MIMGU_mgv1a001108mg                343   2e-108   Erythranthe guttata [common monkey flower]
ref|XP_010263701.1|  PREDICTED: coatomer subunit gamma-2                343   2e-108   Nelumbo nucifera [Indian lotus]
gb|KHN20073.1|  Coatomer subunit gamma                                  343   2e-108   Glycine soja [wild soybean]
gb|KHN33760.1|  Coatomer subunit gamma                                  343   2e-108   Glycine soja [wild soybean]
ref|XP_003522954.1|  PREDICTED: coatomer subunit gamma-like             343   2e-108   Glycine max [soybeans]
ref|XP_011048664.1|  PREDICTED: coatomer subunit gamma-like isofo...    343   2e-108   Populus euphratica
ref|XP_003527225.1|  PREDICTED: coatomer subunit gamma-like             342   3e-108   Glycine max [soybeans]
ref|XP_003631645.1|  PREDICTED: coatomer subunit gamma-2                342   3e-108   Vitis vinifera
ref|XP_003603909.1|  Coatomer subunit gamma                             342   3e-108   Medicago truncatula
ref|XP_007131844.1|  hypothetical protein PHAVU_011G046000g             342   4e-108   Phaseolus vulgaris [French bean]
ref|XP_010942029.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     342   4e-108   Elaeis guineensis
ref|XP_007042213.1|  Coatomer gamma-2 subunit / gamma-2 coat prot...    342   5e-108   
gb|KDP46244.1|  hypothetical protein JCGZ_10084                         342   5e-108   Jatropha curcas
ref|XP_011464120.1|  PREDICTED: coatomer subunit gamma                  342   5e-108   Fragaria vesca subsp. vesca
ref|XP_011088383.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     341   6e-108   
ref|XP_007042214.1|  Coatomer gamma-2 subunit / gamma-2 coat prot...    341   7e-108   
ref|XP_007136172.1|  hypothetical protein PHAVU_009G024100g             341   7e-108   Phaseolus vulgaris [French bean]
ref|XP_011088382.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     341   7e-108   Sesamum indicum [beniseed]
ref|XP_010467348.1|  PREDICTED: coatomer subunit gamma-like             341   1e-107   Camelina sativa [gold-of-pleasure]
gb|KJB47485.1|  hypothetical protein B456_008G028500                    341   1e-107   Gossypium raimondii
ref|XP_006423249.1|  hypothetical protein CICLE_v10027789mg             340   2e-107   
ref|XP_010942028.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     340   2e-107   Elaeis guineensis
ref|XP_006423248.1|  hypothetical protein CICLE_v10027789mg             339   4e-107   Citrus clementina [clementine]
ref|XP_004500815.1|  PREDICTED: coatomer subunit gamma-like             339   5e-107   Cicer arietinum [garbanzo]
ref|XP_006409466.1|  hypothetical protein EUTSA_v10022539mg             339   5e-107   Eutrema salsugineum [saltwater cress]
ref|XP_011092782.1|  PREDICTED: coatomer subunit gamma-2-like           339   6e-107   Sesamum indicum [beniseed]
gb|KHG11475.1|  hypothetical protein F383_06298                         338   9e-107   Gossypium arboreum [tree cotton]
gb|KJB32493.1|  hypothetical protein B456_005G242900                    338   1e-106   Gossypium raimondii
gb|KJB32494.1|  hypothetical protein B456_005G242900                    338   1e-106   Gossypium raimondii
ref|XP_002509477.1|  coatomer gamma subunit, putative                   338   1e-106   Ricinus communis
ref|XP_006296595.1|  hypothetical protein CARUB_v10012945mg             338   2e-106   Capsella rubella
ref|XP_010526924.1|  PREDICTED: coatomer subunit gamma                  337   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_002884158.1|  hypothetical protein ARALYDRAFT_900277             337   2e-106   Arabidopsis lyrata subsp. lyrata
gb|EYU37789.1|  hypothetical protein MIMGU_mgv1a001103mg                337   3e-106   Erythranthe guttata [common monkey flower]
emb|CAA18824.1|  Nonclathrin coat protein gamma-like protein            336   3e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30073.1|  hypothetical protein AALP_AA7G213200                    337   5e-106   Arabis alpina [alpine rockcress]
ref|NP_195171.2|  coatomer subunit gamma                                336   6e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392974.1|  PREDICTED: coatomer subunit gamma-2-like           336   6e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002869144.1|  hypothetical protein ARALYDRAFT_491217             336   7e-106   
ref|XP_011037539.1|  PREDICTED: coatomer subunit gamma                  336   7e-106   Populus euphratica
ref|XP_006412224.1|  hypothetical protein EUTSA_v10024368mg             335   2e-105   Eutrema salsugineum [saltwater cress]
ref|XP_006487155.1|  PREDICTED: coatomer subunit gamma-2-like iso...    335   2e-105   Citrus sinensis [apfelsine]
ref|XP_010065395.1|  PREDICTED: coatomer subunit gamma                  334   5e-105   Eucalyptus grandis [rose gum]
ref|XP_009412267.1|  PREDICTED: coatomer subunit gamma-2                334   6e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010432412.1|  PREDICTED: coatomer subunit gamma-like             332   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010437613.1|  PREDICTED: coatomer subunit gamma                  332   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010447078.1|  PREDICTED: coatomer subunit gamma-like             332   3e-104   Camelina sativa [gold-of-pleasure]
emb|CDY46248.1|  BnaC03g66090D                                          332   3e-104   Brassica napus [oilseed rape]
ref|XP_006283082.1|  hypothetical protein CARUB_v10004095mg             332   3e-104   
ref|XP_006649665.1|  PREDICTED: coatomer subunit gamma-1-like           332   3e-104   Oryza brachyantha
ref|XP_009108729.1|  PREDICTED: coatomer subunit gamma-like             332   3e-104   Brassica rapa
ref|XP_004148851.1|  PREDICTED: coatomer subunit gamma-like             332   3e-104   Cucumis sativus [cucumbers]
ref|XP_008457930.1|  PREDICTED: coatomer subunit gamma-like             331   6e-104   Cucumis melo [Oriental melon]
emb|CDX69060.1|  BnaC01g03930D                                          331   6e-104   
emb|CDX75435.1|  BnaA01g02670D                                          331   7e-104   
ref|XP_010028581.1|  PREDICTED: coatomer subunit gamma                  330   1e-103   Eucalyptus grandis [rose gum]
ref|NP_001049443.1|  Os03g0227000                                       330   1e-103   
ref|XP_009121225.1|  PREDICTED: coatomer subunit gamma                  330   1e-103   Brassica rapa
emb|CDX71272.1|  BnaC07g05510D                                          330   1e-103   
gb|AAN60990.1|  Putative Nonclathrin coat protein gamma - like pr...    328   2e-103   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132662.1|  uncharacterized protein LOC100194138               329   3e-103   Zea mays [maize]
sp|Q8H852.2|COPG1_ORYSJ  RecName: Full=Coatomer subunit gamma-1; ...    329   3e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009112399.1|  PREDICTED: coatomer subunit gamma                  329   3e-103   Brassica rapa
ref|XP_002459514.1|  hypothetical protein SORBIDRAFT_02g005920          328   5e-103   Sorghum bicolor [broomcorn]
ref|XP_006658376.1|  PREDICTED: coatomer subunit gamma-2-like           328   6e-103   Oryza brachyantha
ref|XP_003557417.1|  PREDICTED: coatomer subunit gamma-2                328   6e-103   Brachypodium distachyon [annual false brome]
ref|NP_001059131.1|  Os07g0201100                                       328   7e-103   
gb|EEC81692.1|  hypothetical protein OsI_25286                          328   7e-103   Oryza sativa Indica Group [Indian rice]
gb|ACL54542.1|  unknown                                                 328   7e-103   Zea mays [maize]
ref|XP_008650919.1|  PREDICTED: uncharacterized protein LOC100193...    328   7e-103   Zea mays [maize]
gb|EEE58633.1|  hypothetical protein OsJ_09998                          329   7e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955766.1|  PREDICTED: coatomer subunit gamma-2-like           328   7e-103   Setaria italica
gb|EEC74799.1|  hypothetical protein OsI_10600                          328   9e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_009411250.1|  PREDICTED: coatomer subunit gamma-2-like           328   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003558423.1|  PREDICTED: coatomer subunit gamma-1                328   1e-102   Brachypodium distachyon [annual false brome]
dbj|BAJ99125.1|  predicted protein                                      327   2e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02925.1|  predicted protein                                      327   4e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465599.1|  hypothetical protein SORBIDRAFT_01g041860          326   5e-102   Sorghum bicolor [broomcorn]
ref|XP_004985097.1|  PREDICTED: coatomer subunit gamma-1-like           326   6e-102   Setaria italica
gb|EMT19755.1|  Coatomer subunit gamma-1                                325   1e-101   
gb|EMS53044.1|  Coatomer subunit gamma-1                                325   2e-101   Triticum urartu
gb|EMS56973.1|  Coatomer subunit gamma-2                                322   2e-100   Triticum urartu
ref|NP_001146210.1|  uncharacterized protein LOC100279780               320   1e-99    Zea mays [maize]
tpg|DAA42449.1|  TPA: hypothetical protein ZEAMMB73_223819              298   2e-99    
gb|ACN34393.1|  unknown                                                 297   1e-98    Zea mays [maize]
ref|XP_002990584.1|  hypothetical protein SELMODRAFT_185391             317   2e-98    Selaginella moellendorffii
tpg|DAA44254.1|  TPA: hypothetical protein ZEAMMB73_398050              319   2e-98    
ref|XP_002983626.1|  hypothetical protein SELMODRAFT_268757             317   2e-98    Selaginella moellendorffii
ref|XP_010942771.1|  PREDICTED: coatomer subunit gamma-2-like           314   2e-97    Elaeis guineensis
ref|XP_001780339.1|  predicted protein                                  313   6e-97    
ref|XP_001760258.1|  predicted protein                                  312   1e-96    
ref|XP_010096181.1|  Coatomer subunit gamma-2                           309   7e-96    
gb|EMT05643.1|  Coatomer subunit gamma-2                                313   2e-95    
gb|KFK29733.1|  hypothetical protein AALP_AA7G171600                    295   3e-90    Arabis alpina [alpine rockcress]
ref|XP_007509254.1|  coatomer protein gamma-subunit                     289   9e-88    Bathycoccus prasinos
ref|XP_001762251.1|  predicted protein                                  285   2e-87    
ref|XP_002507482.1|  coatomer protein gamma-subunit                     285   1e-86    Micromonas commoda
ref|XP_003056073.1|  coatomer protein gamma-subunit                     284   4e-86    Micromonas pusilla CCMP1545
ref|XP_002946805.1|  hypothetical protein VOLCADRAFT_72994              277   9e-84    Volvox carteri f. nagariensis
ref|XP_001691193.1|  gamma-cop                                          277   1e-83    Chlamydomonas reinhardtii
ref|XP_004301551.1|  PREDICTED: coatomer subunit gamma-like             277   1e-83    Fragaria vesca subsp. vesca
gb|KHN10358.1|  Coatomer subunit gamma                                  258   3e-83    Glycine soja [wild soybean]
ref|XP_005847180.1|  hypothetical protein CHLNCDRAFT_31542              269   2e-80    Chlorella variabilis
gb|KFK41271.1|  hypothetical protein AALP_AA2G108400                    261   5e-78    Arabis alpina [alpine rockcress]
ref|XP_001754805.1|  predicted protein                                  258   7e-77    
gb|KDD74661.1|  adaptin                                                 241   3e-76    Helicosporidium sp. ATCC 50920
ref|XP_001416165.1|  Coatomer gamma subunit                             254   2e-75    Ostreococcus lucimarinus CCE9901
emb|CEG01036.1|  Clathrin alpha-adaptin/coatomer adaptor,appendag...    254   3e-75    Ostreococcus tauri
ref|XP_005651915.1|  Coatomer, gamma subunit                            254   4e-75    Coccomyxa subellipsoidea C-169
gb|KFK29732.1|  hypothetical protein AALP_AA7G171600                    253   6e-75    Arabis alpina [alpine rockcress]
ref|XP_003075049.1|  CopG Coatomer gamma subunit (IC)                   253   9e-75    
ref|XP_011397447.1|  Coatomer subunit gamma                             249   1e-74    Auxenochlorella protothecoides
dbj|BAJ96771.1|  predicted protein                                      249   1e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002600093.1|  hypothetical protein BRAFLDRAFT_79649              230   5e-72    Branchiostoma floridae
ref|XP_004341555.1|  coatomer subunit gamma, putative                   241   2e-70    Acanthamoeba castellanii str. Neff
ref|XP_002111874.1|  hypothetical protein TRIADDRAFT_55337              231   4e-67    Trichoplax adhaerens
ref|XP_973414.1|  PREDICTED: coatomer subunit gamma                     232   4e-67    Tribolium castaneum [rust-red flour beetle]
ref|XP_008903641.1|  hypothetical protein, variant                      231   1e-66    Phytophthora parasitica INRA-310
ref|XP_009515671.1|  hypothetical protein PHYSODRAFT_537097             231   1e-66    Phytophthora sojae
gb|ETK88911.1|  hypothetical protein, variant                           231   1e-66    Phytophthora parasitica
gb|ETO77781.1|  hypothetical protein, variant                           231   1e-66    Phytophthora parasitica P1976
gb|ETI49043.1|  hypothetical protein, variant                           231   1e-66    Phytophthora parasitica P1569
gb|ETI49042.1|  hypothetical protein F443_07033                         230   2e-66    Phytophthora parasitica P1569
gb|ETK88910.1|  hypothetical protein L915_06935                         230   2e-66    Phytophthora parasitica
gb|ETO77780.1|  hypothetical protein F444_07101                         230   2e-66    Phytophthora parasitica P1976
ref|XP_008903640.1|  hypothetical protein PPTG_10119                    230   2e-66    Phytophthora parasitica INRA-310
ref|XP_005705551.1|  coatomer protein complex, subunit gamma            230   2e-66    Galdieria sulphuraria
gb|ELU14014.1|  hypothetical protein CAPTEDRAFT_162815                  229   3e-66    Capitella teleta
ref|XP_001893606.1|  coatomer gamma subunit                             228   6e-66    Brugia malayi [agent of lymphatic filariasis]
emb|CDP97871.1|  Protein Bm13807, isoform a                             228   7e-66    
gb|EYC22058.1|  hypothetical protein Y032_0018g3689                     228   7e-66    Ancylostoma ceylanicum
gb|EYC22059.1|  hypothetical protein Y032_0018g3689                     228   8e-66    Ancylostoma ceylanicum
gb|EYC22057.1|  hypothetical protein Y032_0018g3689                     228   8e-66    Ancylostoma ceylanicum
ref|XP_009870725.1|  PREDICTED: coatomer subunit gamma-2-like           212   1e-65    Apaloderma vittatum
ref|XP_002906610.1|  coatomer subunit gamma, putative                   228   1e-65    Phytophthora infestans T30-4
dbj|GAM19255.1|  hypothetical protein SAMD00019534_024300               228   1e-65    Acytostelium subglobosum LB1
gb|KHN77336.1|  putative coatomer subunit gamma                         228   2e-65    Toxocara canis
ref|XP_320089.2|  AGAP009291-PA                                         227   2e-65    Anopheles gambiae str. PEST
ref|XP_003142745.1|  coatomer gamma subunit                             227   3e-65    Loa loa
ref|XP_002426927.1|  Coatomer subunit gamma-2, putative                 226   4e-65    Pediculus humanus corporis [human body lice]
gb|EMC89476.1|  Coatomer subunit gamma-2                                213   5e-65    
ref|XP_003284402.1|  hypothetical protein DICPUDRAFT_45443              226   5e-65    Dictyostelium purpureum
gb|KFO90143.1|  Coatomer subunit gamma-2                                212   5e-65    Buceros rhinoceros silvestris
ref|XP_001863075.1|  coatomer subunit gamma                             226   6e-65    Culex quinquefasciatus
gb|ETN67504.1|  coatomer subunit gamma                                  226   7e-65    Anopheles darlingi [American malaria mosquito]
dbj|BAK03541.1|  predicted protein                                      225   8e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005767681.1|  COPG1, gamma subunit of the coatomer               218   1e-64    Emiliania huxleyi CCMP1516
ref|XP_011171736.1|  PREDICTED: coatomer subunit gamma                  224   2e-64    Solenopsis invicta [imported red fire ant]
ref|XP_011257977.1|  PREDICTED: coatomer subunit gamma                  224   2e-64    Camponotus floridanus
gb|EFZ10235.1|  hypothetical protein SINV_06617                         224   2e-64    
ref|XP_636291.1|  adaptin N-terminal domain-containing protein          224   2e-64    Dictyostelium discoideum AX4
ref|XP_002187860.1|  PREDICTED: coatomer subunit gamma-2 isoform 1      224   2e-64    Taeniopygia guttata
ref|XP_002413239.1|  coatomer gamma subunit, putative                   224   2e-64    Ixodes scapularis [blacklegged tick]
gb|ERG81812.1|  putative coatomer subunit gamma                         224   3e-64    
ref|XP_005838910.1|  coatomer subunit gammma                            224   3e-64    Guillardia theta CCMP2712
ref|XP_011349357.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     223   4e-64    Ooceraea biroi
ref|XP_008619222.1|  hypothetical protein SDRG_14843                    223   4e-64    Saprolegnia diclina VS20
ref|XP_011349356.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     223   4e-64    Ooceraea biroi
gb|KDO33518.1|  hypothetical protein SPRG_01590                         223   4e-64    Saprolegnia parasitica CBS 223.65
ref|XP_004046286.1|  PREDICTED: coatomer subunit gamma-2-like           210   5e-64    
dbj|BAE28895.1|  unnamed protein product                                210   7e-64    Mus musculus [mouse]
ref|XP_011439759.1|  PREDICTED: coatomer subunit gamma-2-like           223   9e-64    Crassostrea gigas
gb|EKC27123.1|  Coatomer subunit gamma-2                                222   9e-64    Crassostrea gigas
ref|XP_003399738.1|  PREDICTED: coatomer subunit gamma-like             222   1e-63    Bombus terrestris [large earth bumblebee]
ref|XP_005714029.1|  Coatomer subunit gamma                             222   1e-63    Chondrus crispus [carageen]
emb|CCI47579.1|  unnamed protein product                                222   2e-63    Albugo candida
gb|KDR23235.1|  Coatomer subunit gamma-2                                222   2e-63    Zootermopsis nevadensis
emb|CCI47577.1|  unnamed protein product                                222   2e-63    Albugo candida
ref|NP_001036846.1|  nonclathrin coat protein gamma1-COP                221   2e-63    Bombyx mori [silk moth]
ref|XP_011050148.1|  PREDICTED: coatomer subunit gamma                  221   2e-63    Acromyrmex echinatior
emb|CCI47580.1|  unnamed protein product                                222   2e-63    Albugo candida
ref|XP_011149849.1|  PREDICTED: coatomer subunit gamma                  221   2e-63    Harpegnathos saltator
emb|CCI47578.1|  unnamed protein product                                222   2e-63    Albugo candida
emb|CCA20227.1|  hypothetical protein ARALYDRAFT_900277                 221   2e-63    Albugo laibachii Nc14
gb|EHJ75334.1|  nonclathrin coat protein gamma2-COP                     221   2e-63    
ref|XP_003700498.1|  PREDICTED: coatomer subunit gamma-like             221   3e-63    
ref|XP_003493763.1|  PREDICTED: coatomer subunit gamma-like             221   3e-63    Bombus impatiens
gb|EFA81100.1|  adaptin N-terminal domain-containing protein            221   3e-63    Heterostelium album PN500
ref|XP_006611321.1|  PREDICTED: coatomer subunit gamma-like isofo...    220   5e-63    Apis dorsata [rock honeybee]
ref|XP_003691218.1|  PREDICTED: coatomer subunit gamma-like             220   5e-63    
ref|XP_006559437.1|  PREDICTED: coatomer subunit gamma isoform X2       220   5e-63    Apis mellifera [bee]
ref|XP_784737.3|  PREDICTED: coatomer subunit gamma-2-like              220   5e-63    Strongylocentrotus purpuratus [purple urchin]
ref|XP_001632631.1|  predicted protein                                  220   5e-63    Nematostella vectensis
ref|XP_006559436.1|  PREDICTED: coatomer subunit gamma isoform X1       220   6e-63    Apis mellifera [bee]
ref|XP_010135111.1|  PREDICTED: coatomer subunit gamma-2                213   6e-63    Buceros rhinoceros silvestris
ref|XP_004361518.1|  adaptin N-terminal domain-containing protein       220   6e-63    Cavenderia fasciculata
ref|XP_006611320.1|  PREDICTED: coatomer subunit gamma-like isofo...    220   6e-63    Apis dorsata [rock honeybee]
gb|EHJ74076.1|  nonclathrin coat protein gamma1-COP                     219   1e-62    
emb|CDW55059.1|  coatomer subunit gamma                                 219   1e-62    Trichuris trichiura
dbj|BAA93048.2|  nonclathrin coat protein gamma2-COP                    219   2e-62    Bombyx mori [silk moth]
ref|XP_009839265.1|  hypothetical protein H257_13452                    219   2e-62    Aphanomyces astaci
dbj|BAE37449.1|  unnamed protein product                                210   2e-62    Mus musculus [mouse]
ref|XP_008067061.1|  PREDICTED: coatomer subunit gamma-2-like           209   2e-62    Carlito syrichta
gb|KFP62193.1|  Coatomer subunit gamma-2                                213   3e-62    Cariama cristata
ref|XP_009708813.1|  PREDICTED: coatomer subunit gamma-2                213   3e-62    Cariama cristata
gb|KFV94911.1|  Coatomer subunit gamma-2                                213   3e-62    Eurypyga helias
ref|XP_010154042.1|  PREDICTED: coatomer subunit gamma-2                213   3e-62    Eurypyga helias
gb|ERL89814.1|  hypothetical protein D910_07175                         217   5e-62    Dendroctonus ponderosae
ref|XP_011495854.1|  PREDICTED: coatomer subunit gamma isoform X2       217   6e-62    Ceratosolen solmsi marchali
ref|XP_011495853.1|  PREDICTED: coatomer subunit gamma isoform X1       217   8e-62    Ceratosolen solmsi marchali
ref|XP_008864270.1|  hypothetical protein H310_02513                    217   9e-62    Aphanomyces invadans
ref|XP_005793200.1|  COPG1, gamma subunit of the coatomer               217   1e-61    Emiliania huxleyi CCMP1516
ref|XP_005793201.1|  coatomer protein gamma 2 subunit                   216   1e-61    Emiliania huxleyi CCMP1516
ref|XP_008557515.1|  PREDICTED: coatomer subunit gamma                  216   1e-61    Microplitis demolitor
gb|AAH45918.1|  Copg2 protein                                           206   1e-61    Danio rerio [leopard danio]
gb|KFZ54001.1|  Coatomer subunit gamma-1                                203   2e-61    Antrostomus carolinensis
ref|XP_010161636.1|  PREDICTED: coatomer subunit gamma-1-like           203   2e-61    Antrostomus carolinensis
ref|XP_004930789.1|  PREDICTED: coatomer subunit gamma                  216   2e-61    Bombyx mori [silk moth]
gb|AAX28445.2|  SJCHGC05579 protein                                     202   3e-61    Schistosoma japonicum
ref|XP_002053897.1|  GJ23086                                            215   5e-61    
ref|XP_005992625.1|  PREDICTED: coatomer subunit gamma-1                214   5e-61    
ref|XP_001964590.1|  GF22968                                            214   5e-61    Drosophila ananassae
ref|XP_009058878.1|  hypothetical protein LOTGIDRAFT_191967             214   6e-61    Lottia gigantea
ref|XP_007441415.1|  PREDICTED: coatomer subunit gamma-2-like           214   9e-61    Python bivittatus
gb|KFQ78160.1|  Coatomer subunit gamma-2                                212   1e-60    Phoenicopterus ruber ruber
ref|XP_003736402.1|  GA13624, isoform B                                 214   1e-60    
ref|XP_001358267.1|  GA13624, isoform A                                 213   1e-60    
ref|XP_003228861.1|  PREDICTED: coatomer subunit gamma-2                213   1e-60    Anolis carolinensis [Carolina anole]
ref|XP_001998865.1|  GI23396                                            213   2e-60    Drosophila mojavensis
ref|XP_002069802.1|  GK11719                                            213   2e-60    Drosophila willistoni
ref|XP_001989718.1|  GH18636                                            213   2e-60    Drosophila grimshawi
ref|XP_010579361.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     212   2e-60    Haliaeetus leucocephalus
ref|XP_003201845.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     213   2e-60    Meleagris gallopavo [common turkey]
gb|KFM76767.1|  Coatomer subunit gamma-2                                213   2e-60    Stegodyphus mimosarum
ref|XP_414981.2|  PREDICTED: coatomer subunit gamma-2 isoform X2        212   3e-60    Gallus gallus [bantam]
gb|KFQ66228.1|  Coatomer subunit gamma-2                                212   4e-60    Phaethon lepturus
ref|XP_006752768.1|  PREDICTED: coatomer subunit gamma-2-like           200   4e-60    Myotis davidii
ref|XP_004636947.1|  PREDICTED: coatomer subunit gamma-2                211   4e-60    Octodon degus
ref|XP_009677631.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    Struthio camelus australis
ref|XP_009646680.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    Egretta garzetta
gb|KFV93281.1|  Coatomer subunit gamma-2                                212   4e-60    Fulmarus glacialis
ref|XP_005377611.1|  PREDICTED: coatomer subunit gamma-2-like           211   4e-60    
ref|XP_009578347.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    Fulmarus glacialis
ref|XP_010127718.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    Chlamydotis macqueenii
ref|XP_010281384.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    Phaethon lepturus
ref|XP_010297179.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    Balearica regulorum gibbericeps
ref|XP_009812764.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    Gavia stellata
ref|XP_001367114.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     212   4e-60    Monodelphis domestica
ref|XP_007056007.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     212   4e-60    Chelonia mydas [green seaturtle]
gb|KFQ03848.1|  Coatomer subunit gamma-2                                212   4e-60    Haliaeetus albicilla
gb|KFQ50320.1|  Coatomer subunit gamma-2                                212   4e-60    Pelecanus crispus
gb|KFO04278.1|  Coatomer subunit gamma-2                                212   4e-60    Balearica regulorum gibbericeps
gb|KFP34936.1|  Coatomer subunit gamma-2                                212   4e-60    
gb|KFW89615.1|  Coatomer subunit gamma-2                                212   4e-60    
gb|KFP10731.1|  Coatomer subunit gamma-2                                212   4e-60    
ref|XP_010020207.1|  PREDICTED: coatomer subunit gamma-2                210   4e-60    
ref|XP_009478462.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    
ref|XP_009500374.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    
gb|KFV47491.1|  Coatomer subunit gamma-2                                212   4e-60    
ref|XP_009917069.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    
ref|XP_007056008.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     212   4e-60    
ref|XP_010579358.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     212   4e-60    
ref|XP_005504385.1|  PREDICTED: coatomer subunit gamma-2                212   4e-60    
gb|KFV83597.1|  Coatomer subunit gamma-2                                212   5e-60    
ref|XP_008172281.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     212   5e-60    
ref|XP_009460872.1|  PREDICTED: coatomer subunit gamma-2                212   5e-60    
ref|XP_005435505.1|  PREDICTED: coatomer subunit gamma-2                212   5e-60    
gb|KFV55437.1|  Coatomer subunit gamma-2                                212   5e-60    
ref|XP_005235387.1|  PREDICTED: coatomer subunit gamma-2                212   5e-60    
gb|KFQ44737.1|  Coatomer subunit gamma-2                                210   5e-60    
gb|KFR13110.1|  Coatomer subunit gamma-2                                212   5e-60    
gb|KFB45874.1|  AGAP009291-PA-like protein                              212   5e-60    
ref|XP_007669172.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     212   5e-60    
ref|XP_001511377.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     212   5e-60    
ref|XP_002043712.1|  GM16430                                            212   5e-60    
ref|XP_009935875.1|  PREDICTED: coatomer subunit gamma-2                212   5e-60    
ref|XP_009962331.1|  PREDICTED: coatomer subunit gamma-2                212   5e-60    
ref|XP_009881282.1|  PREDICTED: coatomer subunit gamma-2                212   5e-60    
gb|ACL83847.1|  gammaCop-PB                                             212   5e-60    
ref|XP_007504392.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     212   6e-60    
ref|NP_001171865.1|  coatomer subunit gamma-2                           212   6e-60    
gb|AAF05719.1|AF191563_1  coatomer protein gamma subunit                212   6e-60    
ref|XP_005009582.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    212   6e-60    
ref|NP_524608.1|  coat protein (coatomer) gamma, isoform A              212   6e-60    
gb|AEQ05569.1|  RE13603p1                                               212   6e-60    
ref|NP_733432.1|  coat protein (coatomer) gamma, isoform B              212   6e-60    
ref|XP_002099517.1|  GE10946                                            212   6e-60    
ref|NP_001163784.1|  coat protein (coatomer) gamma, isoform C           212   6e-60    
ref|XP_008172280.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     212   6e-60    
ref|XP_003771666.1|  PREDICTED: coatomer subunit gamma-2                212   6e-60    
gb|AAM29550.1|  RE62270p                                                211   6e-60    
ref|XP_007951675.1|  PREDICTED: coatomer subunit gamma-2                211   7e-60    
ref|XP_005533148.1|  PREDICTED: coatomer subunit gamma-2                211   8e-60    
ref|XP_008182471.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     211   8e-60    
ref|XP_007524272.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     211   8e-60    
ref|XP_007524271.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     211   8e-60    
ref|XP_003261480.2|  PREDICTED: coatomer subunit gamma-2-like           209   8e-60    
ref|XP_001949780.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     211   8e-60    
ref|NP_001263145.1|  coat protein (coatomer) gamma, isoform D           211   8e-60    
ref|XP_005365844.1|  PREDICTED: coatomer subunit gamma-2                211   9e-60    
ref|XP_008627077.1|  PREDICTED: coatomer subunit gamma-2                211   9e-60    
gb|EMP39438.1|  Coatomer subunit gamma-2                                212   1e-59    
ref|XP_005331155.1|  PREDICTED: coatomer subunit gamma-2                211   1e-59    
ref|XP_004741802.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     211   1e-59    
ref|XP_004741801.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     211   1e-59    
ref|XP_010408344.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    211   1e-59    
emb|CEF68303.1|  Coatomer subunit gamma-1                               211   1e-59    
sp|D4ABY2.2|COPG2_RAT  RecName: Full=Coatomer subunit gamma-2; Al...    209   1e-59    
pdb|3TJZ|B  Chain B, Crystal Structure Of Arf1 Bound To The Gamma...    202   1e-59    
ref|XP_010631824.1|  PREDICTED: coatomer subunit gamma-2                211   1e-59    
gb|ELR51700.1|  Coatomer subunit gamma-2                                209   1e-59    
ref|XP_003791662.1|  PREDICTED: coatomer subunit gamma-2-like           209   2e-59    
ref|NP_001276962.1|  coatomer subunit gamma-2 isoform 2                 209   2e-59    
ref|XP_007611892.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     210   2e-59    
ref|XP_001095932.1|  PREDICTED: coatomer subunit gamma-2                209   2e-59    
ref|XP_002154548.2|  PREDICTED: coatomer subunit gamma-2-like           210   2e-59    
ref|XP_005902268.1|  PREDICTED: coatomer subunit gamma-2                209   2e-59    
ref|XP_003381172.1|  coatomer subunit gamma-2                           210   2e-59    
ref|XP_006047780.1|  PREDICTED: coatomer subunit gamma-2-like iso...    209   2e-59    
gb|ELK38623.1|  Coatomer subunit gamma-2                                199   2e-59    
ref|XP_008926178.1|  PREDICTED: coatomer subunit gamma-2                210   2e-59    
ref|XP_005964485.1|  PREDICTED: coatomer subunit gamma-2-like           209   2e-59    
ref|XP_010802776.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     209   2e-59    
ref|XP_006158897.1|  PREDICTED: coatomer subunit gamma-2                210   2e-59    
ref|XP_005039038.1|  PREDICTED: coatomer subunit gamma-2                210   2e-59    
gb|KFW84305.1|  Coatomer subunit gamma-2                                210   2e-59    
ref|XP_007617480.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     210   2e-59    
ref|XP_004398041.1|  PREDICTED: coatomer subunit gamma-2                210   3e-59    
ref|XP_532421.4|  PREDICTED: coatomer subunit gamma-2 isoform X4        210   3e-59    
gb|KFM09800.1|  Coatomer subunit gamma-2                                210   3e-59    
ref|XP_006979482.1|  PREDICTED: coatomer subunit gamma-2                210   3e-59    
ref|XP_011188007.1|  PREDICTED: coatomer subunit gamma                  210   3e-59    
gb|KFW72045.1|  Coatomer subunit gamma-2                                210   3e-59    
ref|XP_008710283.1|  PREDICTED: coatomer subunit gamma-2                209   3e-59    
ref|XP_009280965.1|  PREDICTED: coatomer subunit gamma-2                210   3e-59    
ref|XP_010945831.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     209   3e-59    
ref|XP_005086531.1|  PREDICTED: coatomer subunit gamma-2                210   3e-59    
ref|NP_001100399.1|  coatomer subunit gamma-2                           209   3e-59    
ref|XP_001981077.1|  GG11813                                            210   3e-59    
emb|CDS21793.1|  Coatomer subunit gamma                                 210   3e-59    
ref|XP_006265191.1|  PREDICTED: coatomer subunit gamma-2                209   3e-59    
ref|XP_004661259.1|  PREDICTED: coatomer subunit gamma-2                209   3e-59    
ref|XP_002913488.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     209   3e-59    
ref|XP_006031895.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   3e-59    
ref|XP_005176451.1|  PREDICTED: coatomer subunit gamma                  209   3e-59    
ref|XP_011228728.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     209   3e-59    
ref|XP_007076354.1|  PREDICTED: coatomer subunit gamma-2-like           209   3e-59    
gb|AAH17443.2|  COPG2 protein                                           209   3e-59    
ref|XP_004893442.1|  PREDICTED: coatomer subunit gamma-2                209   3e-59    
ref|XP_006031896.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     209   4e-59    
ref|XP_011228716.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   4e-59    
ref|XP_005140675.1|  PREDICTED: coatomer subunit gamma-2                209   4e-59    
ref|XP_007469781.1|  PREDICTED: coatomer subunit gamma-2                209   4e-59    
ref|XP_009329295.1|  PREDICTED: coatomer subunit gamma-2                209   4e-59    
ref|XP_009001311.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    209   4e-59    
ref|XP_005628431.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     210   4e-59    
ref|NP_036265.3|  coatomer subunit gamma-2 isoform 1                    209   4e-59    
ref|XP_007981128.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   4e-59    
ref|XP_004523456.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    209   4e-59    
ref|XP_009202144.1|  PREDICTED: coatomer subunit gamma-2                209   4e-59    
ref|XP_011310488.1|  PREDICTED: coatomer subunit gamma                  209   4e-59    
gb|EHH52515.1|  hypothetical protein EGM_12967                          209   4e-59    
ref|XP_004430817.1|  PREDICTED: coatomer subunit gamma-2-like           209   4e-59    
ref|XP_003813516.2|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   4e-59    
ref|XP_005550843.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     209   4e-59    
ref|XP_003921038.1|  PREDICTED: coatomer subunit gamma-2                209   4e-59    
ref|XP_010377104.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     209   4e-59    
ref|XP_003983109.2|  PREDICTED: coatomer subunit gamma-2                209   4e-59    
ref|XP_010377103.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   4e-59    
ref|XP_004272238.1|  PREDICTED: coatomer subunit gamma-2                209   4e-59    
ref|XP_009452485.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   4e-59    
ref|XP_005550842.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   4e-59    
ref|NP_001075917.1|  coatomer subunit gamma-2                           209   4e-59    
ref|XP_004382736.1|  PREDICTED: coatomer subunit gamma-2                209   4e-59    
ref|XP_006861204.1|  PREDICTED: coatomer subunit gamma-2                209   5e-59    
gb|KFV67190.1|  Coatomer subunit gamma-2                                209   5e-59    
ref|XP_005679647.1|  PREDICTED: coatomer subunit gamma-2                209   5e-59    
ref|XP_010945830.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   5e-59    
ref|XP_009898597.1|  PREDICTED: coatomer subunit gamma-2                209   5e-59    
ref|XP_010973968.1|  PREDICTED: coatomer subunit gamma-2                209   5e-59    
ref|NP_001233167.1|  coatomer subunit gamma-2                           209   5e-59    
ref|XP_009561693.1|  PREDICTED: coatomer subunit gamma-2                209   5e-59    
gb|KFO78000.1|  Coatomer subunit gamma-2                                209   5e-59    
ref|XP_009041521.1|  hypothetical protein AURANDRAFT_39222              209   5e-59    
ref|XP_011214763.1|  PREDICTED: coatomer subunit gamma                  209   5e-59    
ref|NP_059506.1|  coatomer subunit gamma-2                              209   5e-59    
ref|XP_003420932.2|  PREDICTED: coatomer subunit gamma-2                208   5e-59    
dbj|BAC40387.1|  unnamed protein product                                209   6e-59    
ref|XP_008401516.1|  PREDICTED: coatomer subunit gamma-2                208   6e-59    
gb|EDL13724.1|  coatomer protein complex, subunit gamma 2               209   6e-59    
ref|XP_003384949.1|  PREDICTED: coatomer subunit gamma-2-like           209   6e-59    
ref|XP_005628430.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     209   7e-59    
ref|XP_009022681.1|  hypothetical protein HELRODRAFT_155881             209   7e-59    
ref|XP_007177339.1|  PREDICTED: coatomer subunit gamma-2                208   8e-59    
ref|XP_008511127.1|  PREDICTED: coatomer subunit gamma-2                208   8e-59    
ref|XP_005609552.1|  PREDICTED: coatomer subunit gamma-2                208   8e-59    
ref|XP_003972850.1|  PREDICTED: coatomer subunit gamma-2-like           208   1e-58    
ref|XP_005628429.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     209   1e-58    
sp|Q9I8E6.1|COPG2_TAKRU  RecName: Full=Coatomer subunit gamma-2; ...    208   1e-58    
ref|XP_004608312.1|  PREDICTED: coatomer subunit gamma-2                208   1e-58    
ref|NP_001133706.1|  Coatomer subunit gamma-2                           208   1e-58    
emb|CDI97519.1|  Coatomer subunit gamma                                 208   1e-58    
ref|XP_009095725.1|  PREDICTED: coatomer subunit gamma-2                208   1e-58    
ref|XP_007564468.1|  PREDICTED: coatomer subunit gamma-2                208   1e-58    
ref|XP_010784382.1|  PREDICTED: coatomer subunit gamma-2                207   1e-58    
ref|XP_001742798.1|  hypothetical protein                               207   1e-58    
ref|XP_005807471.1|  PREDICTED: coatomer subunit gamma-2-like           207   1e-58    
ref|XP_010735170.1|  PREDICTED: coatomer subunit gamma-2                207   2e-58    
ref|XP_004083090.1|  PREDICTED: coatomer subunit gamma-2                207   2e-58    
ref|XP_003445006.1|  PREDICTED: coatomer subunit gamma-2-like           207   2e-58    
ref|XP_010885618.1|  PREDICTED: coatomer subunit gamma-2                207   2e-58    
emb|CAG07279.1|  unnamed protein product                                208   2e-58    
ref|XP_006633341.1|  PREDICTED: coatomer subunit gamma-2-like           207   2e-58    
ref|XP_008299543.1|  PREDICTED: coatomer subunit gamma-2                207   2e-58    
ref|XP_004548319.1|  PREDICTED: coatomer subunit gamma-2-like           207   2e-58    
ref|XP_006680775.1|  hypothetical protein BATDEDRAFT_35627              207   2e-58    
sp|Q9PUE4.2|COPG2_DANRE  RecName: Full=Coatomer subunit gamma-2; ...    207   2e-58    
ref|NP_571069.1|  coatomer subunit gamma-2                              207   2e-58    
ref|XP_004592596.1|  PREDICTED: coatomer subunit gamma-2                207   2e-58    
ref|XP_011355541.1|  PREDICTED: coatomer subunit gamma-2                207   2e-58    
gb|ELK13848.1|  Coatomer subunit gamma-2                                207   2e-58    
ref|XP_003743702.1|  PREDICTED: coatomer subunit gamma-2-like iso...    207   2e-58    
ref|XP_003743703.1|  PREDICTED: coatomer subunit gamma-2-like iso...    207   3e-58    
ref|XP_008256411.1|  PREDICTED: coatomer subunit gamma-2                207   3e-58    
ref|XP_008313867.1|  PREDICTED: coatomer subunit gamma-2                207   3e-58    
gb|AAH96860.1|  Copg2 protein                                           207   3e-58    
ref|XP_005927231.1|  PREDICTED: coatomer subunit gamma-2-like           207   3e-58    
ref|XP_006780784.1|  PREDICTED: coatomer subunit gamma-2-like           207   4e-58    
ref|XP_008479519.1|  PREDICTED: coatomer subunit gamma                  206   5e-58    
ref|XP_006887194.1|  PREDICTED: coatomer subunit gamma-2                206   7e-58    
gb|KFH65084.1|  hypothetical protein MVEG_08565                         206   8e-58    
ref|XP_008212253.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    205   9e-58    
gb|KFQ19840.1|  Coatomer subunit gamma-1                                205   1e-57    
gb|EMC82040.1|  Coatomer subunit gamma                                  205   1e-57    
ref|XP_008942996.1|  PREDICTED: coatomer subunit gamma-1                205   1e-57    
ref|XP_005510201.1|  PREDICTED: coatomer subunit gamma-1                205   1e-57    
ref|XP_006901434.1|  PREDICTED: coatomer subunit gamma-1                201   1e-57    
ref|XP_009577632.1|  PREDICTED: coatomer subunit gamma-1                203   2e-57    
gb|KFV97260.1|  Coatomer subunit gamma-1                                203   2e-57    
ref|NP_001008019.1|  coatomer subunit gamma-2                           204   2e-57    
ref|NP_001086117.1|  coatomer subunit gamma-2                           204   2e-57    
ref|XP_005053052.1|  PREDICTED: coatomer subunit gamma-1                204   3e-57    
ref|XP_010011059.1|  PREDICTED: coatomer subunit gamma-1                203   4e-57    
ref|XP_009998601.1|  PREDICTED: coatomer subunit gamma-2                204   4e-57    
gb|KFQ47864.1|  Coatomer subunit gamma-1                                203   4e-57    
ref|XP_007889035.1|  PREDICTED: coatomer subunit gamma-2                204   4e-57    
gb|KFP04935.1|  Coatomer subunit gamma-1                                203   5e-57    
gb|KFQ15935.1|  Coatomer subunit gamma-1                                203   5e-57    
ref|XP_009957138.1|  PREDICTED: coatomer subunit gamma-1                203   5e-57    
ref|XP_008497323.1|  PREDICTED: coatomer subunit gamma-1                203   5e-57    
ref|XP_006870543.1|  PREDICTED: coatomer subunit gamma-1                203   5e-57    
gb|EOA98107.1|  Coatomer subunit gamma                                  203   6e-57    
gb|KGL75899.1|  Coatomer subunit gamma-1                                203   6e-57    
gb|KFP93266.1|  Coatomer subunit gamma-1                                203   7e-57    
ref|NP_001124939.1|  coatomer subunit gamma-1                           202   7e-57    
gb|KGL97575.1|  Coatomer subunit gamma-1                                203   7e-57    
ref|XP_009910197.1|  PREDICTED: coatomer subunit gamma-1                203   7e-57    
ref|XP_010136438.1|  PREDICTED: coatomer subunit gamma-1                203   7e-57    
ref|XP_010295987.1|  PREDICTED: coatomer subunit gamma-1                203   7e-57    
ref|XP_010157999.1|  PREDICTED: coatomer subunit gamma-1                203   7e-57    
gb|KFV96550.1|  Coatomer subunit gamma-1                                203   7e-57    
ref|XP_009873955.1|  PREDICTED: coatomer subunit gamma-1                203   7e-57    
ref|XP_009706794.1|  PREDICTED: coatomer subunit gamma-1                203   8e-57    
ref|XP_005145849.1|  PREDICTED: coatomer subunit gamma-1                203   8e-57    
gb|KFO90973.1|  Coatomer subunit gamma-1                                203   8e-57    
gb|KFQ64533.1|  Coatomer subunit gamma-1                                203   8e-57    
gb|KFP16314.1|  Coatomer subunit gamma-1                                203   8e-57    
gb|KFU88899.1|  Coatomer subunit gamma-1                                203   8e-57    
gb|KFR13976.1|  Coatomer subunit gamma-1                                202   8e-57    
gb|KFV55300.1|  Coatomer subunit gamma-1                                202   8e-57    
ref|XP_005522140.1|  PREDICTED: coatomer subunit gamma-1                203   8e-57    
gb|ABG81487.1|  coatomer protein complex, subunit gamma 1               201   8e-57    
ref|XP_010570347.1|  PREDICTED: coatomer subunit gamma-1                203   8e-57    



>emb|CAN61312.1| hypothetical protein VITISV_013386 [Vitis vinifera]
Length=213

 Score =   342 bits (877),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE DYSPF+GIEKGAVLQEARVFN+PQL+ RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEADYSPFLGIEKGAVLQEARVFNDPQLEPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSRDTGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIV+RWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVRRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KDO49099.1| hypothetical protein CISIN_1g0029001mg, partial [Citrus sinensis]
 gb|KDO49100.1| hypothetical protein CISIN_1g0029001mg, partial [Citrus sinensis]
Length=317

 Score =   343 bits (879),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D+GLRRMVYL+IKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSRDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQT PEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTTPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_004230861.1| PREDICTED: coatomer subunit gamma [Solanum lycopersicum]
Length=886

 Score =   355 bits (911),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/187 (97%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDEMDYSPFMGIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEMDYSPFMGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            EAFTKVEATEVFF+VTKLFQSKD+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   EAFTKVEATEVFFSVTKLFQSKDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_006365093.1| PREDICTED: coatomer subunit gamma-like [Solanum tuberosum]
Length=886

 Score =   355 bits (911),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 182/187 (97%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDEMDYSPFMGIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEMDYSPFMGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            EAFTKVEATEVFF+VTKLFQSKD+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   EAFTKVEATEVFFSVTKLFQSKDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010423748.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=463

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            EAFTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   EAFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+H+L+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHMLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_009609407.1| PREDICTED: coatomer subunit gamma [Nicotiana tomentosiformis]
Length=887

 Score =   353 bits (905),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE +YSPFMGIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLLKKDDDRDDEAEYSPFMGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKDLGLRRMVYL+IKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDLGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEA+
Sbjct  181  NEVQEAI  187



>ref|XP_009795130.1| PREDICTED: coatomer subunit gamma [Nicotiana sylvestris]
Length=887

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE +YSPFMGIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLLKKDDDRDDEAEYSPFMGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKDLGLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDLGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSSTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>emb|CDO97061.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 179/187 (96%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDEMDYSPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEMDYSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSKDVGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_009605957.1| PREDICTED: coatomer subunit gamma [Nicotiana tomentosiformis]
Length=886

 Score =   350 bits (897),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 179/187 (96%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDEMDYSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEMDYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTK EAT VFFAVTKLFQSKD+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ESFTKAEATGVFFAVTKLFQSKDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_003606893.1| Coatomer subunit gamma [Medicago truncatula]
 gb|AES89090.1| coatomer subunit gamma-like protein [Medicago truncatula]
Length=885

 Score =   349 bits (896),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLIKKDDDRDDEDNYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF+VTKLFQS+DLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKVEATEVFFSVTKLFQSRDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_009800885.1| PREDICTED: coatomer subunit gamma-like [Nicotiana sylvestris]
Length=886

 Score =   349 bits (896),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 179/187 (96%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDEMDYSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEMDYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTK EAT VFFAVTKLFQSKD+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ESFTKAEATGVFFAVTKLFQSKDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|EPS63349.1| coatomer subunit gamma [Genlisea aurea]
Length=887

 Score =   348 bits (894),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRD+E +YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYL+NQG
Sbjct  1    MAQPLVKKDDDRDEEAEYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLINQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSKDVGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQT PEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTTPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_002305424.1| hypothetical protein POPTR_0004s16090g [Populus trichocarpa]
 gb|EEE85935.1| hypothetical protein POPTR_0004s16090g [Populus trichocarpa]
Length=885

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            ++FTKVEATEVFF+VTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   DSFTKVEATEVFFSVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_006856032.1| hypothetical protein AMTR_s00059p00069290 [Amborella trichopoda]
 gb|ERN17499.1| hypothetical protein AMTR_s00059p00069290 [Amborella trichopoda]
Length=887

 Score =   348 bits (892),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSKDMGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLL QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLGQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_011048655.1| PREDICTED: coatomer subunit gamma-like isoform X1 [Populus euphratica]
Length=886

 Score =   347 bits (890),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            ++FTK EATEVFF+VTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   DSFTKTEATEVFFSVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_003541056.1| PREDICTED: coatomer subunit gamma-2-like [Glycine max]
Length=887

 Score =   347 bits (889),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EATEVFF+VTKLFQS+DLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKTEATEVFFSVTKLFQSRDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIH+LQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHILQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KHN25367.1| Coatomer subunit gamma [Glycine soja]
Length=887

 Score =   347 bits (889),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EATEVFF+VTKLFQS+DLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKTEATEVFFSVTKLFQSRDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIH+LQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHILQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010254880.1| PREDICTED: coatomer subunit gamma-2 [Nelumbo nucifera]
Length=888

 Score =   347 bits (889),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRD+E +YSPF GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDEEAEYSPFTGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSRDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010530844.1| PREDICTED: coatomer subunit gamma-like [Tarenaya hassleriana]
Length=887

 Score =   346 bits (888),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFF+VTKLFQSKD GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKIEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KHN39778.1| Coatomer subunit gamma-2 [Glycine soja]
Length=887

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            M+QPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MSQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EATEVFF+VTKLFQS+DLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKTEATEVFFSVTKLFQSRDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIH+LQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHILQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_008447037.1| PREDICTED: coatomer subunit gamma [Cucumis melo]
Length=887

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLIKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ENFTKIEATEVFFAVTKLFQSRDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSG+HLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGLHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_004150412.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 ref|XP_004160233.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 gb|KGN44347.1| hypothetical protein Csa_7G267950 [Cucumis sativus]
Length=887

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLIKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ENFTKIEATEVFFAVTKLFQSRDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSG+HLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGLHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_003537872.1| PREDICTED: coatomer subunit gamma-2-like [Glycine max]
Length=887

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            M+QPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MSQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EATEVFF+VTKLFQS+DLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKTEATEVFFSVTKLFQSRDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIH+LQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHILQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010690898.1| PREDICTED: coatomer subunit gamma [Beta vulgaris subsp. vulgaris]
Length=886

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLIKKDDDRDDESEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDNGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KJB47487.1| hypothetical protein B456_008G028500 [Gossypium raimondii]
Length=740

 Score =   342 bits (876),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD DDE+DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPFLKKDDDHDDEVDYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+DLGLRRMVY+IIKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDLGLRRMVYVIIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLC+ITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCQITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_008787310.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit gamma-2-like 
[Phoenix dactylifera]
Length=886

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 182/187 (97%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MA+PLVKKDDDRDDE  YSPFMGIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAEPLVKKDDDRDDED-YSPFMGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKIEATEVFFAVTKLFQSKDTGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_009374177.1| PREDICTED: coatomer subunit gamma [Pyrus x bretschneideri]
Length=886

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 183/187 (98%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE  YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEE-YSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF+VTKLFQS+D+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKVEATEVFFSVTKLFQSRDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_004507423.1| PREDICTED: coatomer subunit gamma-like [Cicer arietinum]
Length=884

 Score =   345 bits (884),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQ  VKKDDDRDDE++YSPFMGIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQSYVKKDDDRDDEVEYSPFMGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF+VTKLFQS+DLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKVEATEVFFSVTKLFQSRDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQA+VDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAVVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_008375923.1| PREDICTED: coatomer subunit gamma [Malus domestica]
Length=886

 Score =   345 bits (884),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 184/187 (98%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE  YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEE-YSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQS+D+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ESFTKVEATEVFFSVTKLFQSRDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQE+V
Sbjct  180  NEVQESV  186



>ref|XP_002313799.1| hypothetical protein POPTR_0009s11800g [Populus trichocarpa]
 gb|EEE87754.1| hypothetical protein POPTR_0009s11800g [Populus trichocarpa]
Length=886

 Score =   344 bits (883),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            + FTK EATEVFF+VTKLFQSKD GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   DYFTKTEATEVFFSVTKLFQSKDFGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_009345731.1| PREDICTED: coatomer subunit gamma-like [Pyrus x bretschneideri]
Length=886

 Score =   344 bits (883),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 184/187 (98%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE  YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEE-YSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQS+D+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ESFTKVEATEVFFSVTKLFQSRDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQ+AV
Sbjct  180  NEVQDAV  186



>gb|KHG07840.1| hypothetical protein F383_13405 [Gossypium arboreum]
Length=887

 Score =   344 bits (882),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEADYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD+GLRRMVY++IKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDIGLRRMVYVMIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010548052.1| PREDICTED: coatomer subunit gamma-like [Tarenaya hassleriana]
Length=887

 Score =   344 bits (882),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKIEATEVFFAVTKLFQSKDTGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEA+
Sbjct  181  NEVQEAI  187



>gb|KJB79199.1| hypothetical protein B456_013G037600 [Gossypium raimondii]
Length=887

 Score =   344 bits (882),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEADYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD+GLRRMVY++IKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDIGLRRMVYVMIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_008236878.1| PREDICTED: coatomer subunit gamma [Prunus mume]
Length=886

 Score =   344 bits (882),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE  YSPF+GIEKGAVLQEARVFN+PQLD+RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEE-YSPFLGIEKGAVLQEARVFNDPQLDSRRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF+VTKLFQS+D+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKVEATEVFFSVTKLFQSRDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_007200317.1| hypothetical protein PRUPE_ppa001186mg [Prunus persica]
 gb|EMJ01516.1| hypothetical protein PRUPE_ppa001186mg [Prunus persica]
Length=886

 Score =   343 bits (881),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE  YSPF+GIEKGAVLQEARVFN+PQLD+RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEE-YSPFLGIEKGAVLQEARVFNDPQLDSRRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF+VTKLFQS+D+GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKVEATEVFFSVTKLFQSRDIGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_008783467.1| PREDICTED: coatomer subunit gamma-2 [Phoenix dactylifera]
Length=886

 Score =   343 bits (881),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 182/187 (97%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MA+PLVKKDDDRDDE  YSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAEPLVKKDDDRDDED-YSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKVEATEVFFAVTKLFQSKDTGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>gb|EYU42621.1| hypothetical protein MIMGU_mgv1a001108mg [Erythranthe guttata]
Length=888

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRD+E+DYSPFMGIEKGAVLQEARVFN+PQLDAR+C+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDEEVDYSPFMGIEKGAVLQEARVFNDPQLDARKCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EAT+VFFAVTKLFQSKD+GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ETFTKFEATDVFFAVTKLFQSKDIGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQT PEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTTPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010263701.1| PREDICTED: coatomer subunit gamma-2 [Nelumbo nucifera]
Length=887

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP VKKDDDRDDE +YSPF+GIEKGAVLQEARVF++PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPFVKKDDDRDDEAEYSPFIGIEKGAVLQEARVFHDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+D+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KHN20073.1| Coatomer subunit gamma [Glycine soja]
Length=882

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+G+EKG+VLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGLEKGSVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD+GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDMGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLL+QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLSQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KHN33760.1| Coatomer subunit gamma [Glycine soja]
Length=886

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE DYSPF+GIEKG+VLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEADYSPFLGIEKGSVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDTGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLL+QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLSQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_003522954.1| PREDICTED: coatomer subunit gamma-like [Glycine max]
Length=886

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE DYSPF+GIEKG+VLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEADYSPFLGIEKGSVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDTGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLL+QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLSQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_011048664.1| PREDICTED: coatomer subunit gamma-like isoform X2 [Populus euphratica]
Length=885

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 181/187 (97%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE  YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDEE-YSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            ++FTK EATEVFF+VTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   DSFTKTEATEVFFSVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_003527225.1| PREDICTED: coatomer subunit gamma-like [Glycine max]
Length=882

 Score =   342 bits (878),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+G+EKG+VLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGLEKGSVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD+GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDMGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLL+QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLSQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_003631645.1| PREDICTED: coatomer subunit gamma-2 [Vitis vinifera]
 emb|CBI32579.3| unnamed protein product [Vitis vinifera]
Length=887

 Score =   342 bits (878),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE DYSPF+GIEKGAVLQEARVFN+PQL+ RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEADYSPFLGIEKGAVLQEARVFNDPQLEPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSRDTGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIV+RWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVRRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_003603909.1| Coatomer subunit gamma [Medicago truncatula]
 gb|AES74160.1| coatomer subunit gamma-like protein [Medicago truncatula]
Length=887

 Score =   342 bits (878),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPFMGIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFMGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EATEVFFAVTKLFQSKD+GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKTEATEVFFAVTKLFQSKDMGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLL QIERYLKQAIVDKNP+VASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLAQIERYLKQAIVDKNPIVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE+V
Sbjct  181  NEVQESV  187



>ref|XP_007131844.1| hypothetical protein PHAVU_011G046000g [Phaseolus vulgaris]
 gb|ESW03838.1| hypothetical protein PHAVU_011G046000g [Phaseolus vulgaris]
Length=887

 Score =   342 bits (877),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE DYSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDEADYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+DLGLRRMVYLIIKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMISKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRAN+IRVLCRITDGTLLTQIERYLKQ IVDKNPVVASAALVSGIHLLQT+PEIVKRWS
Sbjct  121  MYRANSIRVLCRITDGTLLTQIERYLKQGIVDKNPVVASAALVSGIHLLQTSPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010942029.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Elaeis guineensis]
Length=886

 Score =   342 bits (877),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 181/187 (97%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MA+PLVKKDDDRDDE  YSPFMGIEKGAVLQEARVFN+PQLDAR+C+ VITKLLYLLNQG
Sbjct  1    MAEPLVKKDDDRDDED-YSPFMGIEKGAVLQEARVFNDPQLDARKCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKIEATEVFFAVTKLFQSKDTGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHL QTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLFQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_007042213.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative isoform 1 [Theobroma cacao]
 gb|EOX98044.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative isoform 1 [Theobroma cacao]
Length=887

 Score =   342 bits (877),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEADYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF+VTKLFQS+D+GLRRMVY++IKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFSVTKLFQSRDIGLRRMVYVMIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KDP46244.1| hypothetical protein JCGZ_10084 [Jatropha curcas]
Length=887

 Score =   342 bits (876),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE ++SPF+GIEKGAVLQEARVFN+PQLD R+C+ VITKLLYLLNQG
Sbjct  1    MAQPLIKKDDDRDDEAEFSPFLGIEKGAVLQEARVFNDPQLDPRKCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+D+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS++D
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKSD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_011464120.1| PREDICTED: coatomer subunit gamma [Fragaria vesca subsp. vesca]
Length=886

 Score =   342 bits (876),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 182/187 (97%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE  YSPF+GIEKGAVLQ+ARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEE-YSPFLGIEKGAVLQDARVFNDPQLDPRRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+D+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKVEATEVFFAVTKLFQSRDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_011088383.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Sesamum indicum]
Length=871

 Score =   341 bits (875),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRD+E DYSPF+GIEKGAVLQEARVF++PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDEEADYSPFLGIEKGAVLQEARVFHDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E  TK+EATEVFFAVTKLFQSKD+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ETLTKIEATEVFFAVTKLFQSKDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            ++RANAIRVLCRITDGTLL QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  LFRANAIRVLCRITDGTLLAQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_007042214.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative isoform 2 [Theobroma cacao]
 gb|EOX98045.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative isoform 2 [Theobroma cacao]
Length=869

 Score =   341 bits (875),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEADYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF+VTKLFQS+D+GLRRMVY++IKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFSVTKLFQSRDIGLRRMVYVMIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_007136172.1| hypothetical protein PHAVU_009G024100g [Phaseolus vulgaris]
 gb|ESW08166.1| hypothetical protein PHAVU_009G024100g [Phaseolus vulgaris]
Length=887

 Score =   341 bits (875),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPFMGIEKG+VLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFMGIEKGSVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD+GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDMGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MY+ANAIRVLCRITDGTLL+QIERY+KQAIVDKNPVVASAAL+SG HLLQTNPEIVKRWS
Sbjct  121  MYKANAIRVLCRITDGTLLSQIERYIKQAIVDKNPVVASAALISGFHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_011088382.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Sesamum indicum]
Length=888

 Score =   341 bits (875),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRD+E DYSPF+GIEKGAVLQEARVF++PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDEEADYSPFLGIEKGAVLQEARVFHDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E  TK+EATEVFFAVTKLFQSKD+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ETLTKIEATEVFFAVTKLFQSKDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            ++RANAIRVLCRITDGTLL QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  LFRANAIRVLCRITDGTLLAQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010467348.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=886

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            EAFTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   EAFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+H+L+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHMLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KJB47485.1| hypothetical protein B456_008G028500 [Gossypium raimondii]
 gb|KJB47486.1| hypothetical protein B456_008G028500 [Gossypium raimondii]
Length=883

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD DDE+DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPFLKKDDDHDDEVDYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+DLGLRRMVY+IIKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDLGLRRMVYVIIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLC+ITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCQITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_006423249.1| hypothetical protein CICLE_v10027789mg [Citrus clementina]
 gb|ESR36489.1| hypothetical protein CICLE_v10027789mg [Citrus clementina]
Length=860

 Score =   340 bits (871),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D+GLRRMVYL+IKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSRDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLL+T PEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLETTPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010942028.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Elaeis guineensis]
Length=887

 Score =   340 bits (872),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MA+PLVKKDDDRDDE+DYSPFMGIEKGAVLQEARVFN+PQLDAR+C+ VITKLLYLLNQG
Sbjct  1    MAEPLVKKDDDRDDEVDYSPFMGIEKGAVLQEARVFNDPQLDARKCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSKDTGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHL QTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLFQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_006423248.1| hypothetical protein CICLE_v10027789mg [Citrus clementina]
 ref|XP_006487154.1| PREDICTED: coatomer subunit gamma-2-like isoform X1 [Citrus sinensis]
 gb|ESR36488.1| hypothetical protein CICLE_v10027789mg [Citrus clementina]
Length=886

 Score =   339 bits (870),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D+GLRRMVYL+IKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKIEATEVFFAVTKLFQSRDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLL+T PEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLETTPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_004500815.1| PREDICTED: coatomer subunit gamma-like [Cicer arietinum]
Length=887

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQ LVKKDDDRDDE +YSPFMGIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQQLVKKDDDRDDEAEYSPFMGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EATEVFFAVTKLFQS+D+GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKTEATEVFFAVTKLFQSRDMGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLL QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLAQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_006409466.1| hypothetical protein EUTSA_v10022539mg [Eutrema salsugineum]
 gb|ESQ50919.1| hypothetical protein EUTSA_v10022539mg [Eutrema salsugineum]
Length=886

 Score =   339 bits (869),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DG+LLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGSLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_011092782.1| PREDICTED: coatomer subunit gamma-2-like [Sesamum indicum]
Length=888

 Score =   339 bits (869),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE+DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEVDYSPFLGIEKGAVLQEARVFNDPQLDTRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E  TKVEATEVFFAVTKLFQSKD+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNSRTD
Sbjct  61   ETLTKVEATEVFFAVTKLFQSKDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDK+PVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKSPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KHG11475.1| hypothetical protein F383_06298 [Gossypium arboreum]
Length=887

 Score =   338 bits (868),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE+DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEVDYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+D+GLRRMVY+IIKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDMGLRRMVYVIIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KJB32493.1| hypothetical protein B456_005G242900 [Gossypium raimondii]
Length=882

 Score =   338 bits (867),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE+DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEVDYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+D+GLRRMVY+IIKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDMGLRRMVYVIIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|KJB32494.1| hypothetical protein B456_005G242900 [Gossypium raimondii]
Length=887

 Score =   338 bits (867),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE+DYSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEVDYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+D+GLRRMVY+IIKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDMGLRRMVYVIIKELSPSADEVIIVTSSLMKDMTSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_002509477.1| coatomer gamma subunit, putative [Ricinus communis]
 gb|EEF50864.1| coatomer gamma subunit, putative [Ricinus communis]
Length=887

 Score =   338 bits (867),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE DYSPF+GIEKGAVLQEARVFN+PQLD+R+C+ VITK+LYLLNQG
Sbjct  1    MAQPLIKKDDDRDDEADYSPFLGIEKGAVLQEARVFNDPQLDSRKCSQVITKILYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            ++ +K+EATEVFF+VTKLFQS+DL LRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   DSLSKIEATEVFFSVTKLFQSRDLALRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_006296595.1| hypothetical protein CARUB_v10012945mg [Capsella rubella]
 gb|EOA29493.1| hypothetical protein CARUB_v10012945mg [Capsella rubella]
Length=886

 Score =   338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDD DDE++YSPFMGIEKGAVLQEARVFNEPQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLMKKDDDHDDELEYSPFMGIEKGAVLQEARVFNEPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            EAFTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   EAFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLC+I DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+H+L+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCQIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHMLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010526924.1| PREDICTED: coatomer subunit gamma [Tarenaya hassleriana]
Length=886

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKIEATEVFFAVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVL RI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQT+PEIVKRWS
Sbjct  121  MYRANAIRVLSRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTSPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_002884158.1| hypothetical protein ARALYDRAFT_900277 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60417.1| hypothetical protein ARALYDRAFT_900277 [Arabidopsis lyrata subsp. 
lyrata]
Length=886

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFVGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+H+L+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHMLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|EYU37789.1| hypothetical protein MIMGU_mgv1a001103mg [Erythranthe guttata]
Length=888

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE+DYSPF+GIEKGAVLQEARVFN+PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEVDYSPFLGIEKGAVLQEARVFNDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EATEVFF+VTKLFQSKD+GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNSRTD
Sbjct  61   EIFTKTEATEVFFSVTKLFQSKDIGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQT PEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTTPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>emb|CAA18824.1| Nonclathrin coat protein gamma-like protein [Arabidopsis thaliana]
 emb|CAB80162.1| Nonclathrin coat protein gamma-like protein [Arabidopsis thaliana]
Length=831

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQ+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>gb|KFK30073.1| hypothetical protein AALP_AA7G213200 [Arabis alpina]
Length=886

 Score =   337 bits (863),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQ+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|NP_195171.2| coatomer subunit gamma [Arabidopsis thaliana]
 sp|Q0WW26.2|COPG_ARATH RecName: Full=Coatomer subunit gamma; AltName: Full=Gamma-coat 
protein; Short=Gamma-COP [Arabidopsis thaliana]
 dbj|BAH20306.1| AT4G34450 [Arabidopsis thaliana]
 gb|AEE86378.1| coatomer subunit gamma [Arabidopsis thaliana]
Length=886

 Score =   336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQ+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|XP_009392974.1| PREDICTED: coatomer subunit gamma-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392975.1| PREDICTED: coatomer subunit gamma-2-like [Musa acuminata subsp. 
malaccensis]
Length=887

 Score =   336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP VKKDDD D+E +YSPF GIEKGAVLQEARVF++PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPFVKKDDDLDEEEEYSPFHGIEKGAVLQEARVFHDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD  LRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDTVLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVAS ALVSG+HLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASGALVSGVHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_002869144.1| hypothetical protein ARALYDRAFT_491217 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45403.1| hypothetical protein ARALYDRAFT_491217 [Arabidopsis lyrata subsp. 
lyrata]
Length=889

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQ+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|XP_011037539.1| PREDICTED: coatomer subunit gamma [Populus euphratica]
Length=885

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE +YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEAEYSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            ++FTKVEATEVFF+VTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   DSFTKVEATEVFFSVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNP IV+R  
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPVIVRRRR  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_006412224.1| hypothetical protein EUTSA_v10024368mg [Eutrema salsugineum]
 gb|ESQ53677.1| hypothetical protein EUTSA_v10024368mg [Eutrema salsugineum]
Length=886

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP VKKDDD DDE++YSPFMGIEKGAVLQEARVFN+PQ+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPFVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDPQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|XP_006487155.1| PREDICTED: coatomer subunit gamma-2-like isoform X2 [Citrus sinensis]
Length=885

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 180/187 (96%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDDRDDE  YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDRDDEE-YSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQS+D+GLRRMVYL+IKELSPSADEVIIVTSSLMKDM S+TD
Sbjct  60   ETFTKIEATEVFFAVTKLFQSRDIGLRRMVYLMIKELSPSADEVIIVTSSLMKDMTSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLL+T PEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLETTPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_010065395.1| PREDICTED: coatomer subunit gamma [Eucalyptus grandis]
 gb|KCW62849.1| hypothetical protein EUGRSUZ_G00444 [Eucalyptus grandis]
Length=887

 Score =   334 bits (856),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD ++   YSPF+GIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPFMKKDDDDEEAD-YSPFLGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK EATEVFFAVTKLFQS+D+GLRRMVYL+IKE+SPSADEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKTEATEVFFAVTKLFQSRDIGLRRMVYLMIKEISPSADEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  120  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_009412267.1| PREDICTED: coatomer subunit gamma-2 [Musa acuminata subsp. malaccensis]
Length=887

 Score =   334 bits (856),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP VKKDDD D+E +YSPF GIEKGAVLQEARVF++PQLDARRC+ VITKLLYLLNQG
Sbjct  1    MAQPFVKKDDDLDEEEEYSPFYGIEKGAVLQEARVFHDPQLDARRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD  LRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+TD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSKDTVLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITD TLLTQIERYLKQAIVDKNPVVASAALVSG+HLLQTN EIVKRWS
Sbjct  121  MYRANAIRVLCRITDSTLLTQIERYLKQAIVDKNPVVASAALVSGVHLLQTNSEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_010432412.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=888

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLRTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|XP_010437613.1| PREDICTED: coatomer subunit gamma [Camelina sativa]
Length=888

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLRTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|XP_010447078.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=888

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLRTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>emb|CDY46248.1| BnaC03g66090D [Brassica napus]
Length=886

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP VKKDDD DDEM+YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPFVKKDDDHDDEMEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLRTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE V
Sbjct  181  NEVQEGV  187



>ref|XP_006283082.1| hypothetical protein CARUB_v10004095mg [Capsella rubella]
 gb|EOA15980.1| hypothetical protein CARUB_v10004095mg [Capsella rubella]
Length=912

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|XP_006649665.1| PREDICTED: coatomer subunit gamma-1-like [Oryza brachyantha]
Length=897

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 176/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  73   EMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            EMAQP +KKDDD ++   YSPF GIEKGAVLQEAR F++PQLDARRC+ VITKLLYLLNQ
Sbjct  13   EMAQPYMKKDDDDEEVE-YSPFFGIEKGAVLQEARAFHDPQLDARRCSQVITKLLYLLNQ  71

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GE FTKVEATEVFFAVTKLFQSKD GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+T
Sbjct  72   GETFTKVEATEVFFAVTKLFQSKDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKT  131

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRW
Sbjct  132  DMYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRW  191

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  192  SNEVQEAV  199



>ref|XP_009108729.1| PREDICTED: coatomer subunit gamma-like [Brassica rapa]
 emb|CDX76283.1| BnaA08g11170D [Brassica napus]
Length=886

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP VKKDDD DDEM+YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPFVKKDDDHDDEMEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLRTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE V
Sbjct  181  NEVQEGV  187



>ref|XP_004148851.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 ref|XP_004167678.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 gb|KGN61788.1| hypothetical protein Csa_2G245520 [Cucumis sativus]
Length=887

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE +YSPF+GIEKG VLQEARVFN+PQLD R+C+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDYDDEEEYSPFLGIEKGTVLQEARVFNDPQLDTRKCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF VTKLFQS+D+ LRRMVYL+IKELSPS+D+VIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKVEATEVFFGVTKLFQSRDIELRRMVYLMIKELSPSSDDVIIVTSSLMKDMNSKND  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|XP_008457930.1| PREDICTED: coatomer subunit gamma-like [Cucumis melo]
Length=887

 Score =   331 bits (849),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE +YSPF+GIEKG VLQEARVFN+PQLD R+C+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDYDDEEEYSPFLGIEKGTVLQEARVFNDPQLDTRKCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFF VTKLFQS+D+ LRRMVYL+IKELSPS+D+VIIVTSSLMKDMNS+ D
Sbjct  61   ETFTKVEATEVFFGVTKLFQSRDIELRRMVYLMIKELSPSSDDVIIVTSSLMKDMNSKND  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS
Sbjct  121  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>emb|CDX69060.1| BnaC01g03930D [Brassica napus]
Length=886

 Score =   331 bits (848),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP VKKDDD DDE++YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPYVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>emb|CDX75435.1| BnaA01g02670D [Brassica napus]
Length=886

 Score =   331 bits (848),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP VKKDDD DDE++YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPYVKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|XP_010028581.1| PREDICTED: coatomer subunit gamma [Eucalyptus grandis]
 gb|KCW55343.1| hypothetical protein EUGRSUZ_I01263 [Eucalyptus grandis]
Length=887

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP  KKDDDRD+E +YSPF+GIEKGAVLQEARVF++PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPFAKKDDDRDEEAEYSPFLGIEKGAVLQEARVFHDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQS+D+GLRRMVYL+IKE+SPS+DEVI+VTSSLMKDM SRTD
Sbjct  61   ETFTKVEATEVFFAVTKLFQSRDIGLRRMVYLMIKEISPSSDEVIMVTSSLMKDMTSRTD  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            +YRANAIRVLC+ITDGTLL QIERYLKQAIVDKNPVVASAALVSGIH+LQTNPEIVKRWS
Sbjct  121  VYRANAIRVLCQITDGTLLGQIERYLKQAIVDKNPVVASAALVSGIHILQTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>ref|NP_001049443.1| Os03g0227000 [Oryza sativa Japonica Group]
 gb|ABF94752.1| Adaptin N terminal region family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11357.1| Os03g0227000 [Oryza sativa Japonica Group]
 dbj|BAG90916.1| unnamed protein product [Oryza sativa Japonica Group]
Length=897

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 176/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  73   EMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            EMAQP +KKDDD +D   YSPF GIEKGAVLQEAR F++PQLDAR+C+ VITKLLYLLNQ
Sbjct  13   EMAQPYMKKDDDDEDVE-YSPFYGIEKGAVLQEARAFHDPQLDARKCSQVITKLLYLLNQ  71

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GE FTKVEATEVFFAVTKLFQSKD GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+T
Sbjct  72   GETFTKVEATEVFFAVTKLFQSKDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKT  131

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRW
Sbjct  132  DMYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRW  191

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  192  SNEVQEAV  199



>ref|XP_009121225.1| PREDICTED: coatomer subunit gamma [Brassica rapa]
 emb|CDY46215.1| BnaA07g03550D [Brassica napus]
Length=887

 Score =   330 bits (846),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE+++SPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDLDDELEFSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSP +DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPGSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+H+L++NPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHMLKSNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>emb|CDX71272.1| BnaC07g05510D [Brassica napus]
Length=887

 Score =   330 bits (846),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE+++SPFMGIEKGAVLQEARVFN+PQLD RRC+ VITKLLYLLNQG
Sbjct  1    MAQPLVKKDDDLDDELEFSPFMGIEKGAVLQEARVFNDPQLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSP +DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPGSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+H+L++NPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHMLKSNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  181  NEVQEAV  187



>gb|AAN60990.1| Putative Nonclathrin coat protein gamma - like protein [Oryza 
sativa Japonica Group]
Length=826

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 175/187 (94%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD +D   YSPF GIEKGAVLQEAR F++PQLDAR+C+ VITKLLYLLNQG
Sbjct  1    MAQPYMKKDDDDEDVE-YSPFYGIEKGAVLQEARAFHDPQLDARKCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKVEATEVFFAVTKLFQSKDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRWS
Sbjct  120  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|NP_001132662.1| uncharacterized protein LOC100194138 [Zea mays]
 gb|ACG28715.1| coatomer subunit gamma [Zea mays]
 gb|ACN34045.1| unknown [Zea mays]
 tpg|DAA42450.1| TPA: coatomer subunit gamma [Zea mays]
Length=888

 Score =   329 bits (844),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 178/188 (95%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDVGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>sp|Q8H852.2|COPG1_ORYSJ RecName: Full=Coatomer subunit gamma-1; AltName: Full=Gamma-1-coat 
protein; Short=Gamma-1-COP [Oryza sativa Japonica Group]
Length=884

 Score =   329 bits (844),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 175/187 (94%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD +D   YSPF GIEKGAVLQEAR F++PQLDAR+C+ VITKLLYLLNQG
Sbjct  1    MAQPYMKKDDDDEDVE-YSPFYGIEKGAVLQEARAFHDPQLDARKCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKVEATEVFFAVTKLFQSKDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRWS
Sbjct  120  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_009112399.1| PREDICTED: coatomer subunit gamma [Brassica rapa]
Length=886

 Score =   329 bits (844),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP  KKDDD DDE++YSPFMGIEKGAVLQEARVFN+ Q+D RRC+ VITKLLYLLNQG
Sbjct  1    MAQPYAKKDDDHDDELEYSPFMGIEKGAVLQEARVFNDAQVDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VTKLFQSKD GLRRMVYLIIKELSPS+DEVIIVTSSLMKDMNS+ D
Sbjct  61   ESFTKVEATEVFFSVTKLFQSKDTGLRRMVYLIIKELSPSSDEVIIVTSSLMKDMNSKID  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVV+SAALVSG+HLL+TNPEIVKRWS
Sbjct  121  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVSSAALVSGLHLLKTNPEIVKRWS  180

Query  616  NEVQEAV  636
            NEVQE +
Sbjct  181  NEVQEGI  187



>ref|XP_002459514.1| hypothetical protein SORBIDRAFT_02g005920 [Sorghum bicolor]
 gb|EER96035.1| hypothetical protein SORBIDRAFT_02g005920 [Sorghum bicolor]
Length=888

 Score =   328 bits (842),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>ref|XP_006658376.1| PREDICTED: coatomer subunit gamma-2-like [Oryza brachyantha]
Length=889

 Score =   328 bits (842),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>ref|XP_003557417.1| PREDICTED: coatomer subunit gamma-2 [Brachypodium distachyon]
Length=888

 Score =   328 bits (842),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDCDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PEIVKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEIVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>ref|NP_001059131.1| Os07g0201100 [Oryza sativa Japonica Group]
 sp|Q6Z382.1|COPG2_ORYSJ RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat 
protein; Short=Gamma-2-COP [Oryza sativa Japonica Group]
 dbj|BAC84213.1| putative coatomer protein gamma 2-subunit [Oryza sativa Japonica 
Group]
 dbj|BAF21045.1| Os07g0201100 [Oryza sativa Japonica Group]
 gb|EEE66759.1| hypothetical protein OsJ_23473 [Oryza sativa Japonica Group]
Length=889

 Score =   328 bits (842),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>gb|EEC81692.1| hypothetical protein OsI_25286 [Oryza sativa Indica Group]
Length=889

 Score =   328 bits (842),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>gb|ACL54542.1| unknown [Zea mays]
Length=888

 Score =   328 bits (842),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>ref|XP_008650919.1| PREDICTED: uncharacterized protein LOC100193726 isoform X1 [Zea 
mays]
 tpg|DAA59936.1| TPA: hypothetical protein ZEAMMB73_271533 [Zea mays]
Length=888

 Score =   328 bits (841),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>gb|EEE58633.1| hypothetical protein OsJ_09998 [Oryza sativa Japonica Group]
Length=913

 Score =   329 bits (843),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 175/187 (94%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD +D   YSPF GIEKGAVLQEAR F++PQLDAR+C+ VITKLLYLLNQG
Sbjct  1    MAQPYMKKDDDDEDVE-YSPFYGIEKGAVLQEARAFHDPQLDARKCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTKVEATEVFFAVTKLFQSKD GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKVEATEVFFAVTKLFQSKDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRWS
Sbjct  120  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_004955766.1| PREDICTED: coatomer subunit gamma-2-like [Setaria italica]
Length=888

 Score =   328 bits (841),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>gb|EEC74799.1| hypothetical protein OsI_10600 [Oryza sativa Indica Group]
Length=903

 Score =   328 bits (841),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 175/187 (94%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD +D   YSPF GIEKGAVLQEAR F++PQLDAR+C+ VITKLLYLLNQG
Sbjct  1    MAQPYMKKDDDDEDVE-YSPFYGIEKGAVLQEARAFHDPQLDARKCSQVITKLLYLLNQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E FTK+EATEVFFAVTKLFQSKD GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+TD
Sbjct  60   ETFTKIEATEVFFAVTKLFQSKDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRWS
Sbjct  120  MYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>ref|XP_009411250.1| PREDICTED: coatomer subunit gamma-2-like [Musa acuminata subsp. 
malaccensis]
Length=888

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQP-LVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MA+P +VKKDDD DDE +YSPF+G+EKG VLQEARVFN+PQLDARRCA VITKLLYLLNQ
Sbjct  1    MARPYVVKKDDDHDDEAEYSPFLGLEKGTVLQEARVFNDPQLDARRCAQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GEAFTKVEATEVFFAVTKLFQSKD  LRRMVYLIIKELSPSADEVIIVTSSLMKDMNS+ 
Sbjct  61   GEAFTKVEATEVFFAVTKLFQSKDTTLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSKI  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVL +ITDGTLL QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW
Sbjct  121  DMYRANAIRVLSKITDGTLLMQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  180

Query  613  SNEVQEAV  636
            SNEVQE V
Sbjct  181  SNEVQEGV  188



>ref|XP_003558423.1| PREDICTED: coatomer subunit gamma-1 [Brachypodium distachyon]
Length=897

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = +1

Query  73   EMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            EMAQP +KKDDD  +   YSPF GIEKGAVLQEAR F++PQLDARRC+ VITKLLYL+NQ
Sbjct  13   EMAQPYMKKDDDESEIE-YSPFFGIEKGAVLQEARAFHDPQLDARRCSQVITKLLYLINQ  71

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GE FTKVEATEVFFAVTKLFQS D GLRRMVYLIIKELSPS+DEV IVTSSLMKDMNS+T
Sbjct  72   GETFTKVEATEVFFAVTKLFQSNDAGLRRMVYLIIKELSPSSDEVFIVTSSLMKDMNSKT  131

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI DG LLTQIERYLKQAIVDKNPVV+SAALVSGIHLLQ NPEIVKRW
Sbjct  132  DMYRANAIRVLCRIIDGNLLTQIERYLKQAIVDKNPVVSSAALVSGIHLLQANPEIVKRW  191

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  192  SNEVQEAV  199



>dbj|BAJ99125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=889

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            M+QPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MSQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  180

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  181  SNEVQEAV  188



>dbj|BAK02925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=896

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 173/188 (92%), Gaps = 1/188 (1%)
 Frame = +1

Query  73   EMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            EMAQP +KKDDD  D   YSPF GIEKGAVLQEAR F++PQLDARRC+ VITKLLYL+NQ
Sbjct  13   EMAQPYMKKDDDDSDIE-YSPFFGIEKGAVLQEARAFHDPQLDARRCSQVITKLLYLINQ  71

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GE+FTKVEATEVFFAVTKLFQS D GLRR+VYL+IKELSPS+DEV IVTSSLMKDMNS+T
Sbjct  72   GESFTKVEATEVFFAVTKLFQSNDAGLRRLVYLMIKELSPSSDEVFIVTSSLMKDMNSKT  131

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI DG LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRW
Sbjct  132  DMYRANAIRVLCRIIDGNLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRW  191

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  192  SNEVQEAV  199



>ref|XP_002465599.1| hypothetical protein SORBIDRAFT_01g041860 [Sorghum bicolor]
 gb|EER92597.1| hypothetical protein SORBIDRAFT_01g041860 [Sorghum bicolor]
Length=898

 Score =   326 bits (836),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 173/188 (92%), Gaps = 1/188 (1%)
 Frame = +1

Query  73   EMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            EMAQP +KKDDD +D   YSPF GIEKGAVLQEAR F++PQLD RRC+ VITKLLYLLNQ
Sbjct  14   EMAQPYMKKDDDDEDVE-YSPFFGIEKGAVLQEARAFHDPQLDVRRCSQVITKLLYLLNQ  72

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GE FTKVEATEVFFAVTKLFQS D GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+T
Sbjct  73   GETFTKVEATEVFFAVTKLFQSSDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKT  132

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHL Q NPEIVKRW
Sbjct  133  DMYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLAQANPEIVKRW  192

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  193  SNEVQEAV  200



>ref|XP_004985097.1| PREDICTED: coatomer subunit gamma-1-like [Setaria italica]
Length=899

 Score =   326 bits (836),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   EMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            EMAQP +KKDDD D+E++YSPF GIEKGAVLQEAR F++PQLD RRC+ VITKLLYLLNQ
Sbjct  14   EMAQPYMKKDDDDDEEVEYSPFFGIEKGAVLQEARAFHDPQLDVRRCSQVITKLLYLLNQ  73

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GE FTKVEATEVFFAVTKLFQS D GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+T
Sbjct  74   GETFTKVEATEVFFAVTKLFQSSDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKT  133

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHL Q NPEIVKRW
Sbjct  134  DMYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLAQANPEIVKRW  193

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  194  SNEVQEAV  201



>gb|EMT19755.1| Coatomer subunit gamma-1 [Aegilops tauschii]
Length=883

 Score =   325 bits (832),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 172/187 (92%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD  D   YSPF GIEKGAVLQEAR F++PQLDARRC+ VITKLLYL+NQG
Sbjct  1    MAQPYMKKDDDDSDIE-YSPFFGIEKGAVLQEARAFHDPQLDARRCSQVITKLLYLINQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFFAVTKLFQS D GLRR+VYL+IKELSPS+DEV IVTSSLMKDMNS+TD
Sbjct  60   ESFTKVEATEVFFAVTKLFQSNDAGLRRLVYLMIKELSPSSDEVFIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DG LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRWS
Sbjct  120  MYRANAIRVLCRIIDGNLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>gb|EMS53044.1| Coatomer subunit gamma-1 [Triticum urartu]
Length=883

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 172/187 (92%), Gaps = 1/187 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQP +KKDDD  D   YSPF GIEKGAVLQEAR F++PQLDARRC+ VITKLLYL+NQG
Sbjct  1    MAQPYMKKDDDDSDIE-YSPFFGIEKGAVLQEARAFHDPQLDARRCSQVITKLLYLINQG  59

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFFAVTKLFQS D GLRR+VYL+IKELSPS+DEV IVTSSLMKDMNS+TD
Sbjct  60   ESFTKVEATEVFFAVTKLFQSNDAGLRRLVYLMIKELSPSSDEVFIVTSSLMKDMNSKTD  119

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MYRANAIRVLCRI DG LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQ NPEIVKRWS
Sbjct  120  MYRANAIRVLCRIIDGNLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQANPEIVKRWS  179

Query  616  NEVQEAV  636
            NEVQEAV
Sbjct  180  NEVQEAV  186



>gb|EMS56973.1| Coatomer subunit gamma-2 [Triticum urartu]
Length=895

 Score =   322 bits (824),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 177/194 (91%), Gaps = 7/194 (4%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAH------VITKL  234
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC        VITKL
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQGRLPNPVITKL  60

Query  235  LYLLNQGEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMK  414
            LYLLNQG+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEVIIVTSSLMK
Sbjct  61   LYLLNQGDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEVIIVTSSLMK  120

Query  415  DMNSRTDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNP  594
            DMNS+TDMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+P
Sbjct  121  DMNSKTDMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSP  180

Query  595  EIVKRWSNEVQEAV  636
            E+VKRWSNEVQEAV
Sbjct  181  EVVKRWSNEVQEAV  194



>ref|NP_001146210.1| uncharacterized protein LOC100279780 [Zea mays]
 gb|ACL52566.1| unknown [Zea mays]
Length=899

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = +1

Query  73   EMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            EMA P +KKDDD +D   YSPF GIEKG+VLQEAR F++PQLD RRC+ VI KLLYLLNQ
Sbjct  14   EMAHPYMKKDDDDEDVE-YSPFFGIEKGSVLQEARAFHDPQLDVRRCSQVIIKLLYLLNQ  72

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GE FTKVEATEVFFAVTKLFQS D GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+T
Sbjct  73   GETFTKVEATEVFFAVTKLFQSSDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKT  132

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASA+LVSGIHL Q NPEIVKRW
Sbjct  133  DMYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASASLVSGIHLAQANPEIVKRW  192

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  193  SNEVQEAV  200



>tpg|DAA42449.1| TPA: hypothetical protein ZEAMMB73_223819, partial [Zea mays]
Length=191

 Score =   298 bits (763),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDVGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNP  594
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQ  P
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQVCP  174



>gb|ACN34393.1| unknown [Zea mays]
Length=208

 Score =   297 bits (761),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD+GLRRMVYL+IKELSPSADEVIIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDVGLRRMVYLMIKELSPSADEVIIVTSSLMKDMNSKT  120

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNP  594
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQ  P
Sbjct  121  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQVCP  174



>ref|XP_002990584.1| hypothetical protein SELMODRAFT_185391 [Selaginella moellendorffii]
 gb|EFJ08461.1| hypothetical protein SELMODRAFT_185391 [Selaginella moellendorffii]
Length=886

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  70   LEMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLN  249
            + +AQ   KKDDDR+D+ +YSPF GIEK +VLQEARVFN+PQLD RRCA VITKLLYLLN
Sbjct  1    MALAQSGAKKDDDREDDAEYSPFYGIEKASVLQEARVFNDPQLDTRRCAQVITKLLYLLN  60

Query  250  QGEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSR  429
            QGE FTK EATEVFFAVTKLFQSKD+ LRRMVYL+IKE++PS+DEVIIVTSSLMKDM+S+
Sbjct  61   QGETFTKTEATEVFFAVTKLFQSKDVPLRRMVYLMIKEVTPSSDEVIIVTSSLMKDMSSK  120

Query  430  TDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKR  609
            TD+YRANAIRVLCRITDG LL QIERYLKQA+VDKNPVVASAA+VSGIHLLQTNPEIV+R
Sbjct  121  TDLYRANAIRVLCRITDGALLGQIERYLKQAVVDKNPVVASAAIVSGIHLLQTNPEIVRR  180

Query  610  WSNEVQEAV  636
            WSNEVQEAV
Sbjct  181  WSNEVQEAV  189



>tpg|DAA44254.1| TPA: hypothetical protein ZEAMMB73_398050 [Zea mays]
Length=1015

 Score =   319 bits (817),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = +1

Query  73   EMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            EMA P +KKDDD +D   YSPF GIEKG+VLQEAR F++PQLD RRC+ VI KLLYLLNQ
Sbjct  130  EMAHPYMKKDDDDEDVE-YSPFFGIEKGSVLQEARAFHDPQLDVRRCSQVIIKLLYLLNQ  188

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            GE FTKVEATEVFFAVTKLFQS D GLRR+VYL+IKELSPS+DEVIIVTSSLMKDMNS+T
Sbjct  189  GETFTKVEATEVFFAVTKLFQSSDAGLRRLVYLMIKELSPSSDEVIIVTSSLMKDMNSKT  248

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI DGTLLTQIERYLKQAIVDKNPVVASA+LVSGIHL Q NPEIVKRW
Sbjct  249  DMYRANAIRVLCRIIDGTLLTQIERYLKQAIVDKNPVVASASLVSGIHLAQANPEIVKRW  308

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  309  SNEVQEAV  316



>ref|XP_002983626.1| hypothetical protein SELMODRAFT_268757 [Selaginella moellendorffii]
 gb|EFJ15122.1| hypothetical protein SELMODRAFT_268757 [Selaginella moellendorffii]
Length=886

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  70   LEMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLN  249
            + +AQ   KKDDDR+D+ +YSPF GIEK +VLQEARVFN+PQLD RRCA VITKLLYLLN
Sbjct  1    MALAQSGAKKDDDREDDAEYSPFYGIEKASVLQEARVFNDPQLDTRRCAQVITKLLYLLN  60

Query  250  QGEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSR  429
            QGE FTK EATEVFFAVTKLFQSKD+ LRRMVYL+IKE++PS+DEVIIVTSSLMKDM+S+
Sbjct  61   QGETFTKTEATEVFFAVTKLFQSKDVPLRRMVYLMIKEVTPSSDEVIIVTSSLMKDMSSK  120

Query  430  TDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKR  609
            TD+YRANAIRVLCRITDG LL QIERYLKQA+VDKNPVVASAA+VSGIHLLQTNPEIV+R
Sbjct  121  TDLYRANAIRVLCRITDGALLGQIERYLKQAVVDKNPVVASAAIVSGIHLLQTNPEIVRR  180

Query  610  WSNEVQEAV  636
            WSNEVQEAV
Sbjct  181  WSNEVQEAV  189



>ref|XP_010942771.1| PREDICTED: coatomer subunit gamma-2-like [Elaeis guineensis]
Length=888

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = +1

Query  70   LEMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLN  249
            + MA+PLVKKDDDRD E  YSPF+G+EKGAVLQEARVFN+PQLD RRC  VITKLLYLLN
Sbjct  1    MAMAEPLVKKDDDRDYED-YSPFLGVEKGAVLQEARVFNDPQLDGRRCLQVITKLLYLLN  59

Query  250  QGEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSR  429
            QGE FTKVEATEVFFAVTKLFQSKD  LRRMVYL+IKELSPS+DEVI+VTSSLMKDMNS+
Sbjct  60   QGETFTKVEATEVFFAVTKLFQSKDTVLRRMVYLMIKELSPSSDEVIMVTSSLMKDMNSK  119

Query  430  TDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKR  609
             DMYRANAIRVLCRI D TLL Q+ERYL QAIVDKNPVVASAALVSGIHLLQTNP IVKR
Sbjct  120  NDMYRANAIRVLCRIIDDTLLAQMERYLTQAIVDKNPVVASAALVSGIHLLQTNPGIVKR  179

Query  610  WSNEVQEAV  636
            W+ EVQEAV
Sbjct  180  WTKEVQEAV  188



>ref|XP_001780339.1| predicted protein [Physcomitrella patens]
 gb|EDQ54898.1| predicted protein [Physcomitrella patens]
Length=892

 Score =   313 bits (801),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  85   PLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAF  264
            P +KKDDD DD+ +YSPF GIEK AVLQEAR FN+ +LDARRCA VITKLLYL+NQGE F
Sbjct  6    PALKKDDDIDDDSEYSPFYGIEKSAVLQEARCFNDRELDARRCAQVITKLLYLINQGETF  65

Query  265  TKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYR  444
            TK EATEVFFA TKLFQS+D+GLRRMVY++IKE+SPS+DEVIIVTSSLMKDMNS+TD+YR
Sbjct  66   TKNEATEVFFATTKLFQSRDIGLRRMVYIMIKEISPSSDEVIIVTSSLMKDMNSKTDLYR  125

Query  445  ANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEV  624
            ANAIRVLCRITDG LL QIERYLKQA+VDKNPVV+SAALVSGIHLLQ+NPEIVKRWSNEV
Sbjct  126  ANAIRVLCRITDGGLLGQIERYLKQAVVDKNPVVSSAALVSGIHLLQSNPEIVKRWSNEV  185

Query  625  QEAV  636
            QEAV
Sbjct  186  QEAV  189



>ref|XP_001760258.1| predicted protein [Physcomitrella patens]
 gb|EDQ75014.1| predicted protein [Physcomitrella patens]
Length=890

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +1

Query  70   LEMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLN  249
            + + Q ++KKDDD +DE ++SPF GIEK AVLQEARVFN+ +LDARRCA VITKLLYL+N
Sbjct  1    MALVQSVLKKDDDIEDESEFSPFYGIEKSAVLQEARVFNDRELDARRCAQVITKLLYLIN  60

Query  250  QGEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSR  429
            QGE FTK EAT+VFFA TKLFQSKD+GLRRMVYL+IKE+SPS DEVIIVTSSLMKDMNS+
Sbjct  61   QGETFTKNEATDVFFATTKLFQSKDIGLRRMVYLMIKEISPSNDEVIIVTSSLMKDMNSK  120

Query  430  TDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKR  609
            TD+YRANAIRVLCRITDG LL QIERYLKQA+VDKNPVV+SAALVSGIHLLQ+NPEIVKR
Sbjct  121  TDLYRANAIRVLCRITDGGLLGQIERYLKQAVVDKNPVVSSAALVSGIHLLQSNPEIVKR  180

Query  610  WSNEVQEAV  636
            WSNEVQEAV
Sbjct  181  WSNEVQEAV  189



>ref|XP_010096181.1| Coatomer subunit gamma-2 [Morus notabilis]
 gb|EXB63576.1| Coatomer subunit gamma-2 [Morus notabilis]
Length=859

 Score =   309 bits (792),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 179/207 (86%), Gaps = 20/207 (10%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPL+KKDDDRDDE DYSPF+GIEKGAVLQEARVFN+PQLDARRC+ + + +L+  + G
Sbjct  1    MAQPLIKKDDDRDDEADYSPFLGIEKGAVLQEARVFNDPQLDARRCSQLYSSVLFRTDLG  60

Query  256  ---------EAFT-----------KVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPS  375
                     +AF            ++EATEVFFAVTKLFQS+D+GLRRMVYL+IKELSPS
Sbjct  61   LFRVDSGYYQAFVSAESGRNLYKGQIEATEVFFAVTKLFQSRDIGLRRMVYLMIKELSPS  120

Query  376  ADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASA  555
            ADEVIIVTSSLMKDMNS+TDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASA
Sbjct  121  ADEVIIVTSSLMKDMNSKTDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASA  180

Query  556  ALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            ALVSGIHLLQTNPEIVKRWSNEVQEAV
Sbjct  181  ALVSGIHLLQTNPEIVKRWSNEVQEAV  207



>gb|EMT05643.1| Coatomer subunit gamma-2 [Aegilops tauschii]
Length=1168

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 172/188 (91%), Gaps = 2/188 (1%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            MAQPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MAQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEVFFA TKLFQSKD GLRRMVYL+IKELSPSADEV     SLMKDMNS+T
Sbjct  61   GDTFTKVEATEVFFATTKLFQSKDAGLRRMVYLMIKELSPSADEV-AECCSLMKDMNSKT  119

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  120  DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  179

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  180  SNEVQEAV  187



>gb|KFK29733.1| hypothetical protein AALP_AA7G171600 [Arabis alpina]
Length=886

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEAR+FN+ Q+D RRC+ VITKL+YLLNQG
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARIFNDSQVDPRRCSQVITKLVYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEAT+VFF+VTKLFQS+D GLRRMVYLIIKELSPS DEVI+VTSSL+KD+N   +
Sbjct  61   ESFTKVEATQVFFSVTKLFQSEDTGLRRMVYLIIKELSPSPDEVIMVTSSLVKDINCNIE  120

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MY+ANAIRVLCRI D +LLT  ER LKQAIVDKNPVV+SAALVSG+HLL+T PEI+K+W+
Sbjct  121  MYKANAIRVLCRIIDESLLTHFERILKQAIVDKNPVVSSAALVSGLHLLKTYPEIIKKWN  180

Query  616  NEVQEAV  636
            +EVQ+ +
Sbjct  181  DEVQQGI  187



>ref|XP_007509254.1| coatomer protein gamma-subunit [Bathycoccus prasinos]
 emb|CCO19711.1| coatomer protein gamma-subunit [Bathycoccus prasinos]
Length=924

 Score =   289 bits (739),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +1

Query  91   VKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTK  270
            VKK D+  D++ YSPF GIEKGAVLQEAR FN+ QLDARRC  VITKLLYL NQG+ FTK
Sbjct  13   VKKRDEDSDDVYYSPFWGIEKGAVLQEARCFNDSQLDARRCQQVITKLLYLCNQGDTFTK  72

Query  271  VEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRAN  450
             EATEVFF+VTKLFQSKD  LRRMVYLIIKE+ PS+DEVIIVTSSLMKDMNS+ D+YR+N
Sbjct  73   TEATEVFFSVTKLFQSKDSNLRRMVYLIIKEVCPSSDEVIIVTSSLMKDMNSKVDLYRSN  132

Query  451  AIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQE  630
            AIRVLC ITD  LL QIERYLKQA+VDKN VV+SAALVSG+HLL+ N +IV+RWSNE+QE
Sbjct  133  AIRVLCSITDAGLLGQIERYLKQAVVDKNSVVSSAALVSGLHLLKINADIVRRWSNEIQE  192

Query  631  AV  636
            A+
Sbjct  193  AI  194



>ref|XP_001762251.1| predicted protein [Physcomitrella patens]
 gb|EDQ73043.1| predicted protein [Physcomitrella patens]
Length=800

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +1

Query  70   LEMAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLN  249
            + + QP +KKDDD +D+ +YSPF GIE+ AVLQEARVFN+ +LDARRC  VITK+LY +N
Sbjct  1    MTLVQPPLKKDDDVEDDSEYSPFYGIERSAVLQEARVFNDRELDARRCTQVITKVLYFIN  60

Query  250  QGEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSR  429
            QG +FT+ E T+VFFA TKLFQS D+GLRRMVYLIIKE+SPS DEVIIVTSSLMKDMNS+
Sbjct  61   QGVSFTQKEVTDVFFATTKLFQSNDIGLRRMVYLIIKEISPSNDEVIIVTSSLMKDMNSK  120

Query  430  TDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKR  609
            T++YRANAIRVLCRITDG LL QIE +LKQA+VDK+PVV+SAALVSGIHLLQ+ PEIVK 
Sbjct  121  TNLYRANAIRVLCRITDGGLLGQIELHLKQAVVDKSPVVSSAALVSGIHLLQSYPEIVKG  180

Query  610  WSNEVQEAV  636
            WSNEV EAV
Sbjct  181  WSNEVYEAV  189



>ref|XP_002507482.1| coatomer protein gamma-subunit [Micromonas sp. RCC299]
 gb|ACO68740.1| coatomer protein gamma-subunit [Micromonas sp. RCC299]
Length=897

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            +SPF GIEKGAVLQEAR FNE QLDARRC  VITKLLYL NQG++FTKVEATEVFF+VTK
Sbjct  22   FSPFWGIEKGAVLQEARCFNESQLDARRCQQVITKLLYLSNQGDSFTKVEATEVFFSVTK  81

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            LFQS D  LRRMVYLIIKE+ PSADEVIIVTSSLMKDMNS+ D+YR+NAIRVLC ITD  
Sbjct  82   LFQSSDSNLRRMVYLIIKEICPSADEVIIVTSSLMKDMNSKIDLYRSNAIRVLCNITDAG  141

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            LL QIERYLKQA+VDKN  V+SAALVSG HLLQ N EIVKRWS+EVQEA+
Sbjct  142  LLGQIERYLKQAVVDKNATVSSAALVSGHHLLQVNSEIVKRWSSEVQEAL  191



>ref|XP_003056073.1| coatomer protein gamma-subunit [Micromonas pusilla CCMP1545]
 gb|EEH59449.1| coatomer protein gamma-subunit [Micromonas pusilla CCMP1545]
Length=893

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            SPF GIEKGAVLQEAR FN+ QLD RRC  VITKLLYL NQG++FTK EATEVFFAVTKL
Sbjct  27   SPFWGIEKGAVLQEARCFNDSQLDTRRCQQVITKLLYLCNQGDSFTKTEATEVFFAVTKL  86

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD  LRRMVYLIIKE+ P+ADEVIIVTSSLMKDMNS+ D+YR+NAIR LC ITD  L
Sbjct  87   FQSKDTNLRRMVYLIIKEICPTADEVIIVTSSLMKDMNSKIDLYRSNAIRALCNITDAGL  146

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L QIERYLKQA+VD+N VVASAALVSG HLL+ N EIV+RWSNEVQEAV
Sbjct  147  LGQIERYLKQAVVDRNAVVASAALVSGTHLLKVNCEIVRRWSNEVQEAV  195



>ref|XP_002946805.1| hypothetical protein VOLCADRAFT_72994 [Volvox carteri f. nagariensis]
 gb|EFJ52031.1| hypothetical protein VOLCADRAFT_72994 [Volvox carteri f. nagariensis]
Length=884

 Score =   277 bits (709),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            +SPF GI+KGAVLQEARVFN+PQ+D RRC  VITKLLYLLNQGE FTK EA EVFF VTK
Sbjct  28   FSPFYGIDKGAVLQEARVFNDPQIDPRRCQQVITKLLYLLNQGEVFTKKEAAEVFFGVTK  87

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            LFQ +D+ LRRM+YL IK++ P ADEVIIVTSSLMKDMNS+TD+YRAN++RVLC+I DG 
Sbjct  88   LFQKQDINLRRMMYLCIKDICPGADEVIIVTSSLMKDMNSKTDLYRANSVRVLCKIIDGQ  147

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            LL QIERYLKQAIVDK+ VVASAALVS +HLL  N EIVKRW NEVQEA
Sbjct  148  LLAQIERYLKQAIVDKSAVVASAALVSALHLLGNNAEIVKRWVNEVQEA  196



>ref|XP_001691193.1| gamma-cop [Chlamydomonas reinhardtii]
 gb|EDP04926.1| gamma-cop [Chlamydomonas reinhardtii]
Length=883

 Score =   277 bits (708),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            +SPF GI+KGAVLQEARVFN+PQ+D RRC  VITKLLYLLNQGE FTK EA EVFF VTK
Sbjct  28   FSPFYGIDKGAVLQEARVFNDPQIDPRRCQQVITKLLYLLNQGEVFTKKEAAEVFFGVTK  87

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            LFQ +D+ LRRM+YL IK++ P ADEVIIVTSSLMKDMNS+TD+YR+N++RVLC+I D  
Sbjct  88   LFQKQDINLRRMMYLCIKDICPGADEVIIVTSSLMKDMNSKTDLYRSNSVRVLCKIIDSQ  147

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            LL QIERYLKQAIVDK+PVVASAALVS +HLL  N EIVKRW NEVQEA
Sbjct  148  LLAQIERYLKQAIVDKSPVVASAALVSALHLLGNNAEIVKRWINEVQEA  196



>ref|XP_004301551.1| PREDICTED: coatomer subunit gamma-like [Fragaria vesca subsp. 
vesca]
Length=894

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 162/189 (86%), Gaps = 6/189 (3%)
 Frame = +1

Query  79   AQPLVKKdddrddemdYSPFMGIEKGAVLQEARVF-NEPQLDARRCAHVITKLLYLLNQG  255
            AQPLVKKD+D ++   +S F  IEKGAVLQEARVF N+ QLD+RRC  VITKLLYLLNQG
Sbjct  3    AQPLVKKDEDYEEC--HSLFWRIEKGAVLQEARVFFNDAQLDSRRCYQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT-  432
            E FTK+E TEVFFA+TKLF+S D GLRRMVYL+IKEL P ADEV IVTSSLMKDMNS+  
Sbjct  61   ETFTKIETTEVFFAMTKLFRSTDKGLRRMVYLMIKELLPCADEVFIVTSSLMKDMNSKAS  120

Query  433  -DMY-RANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVK  606
             DMY RANAIRVLCRI DGTL+TQIERYLKQAIVD NPVVASAALVSGIHL +TNPE VK
Sbjct  121  DDMYRRANAIRVLCRIADGTLVTQIERYLKQAIVDNNPVVASAALVSGIHLFKTNPETVK  180

Query  607  RWSNEVQEA  633
             W+NEVQ+A
Sbjct  181  WWTNEVQQA  189



>gb|KHN10358.1| Coatomer subunit gamma [Glycine soja]
Length=219

 Score =   258 bits (660),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 144/191 (75%), Gaps = 39/191 (20%)
 Frame = +1

Query  139  MGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQS  318
            MGIEKG+VLQEARVFN+PQLDARRC+ VITKLLYLLNQGE FTKV+AT+ FF VTKLFQS
Sbjct  1    MGIEKGSVLQEARVFNDPQLDARRCSQVITKLLYLLNQGETFTKVKATKFFFPVTKLFQS  60

Query  319  KDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLTQ  498
            KD+GLRRM              VIIVTSS+MKDMN++ DMYRAN+I VLCRITDGTLL+Q
Sbjct  61   KDMGLRRM--------------VIIVTSSIMKDMNNKIDMYRANSILVLCRITDGTLLSQ  106

Query  499  IERYLKQAIVDKNPVVASAALVSGIHLLQT-------------------------NPEIV  603
            IERYLKQAIVDKNPVVASAALVSGIHLLQ                          NPEIV
Sbjct  107  IERYLKQAIVDKNPVVASAALVSGIHLLQVIVILISFCNSLYILIFIYAFCLLRMNPEIV  166

Query  604  KRWSNEVQEAV  636
            KRWSNEVQE V
Sbjct  167  KRWSNEVQEVV  177



>ref|XP_005847180.1| hypothetical protein CHLNCDRAFT_31542 [Chlorella variabilis]
 gb|EFN55078.1| hypothetical protein CHLNCDRAFT_31542 [Chlorella variabilis]
Length=910

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            YSPF GIEKGAVLQEAR FN+  +D RRC  VITKLLYLL QGE+FTK EA+EVFF+VTK
Sbjct  31   YSPFYGIEKGAVLQEARCFNDSHVDPRRCQQVITKLLYLLTQGESFTKAEASEVFFSVTK  90

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            LFQ KD+ LRRMVYL+IKE+ PS+DEVII+TSSLMKDMNS+ D+YRANAIRVLCRI D  
Sbjct  91   LFQHKDVHLRRMVYLVIKEIIPSSDEVIIITSSLMKDMNSKNDLYRANAIRVLCRIIDSQ  150

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            +L QIERYLKQA+VDK+ VVASA L   IHL   N E++KRWSNEVQEA+
Sbjct  151  MLLQIERYLKQAVVDKSAVVASAVLAGAIHLAGANSEVIKRWSNEVQEAI  200



>gb|KFK41271.1| hypothetical protein AALP_AA2G108400 [Arabis alpina]
Length=800

 Score =   261 bits (666),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 157/178 (88%), Gaps = 2/178 (1%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQ LVKKDDD DD+++YSPF+GIEKGAVLQEARVFN+  LD RRC+ VITKLLYLLNQG
Sbjct  1    MAQLLVKKDDDHDDDLEYSPFIGIEKGAVLQEARVFNDTHLDPRRCSQVITKLLYLLNQG  60

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
            E+FTKVEATEVFF+VT+LFQS+D+GLRRMVYLIIKEL+PS DEVIIVTS+L KD+    D
Sbjct  61   ESFTKVEATEVFFSVTRLFQSEDIGLRRMVYLIIKELNPSVDEVIIVTSALRKDIT--ID  118

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKR  609
            MYRANAIRVLCRI DG+LLTQIER LK+A++DKNPVV+SA LVSG+H+L+    +  R
Sbjct  119  MYRANAIRVLCRIIDGSLLTQIERRLKEAVLDKNPVVSSAVLVSGLHMLKVQEAVQSR  176



>ref|XP_001754805.1| predicted protein [Physcomitrella patens]
 gb|EDQ80259.1| predicted protein, partial [Physcomitrella patens]
Length=843

 Score =   258 bits (660),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  217  HVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIV  396
             VITKLLYL+NQGE FTK EAT+VFFA TKLFQSKD+GLRRMVYL+IKE+SPS+DEVIIV
Sbjct  1    QVITKLLYLINQGETFTKNEATDVFFATTKLFQSKDIGLRRMVYLMIKEISPSSDEVIIV  60

Query  397  TSSLMKDMNSRTDMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIH  576
            TSSLMKDMNS+TD+YRANAIRVLCRITDG LL QIERYLKQA+VDKNPVV+SAALVSGIH
Sbjct  61   TSSLMKDMNSKTDLYRANAIRVLCRITDGGLLGQIERYLKQAVVDKNPVVSSAALVSGIH  120

Query  577  LLQTNPEIVKRWSNEVQEAV  636
            LLQ+NPEIVKRWSNEVQEAV
Sbjct  121  LLQSNPEIVKRWSNEVQEAV  140



>gb|KDD74661.1| adaptin, partial [Helicosporidium sp. ATCC 50920]
Length=228

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            YSPF GIEKG VLQEAR FN  Q+D R+C  +ITKLLYLL QGE  TK EA++VFF+VTK
Sbjct  29   YSPFYGIEKGLVLQEAREFNNAQVDPRKCQQIITKLLYLLTQGEHLTKTEASDVFFSVTK  88

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            LFQ  D+ LRRMVYL+IK + PS+DEVII+TSSLMKDMNSR ++YRANAIRVLCRI D  
Sbjct  89   LFQHPDVHLRRMVYLVIKAVIPSSDEVIIITSSLMKDMNSRNELYRANAIRVLCRIMDPG  148

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            +L QIERYLKQA+VDK+PVVA+A L   + L   + ++++RW++EV EA+
Sbjct  149  MLLQIERYLKQAVVDKSPVVAAAVLAGSVRLAAQSSDVLRRWASEVSEAM  198



>ref|XP_001416165.1| Coatomer gamma subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO94458.1| Coatomer gamma subunit [Ostreococcus lucimarinus CCE9901]
Length=868

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            SPF GIEKG VLQEAR FN+PQLDAR+C  VITKLLYL  QGE FTK E TE+FF+VTKL
Sbjct  21   SPFWGIEKGIVLQEARCFNDPQLDARKCQQVITKLLYLHVQGEFFTKTEITEIFFSVTKL  80

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSK+  LRRM+YLIIKE+ P++DEVIIVTSSLMKDMNS+ D+YRANAIRVLC I D  +
Sbjct  81   FQSKNNNLRRMLYLIIKEICPTSDEVIIVTSSLMKDMNSKVDLYRANAIRVLCCIADSAI  140

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L QIERYLKQAIVD++  V+SAAL+S  HL   + +IV+RWS+E+QEAV
Sbjct  141  LGQIERYLKQAIVDRSDAVSSAALISATHLSLADVDIVRRWSSEIQEAV  189



>emb|CEG01036.1| Clathrin alpha-adaptin/coatomer adaptor,appendage, C-terminal 
subdomain, partial [Ostreococcus tauri]
Length=864

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            SPF+GIEKG VLQEAR FN+PQLD R+C  VITKLLYL  QGE FTK E TE+FF+VTKL
Sbjct  17   SPFVGIEKGIVLQEARCFNDPQLDVRKCQQVITKLLYLNIQGELFTKNEITEIFFSVTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSK   LRRMVYLIIKE+ PS+DEVIIVTSSLMKDMNS+ D+YRANAIRVLC I D   
Sbjct  77   FQSKSSNLRRMVYLIIKEICPSSDEVIIVTSSLMKDMNSKVDLYRANAIRVLCCIADAAT  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L QIERYLKQAIVD++  V+SAALVS  HL   + +IV+RWS+E+QEA+
Sbjct  137  LGQIERYLKQAIVDRSDAVSSAALVSATHLTHADVDIVRRWSSEIQEAI  185



>ref|XP_005651915.1| Coatomer, gamma subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE27371.1| Coatomer, gamma subunit [Coccomyxa subellipsoidea C-169]
Length=866

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            YSPF  IEKGAVLQEAR FN+P +D RRC  VITKLLYLL QGE  TK EA+EVFF+VTK
Sbjct  8    YSPFYAIEKGAVLQEARCFNDPHIDPRRCQQVITKLLYLLTQGETLTKKEASEVFFSVTK  67

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            L+QSKD  LRRMVYL+IK++ P ADEVII+TSSLMKDMNS+TD+YR+NAIRVLC ITD  
Sbjct  68   LYQSKDANLRRMVYLVIKDVCPGADEVIIITSSLMKDMNSKTDLYRSNAIRVLCSITDSQ  127

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            LL QIERYLKQAIVDK  VVASA LVS +HLL  N EIVKRW+NE+QEAV
Sbjct  128  LLGQIERYLKQAIVDKAAVVASAVLVSALHLLGHNSEIVKRWTNEIQEAV  177



>gb|KFK29732.1| hypothetical protein AALP_AA7G171600 [Arabis alpina]
Length=869

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 155/187 (83%), Gaps = 17/187 (9%)
 Frame = +1

Query  76   MAQPLVKKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQG  255
            MAQPLVKKDDD DDE++YSPFMGIEKGAVLQEAR+FN+ Q+D RRC              
Sbjct  1    MAQPLVKKDDDHDDELEYSPFMGIEKGAVLQEARIFNDSQVDPRRC--------------  46

Query  256  EAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTD  435
               ++VEAT+VFF+VTKLFQS+D GLRRMVYLIIKELSPS DEVI+VTSSL+KD+N   +
Sbjct  47   ---SQVEATQVFFSVTKLFQSEDTGLRRMVYLIIKELSPSPDEVIMVTSSLVKDINCNIE  103

Query  436  MYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            MY+ANAIRVLCRI D +LLT  ER LKQAIVDKNPVV+SAALVSG+HLL+T PEI+K+W+
Sbjct  104  MYKANAIRVLCRIIDESLLTHFERILKQAIVDKNPVVSSAALVSGLHLLKTYPEIIKKWN  163

Query  616  NEVQEAV  636
            +EVQ+ +
Sbjct  164  DEVQQGI  170



>ref|XP_003075049.1| CopG Coatomer gamma subunit (IC) [Ostreococcus tauri]
Length=867

 Score =   253 bits (645),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            SPF+GIEKG VLQEAR FN+PQLD R+C  VITKLLYL  QGE FTK E TE+FF+VTKL
Sbjct  17   SPFVGIEKGIVLQEARCFNDPQLDVRKCQQVITKLLYLNIQGELFTKNEITEIFFSVTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSK   LRRMVYLIIKE+ PS+DEVIIVTSSLMKDMNS+ D++RANAIRVLC I D   
Sbjct  77   FQSKSSNLRRMVYLIIKEICPSSDEVIIVTSSLMKDMNSKVDLFRANAIRVLCCIADAAT  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L QIERYLKQAIVD++  V+SAALVS  HL   + +IV+RWS+E+QEA+
Sbjct  137  LGQIERYLKQAIVDRSDAVSSAALVSATHLTHADVDIVRRWSSEIQEAI  185



>ref|XP_011397447.1| Coatomer subunit gamma [Auxenochlorella protothecoides]
 gb|KFM24559.1| Coatomer subunit gamma [Auxenochlorella protothecoides]
Length=651

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            YSPF GIEKGAVLQEARVFNE   D RRC  VITKLLYLL QGE+ TK EA++VFFAVTK
Sbjct  29   YSPFYGIEKGAVLQEARVFNEAHADPRRCQQVITKLLYLLTQGESLTKTEASDVFFAVTK  88

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            LFQ KD+ LRRMVYL+IKE+ P++DEVII+TSSLMKDMNS  ++YRANAIRVLCRI D T
Sbjct  89   LFQHKDVHLRRMVYLVIKEVIPASDEVIIITSSLMKDMNSSNELYRANAIRVLCRIIDPT  148

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            +L QIERYLKQA+VDK+ VVA+A L     L ++  +++KRW++E+ EA+
Sbjct  149  MLLQIERYLKQAVVDKSAVVATAVLAGATLLSRSGADVIKRWTSEIGEAM  198



>dbj|BAJ96771.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=856

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 146/188 (78%), Gaps = 34/188 (18%)
 Frame = +1

Query  76   MAQPLV-KKdddrddemdYSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQ  252
            M+QPLV KKDDD D+E  YSPF+GIEKGAVLQEARVF++PQLDARRC  VITKLLYLLNQ
Sbjct  1    MSQPLVVKKDDDLDEEEYYSPFLGIEKGAVLQEARVFHDPQLDARRCCQVITKLLYLLNQ  60

Query  253  GEAFTKVEATEVFFAVTKLFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRT  432
            G+ FTKVEATEV                                 IIVTSSLMKDMNS+T
Sbjct  61   GDTFTKVEATEV---------------------------------IIVTSSLMKDMNSKT  87

Query  433  DMYRANAIRVLCRITDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRW  612
            DMYRANAIRVLCRI D TLLTQIERYLKQAIVDKNPVVASAALVSGI+LLQT+PE+VKRW
Sbjct  88   DMYRANAIRVLCRIIDSTLLTQIERYLKQAIVDKNPVVASAALVSGIYLLQTSPEVVKRW  147

Query  613  SNEVQEAV  636
            SNEVQEAV
Sbjct  148  SNEVQEAV  155



>ref|XP_002600093.1| hypothetical protein BRAFLDRAFT_79649 [Branchiostoma floridae]
 gb|EEN56105.1| hypothetical protein BRAFLDRAFT_79649 [Branchiostoma floridae]
Length=239

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK +VLQEAR FNE  ++ R+C H++TK+LYL+NQGE     EATE FFA+TKL
Sbjct  18   NPFNNLEKTSVLQEARTFNETPINPRKCCHILTKVLYLINQGEHIATTEATETFFAMTKL  77

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRRMVYL IKE++  A++VIIVTSSL KDM  + DMYRA AIR LCRITD T+
Sbjct  78   FQSQDVTLRRMVYLTIKEMADIAEDVIIVTSSLTKDMTGKEDMYRAAAIRALCRITDSTM  137

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVD+NP V+SAAL S +HL++++ ++VKRW NE  EA
Sbjct  138  LQSIERYMKQAIVDRNPSVSSAALTSSLHLMRSSGDVVKRWVNEATEA  185



>ref|XP_004341555.1| coatomer subunit gamma, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19469.1| coatomer subunit gamma, putative [Acanthamoeba castellanii str. 
Neff]
Length=876

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 141/173 (82%), Gaps = 3/173 (2%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            Y PFMG++KG+VLQE R+FNE  ++ R+C H+ITK+LYLL QG+ FTK EAT++FFA T 
Sbjct  12   YDPFMGVDKGSVLQEKRIFNESPINPRKCCHLITKILYLLGQGQTFTKTEATDLFFATTM  71

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            LFQS D+ LRRMVYL++KEL P A++VIIV S L KDMNS+TD+YRANAIRVLC+I D  
Sbjct  72   LFQSTDVNLRRMVYLVLKELLPLAEDVIIVISCLTKDMNSKTDLYRANAIRVLCKINDVA  131

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNP---EIVKRWSNEVQEAV  636
            +L Q ERYLKQAIVD+   VASAALVSG+HL++ +P   +IVKRW +EVQ AV
Sbjct  132  MLGQAERYLKQAIVDREAYVASAALVSGMHLMKGSPAGVDIVKRWFSEVQSAV  184



>ref|XP_002111874.1| hypothetical protein TRIADDRAFT_55337 [Trichoplax adhaerens]
 gb|EDV25841.1| hypothetical protein TRIADDRAFT_55337 [Trichoplax adhaerens]
Length=846

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  IEK  V+QEAR FN+  ++ R+C  ++TKLLYL+NQGE    VEATE FFA+TKL
Sbjct  18   NPFKNIEKATVVQEARTFNDQHINTRKCCMILTKLLYLINQGEILATVEATETFFAMTKL  77

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD+ LRRMVYL IKE+S  A++VIIVTSSL KDMNS+ D++RA+A+R LC ITDG++
Sbjct  78   FQSKDVTLRRMVYLTIKEMSKLAEDVIIVTSSLTKDMNSKEDLFRASAVRALCMITDGSM  137

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERYLKQAIVD++  VASAALVS +HL + N EIVKRW NEVQ+A
Sbjct  138  LQGIERYLKQAIVDRDRSVASAALVSSLHLSRENFEIVKRWVNEVQQA  185



>ref|XP_973414.1| PREDICTED: coatomer subunit gamma [Tribolium castaneum]
 gb|EFA09678.1| hypothetical protein TcasGA2_TC011806 [Tribolium castaneum]
Length=879

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  IEK  VLQEARVFN+  ++ R+C H++TKLLYLLNQGE     EAT+ FFA+TKL
Sbjct  17   NPFQNIEKTTVLQEARVFNDTTVNPRKCTHILTKLLYLLNQGEQLGTKEATDAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRRMVYL IKELS  AD+VIIVTSSL KDM  + D+YRA AIR LC ITD T+
Sbjct  77   FQSRDVILRRMVYLGIKELSSIADDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDATM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD+N  V+SAALVS +HL +  PE+VKRW NE QEAV
Sbjct  137  LQTIERYMKQAIVDRNSAVSSAALVSSLHLTKLAPEVVKRWVNEAQEAV  185



>ref|XP_008903641.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETL42309.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN11159.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETP18810.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=910

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>ref|XP_009515671.1| hypothetical protein PHYSODRAFT_537097 [Phytophthora sojae]
 gb|EGZ28396.1| hypothetical protein PHYSODRAFT_537097 [Phytophthora sojae]
Length=910

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>gb|ETK88911.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL95483.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM48682.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETP46731.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=910

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>gb|ETO77781.1| hypothetical protein, variant [Phytophthora parasitica P1976]
Length=910

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>gb|ETI49043.1| hypothetical protein, variant [Phytophthora parasitica P1569]
Length=910

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>gb|ETI49042.1| hypothetical protein F443_07033 [Phytophthora parasitica P1569]
Length=931

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>gb|ETK88910.1| hypothetical protein L915_06935 [Phytophthora parasitica]
 gb|ETL95482.1| hypothetical protein L917_06750 [Phytophthora parasitica]
 gb|ETM48681.1| hypothetical protein L914_06842 [Phytophthora parasitica]
 gb|ETP46730.1| hypothetical protein F442_07097 [Phytophthora parasitica P10297]
Length=931

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>gb|ETO77780.1| hypothetical protein F444_07101 [Phytophthora parasitica P1976]
Length=931

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>ref|XP_008903640.1| hypothetical protein PPTG_10119 [Phytophthora parasitica INRA-310]
 gb|ETL42308.1| hypothetical protein L916_06883 [Phytophthora parasitica]
 gb|ETN11158.1| hypothetical protein PPTG_10119 [Phytophthora parasitica INRA-310]
 gb|ETP18809.1| hypothetical protein F441_07046 [Phytophthora parasitica CJ01A1]
Length=931

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NPEIV+RW NEVQEAV
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPEIVRRWVNEVQEAV  218



>ref|XP_005705551.1| coatomer protein complex, subunit gamma [Galdieria sulphuraria]
 gb|EME29031.1| coatomer protein complex, subunit gamma [Galdieria sulphuraria]
Length=927

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            SPF+GIEKGAVLQE R+FN+  L  R+C   + +LLYL+ QGE  +  EATEVFF++TKL
Sbjct  25   SPFLGIEKGAVLQECRIFNDLHLKLRKCVDALVRLLYLVGQGEKLSSSEATEVFFSITKL  84

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS +  LRR+VYL IKEL+ +ADEVIIVT+ LMKD+NSR DMYRANA RVLCRITD  +
Sbjct  85   FQSNEPTLRRLVYLSIKELAGAADEVIIVTNCLMKDVNSREDMYRANATRVLCRITDSQM  144

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNP-EIVKRWSNEVQEAV  636
            ++QIERYLKQ IVD+NPVVASAALVSG HLL  N  ++V+RW +E+ +A+
Sbjct  145  VSQIERYLKQEIVDRNPVVASAALVSGQHLLLHNKGDVVRRWISEITQAL  194



>gb|ELU14014.1| hypothetical protein CAPTEDRAFT_162815 [Capitella teleta]
Length=869

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK +VLQEAR FNE  ++ R+C H++TK+LYL+NQGE    +EATE FFA+TKL
Sbjct  15   NPFYNLEKSSVLQEARTFNETPINTRKCCHILTKILYLINQGEHIGTMEATETFFAMTKL  74

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKDL LRRMVYL IKE++  A++VIIVTS L KDM  R D +RA AIR LCRITD T+
Sbjct  75   FQSKDLTLRRMVYLCIKEMAYIAEDVIIVTSCLTKDMTGREDQFRAPAIRALCRITDTTM  134

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDK   V+SAAL S +HL +T+P++VKRW NE QEAV
Sbjct  135  LQSIERYMKQAIVDKVHSVSSAALTSSLHLAKTSPDVVKRWVNEAQEAV  183



>ref|XP_001893606.1| coatomer gamma subunit [Brugia malayi]
Length=879

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  ++K  VLQEARVFNE  ++ARRC+ +++KLLYL  QGEA  + EATE FFAVTKL
Sbjct  14   NPFSNLDKTTVLQEARVFNETPINARRCSLILSKLLYLRQQGEAIGRTEATEAFFAVTKL  73

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QSKD  LRR+VYL IKE    +++VIIVTSSL KDM  R D+YRA AIR LC I DG++
Sbjct  74   WQSKDSNLRRLVYLAIKEFCDISNDVIIVTSSLTKDMTGREDVYRAPAIRALCCIIDGSM  133

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD+N  VASAALVS  HLL+ NPE+V+RW+NEVQEAV
Sbjct  134  LQAIERYMKQAIVDRNSAVASAALVSSFHLLRKNPEVVRRWANEVQEAV  182



>emb|CDP97871.1| Protein Bm13807, isoform a, partial [Brugia malayi]
Length=892

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  ++K  VLQEARVFNE  ++ARRC+ +++KLLYL  QGEA  + EATE FFAVTKL
Sbjct  27   NPFSNLDKTTVLQEARVFNETPINARRCSLILSKLLYLRQQGEAIGRTEATEAFFAVTKL  86

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QSKD  LRR+VYL IKE    +++VIIVTSSL KDM  R D+YRA AIR LC I DG++
Sbjct  87   WQSKDSNLRRLVYLAIKEFCDISNDVIIVTSSLTKDMTGREDVYRAPAIRALCCIIDGSM  146

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD+N  VASAALVS  HLL+ NPE+V+RW+NEVQEAV
Sbjct  147  LQAIERYMKQAIVDRNSAVASAALVSSFHLLRKNPEVVRRWANEVQEAV  195



>gb|EYC22058.1| hypothetical protein Y032_0018g3689 [Ancylostoma ceylanicum]
Length=890

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  ++K +VLQEAR FNE  ++AR+C+ ++TKLLY++ QGE  ++ EATEVFFAVTKL
Sbjct  32   NPFANLDKTSVLQEARAFNETPINARKCSIILTKLLYIIQQGENISRTEATEVFFAVTKL  91

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QSKD  LRR+VYL +KELS  AD+VIIVTSSL KDM  R D+YRA AIR LCRITD  +
Sbjct  92   WQSKDANLRRLVYLAVKELSGLADDVIIVTSSLTKDMTGREDVYRAAAIRALCRITDTGM  151

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKN  V+SAALVS  HL++ + E+V+RW+NEVQEAV
Sbjct  152  LQTIERYMKQAIVDKNGAVSSAALVSSKHLMKKSAEVVRRWANEVQEAV  200



>gb|EYC22059.1| hypothetical protein Y032_0018g3689 [Ancylostoma ceylanicum]
Length=893

 Score =   228 bits (582),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  ++K +VLQEAR FNE  ++AR+C+ ++TKLLY++ QGE  ++ EATEVFFAVTKL
Sbjct  35   NPFANLDKTSVLQEARAFNETPINARKCSIILTKLLYIIQQGENISRTEATEVFFAVTKL  94

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QSKD  LRR+VYL +KELS  AD+VIIVTSSL KDM  R D+YRA AIR LCRITD  +
Sbjct  95   WQSKDANLRRLVYLAVKELSGLADDVIIVTSSLTKDMTGREDVYRAAAIRALCRITDTGM  154

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKN  V+SAALVS  HL++ + E+V+RW+NEVQEAV
Sbjct  155  LQTIERYMKQAIVDKNGAVSSAALVSSKHLMKKSAEVVRRWANEVQEAV  203



>gb|EYC22057.1| hypothetical protein Y032_0018g3689 [Ancylostoma ceylanicum]
Length=893

 Score =   228 bits (582),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  ++K +VLQEAR FNE  ++AR+C+ ++TKLLY++ QGE  ++ EATEVFFAVTKL
Sbjct  35   NPFANLDKTSVLQEARAFNETPINARKCSIILTKLLYIIQQGENISRTEATEVFFAVTKL  94

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QSKD  LRR+VYL +KELS  AD+VIIVTSSL KDM  R D+YRA AIR LCRITD  +
Sbjct  95   WQSKDANLRRLVYLAVKELSGLADDVIIVTSSLTKDMTGREDVYRAAAIRALCRITDTGM  154

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKN  V+SAALVS  HL++ + E+V+RW+NEVQEAV
Sbjct  155  LQTIERYMKQAIVDKNGAVSSAALVSSKHLMKKSAEVVRRWANEVQEAV  203



>ref|XP_009870725.1| PREDICTED: coatomer subunit gamma-2-like, partial [Apaloderma 
vittatum]
Length=180

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  4    NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  63

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  64   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  123

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  124  LQAIERYMKQAIVDKVPSVSSSALVSSLHMMKISYDVVKRWINEAQEA  171



>ref|XP_002906610.1| coatomer subunit gamma, putative [Phytophthora infestans T30-4]
 gb|EEY66011.1| coatomer subunit gamma, putative [Phytophthora infestans T30-4]
Length=910

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 136/173 (79%), Gaps = 5/173 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDAR---RCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++     R   +C  +ITKLL++L QGE FT  E T VFF V
Sbjct  45   SPFQGLDKATVLQETKIFSDANTVTRHPKKCCQLITKLLHILTQGEPFTSAETTAVFFGV  104

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANAIRVLCRI
Sbjct  105  TKLFQSKDANLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSDVDLYRANAIRVLCRI  164

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
             DG++L  IERY+KQAIVD+N +VAS+ALVSGIHL++ NP+IV+RW NEVQEA
Sbjct  165  IDGSMLNAIERYIKQAIVDRNALVASSALVSGIHLIKNNPDIVRRWVNEVQEA  217



>dbj|GAM19255.1| hypothetical protein SAMD00019534_024300 [Acytostelium subglobosum 
LB1]
Length=883

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = +1

Query  133  PFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLF  312
            PF  ++KG V+QE R FN+ QL  R+CA VI+K LYLL++G+ FTK EAT++FFA TKLF
Sbjct  15   PFENLDKGQVVQEKRAFNDTQLQPRQCALVISKFLYLLSRGDTFTKTEATDIFFAATKLF  74

Query  313  QSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLL  492
            QSKD+ LRRM YL++KE S  + + IIVTSSL+KDM+ + ++YRANAIRVLC+I D + L
Sbjct  75   QSKDIPLRRMTYLLLKEFSTISQDAIIVTSSLIKDMSHKIELYRANAIRVLCKIIDASSL  134

Query  493  TQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             Q+ER+ KQ+IV+K+P V+SAALVS IHLL+ +PE VKRW+NEVQEA+
Sbjct  135  PQVERHFKQSIVEKDPHVSSAALVSSIHLLKVSPETVKRWANEVQEAI  182



>gb|KHN77336.1| putative coatomer subunit gamma [Toxocara canis]
Length=937

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P+  ++K AVLQEAR FN+  ++AR+C+ +++KLLYL  QGE   + EATE FFAVTKL
Sbjct  28   NPYANLDKTAVLQEARAFNDTPINARKCSLILSKLLYLRQQGETIGRTEATEAFFAVTKL  87

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QSKD  LRR+VYL IKEL   +++VIIVTSSL KDM  R DMYRA AIR LC I D ++
Sbjct  88   WQSKDANLRRLVYLAIKELCDISNDVIIVTSSLTKDMTGREDMYRAPAIRALCCIIDASM  147

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKNP VASAALVS +HLL+ +PE+V+RW+NEVQEAV
Sbjct  148  LQAIERYMKQAIVDKNPAVASAALVSSLHLLKKSPEVVRRWANEVQEAV  196



>ref|XP_320089.2| AGAP009291-PA [Anopheles gambiae str. PEST]
 sp|Q7PVF6.2|COPG_ANOGA RecName: Full=Coatomer subunit gamma; AltName: Full=Gamma-coat 
protein; Short=Gamma-COP [Anopheles gambiae]
 gb|EAA14827.2| AGAP009291-PA [Anopheles gambiae str. PEST]
Length=868

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P+  +EK +VLQE R+FNE  ++AR+C H++TK+LYLLNQGE     EATE FFA+TKL
Sbjct  17   NPWQNLEKTSVLQETRMFNETPVNARKCTHILTKILYLLNQGEVLGTREATECFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD+ +RRMVYL IKELSP AD+VIIVTSSL KDM  + D+YRA AIR LC ITD T+
Sbjct  77   FQSKDVVMRRMVYLGIKELSPIADDVIIVTSSLTKDMTGKEDLYRAPAIRALCSITDSTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  +ERY+KQ IVD+N  V+S ALVS +HL  T  E+VKRW+NE QEA+
Sbjct  137  LQAVERYMKQCIVDRNAPVSSGALVSSLHLASTAGEVVKRWANEAQEAL  185



>ref|XP_003142745.1| coatomer gamma subunit [Loa loa]
 gb|EFO21327.1| coatomer gamma subunit [Loa loa]
Length=880

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  ++K AVLQEAR FNE  ++ARRC+ +++KLLYL  QGE   + EATE FFA+TKL
Sbjct  14   NPFSNLDKTAVLQEARAFNETPINARRCSLILSKLLYLRQQGETIGRTEATEAFFAITKL  73

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QSKD  LRR+VYL IKE    +++VIIVTSSL KDM  R D+YRA AIR LC I DG++
Sbjct  74   WQSKDSNLRRLVYLAIKEFCDISNDVIIVTSSLTKDMTGREDIYRAPAIRALCCIIDGSM  133

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD+N  VASAALVS  HLL+ NPE+V+RW+NEVQEAV
Sbjct  134  LQAIERYMKQAIVDRNSAVASAALVSSFHLLRKNPEVVRRWANEVQEAV  182



>ref|XP_002426927.1| Coatomer subunit gamma-2, putative [Pediculus humanus corporis]
 gb|EEB14189.1| Coatomer subunit gamma-2, putative [Pediculus humanus corporis]
Length=881

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ R+C H +TK+LYLLNQGE     EATE FFA+TKL
Sbjct  16   NPFANVEKTAVLQEARMFNETPINPRKCTHTLTKILYLLNQGEQLGVTEATEAFFAMTKL  75

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD+ LRRMVYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD T+
Sbjct  76   FQSKDVILRRMVYLGIKELSGIAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDVTM  135

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKN  V+SAALVS +HL +   +++KRW NEVQEA+
Sbjct  136  LQAIERYMKQAIVDKNTAVSSAALVSSLHLTKVAGDVIKRWVNEVQEAL  184



>gb|EMC89476.1| Coatomer subunit gamma-2 [Columba livia]
Length=246

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  17   NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  77   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  137  LQAIERYMKQAIVDKVPSVSSSALVSSLHMMKISYDVVKRWINEAQEA  184



>ref|XP_003284402.1| hypothetical protein DICPUDRAFT_45443 [Dictyostelium purpureum]
 gb|EGC39052.1| hypothetical protein DICPUDRAFT_45443 [Dictyostelium purpureum]
Length=889

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            F  ++KG V+QE R FNE  +  R+C+ VI++ LYLL++G+ FTK EAT++FFA TKLFQ
Sbjct  16   FENLDKGQVVQEKRAFNESPIHPRKCSLVISQFLYLLSRGDTFTKKEATDIFFAATKLFQ  75

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            SKD+ LRR++YL++KELS  +D+ IIV SSL KDM  + ++YRANAIR+LC+ITD ++L 
Sbjct  76   SKDIPLRRLMYLLLKELSSISDDAIIVISSLTKDMTHKIELYRANAIRILCKITDSSILP  135

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            QIERY KQ+IV+K+P V+SAALVS IHLL+ +PEIVKRW NEVQEA+
Sbjct  136  QIERYFKQSIVEKDPHVSSAALVSSIHLLKVSPEIVKRWGNEVQEAI  182



>gb|KFO90143.1| Coatomer subunit gamma-2, partial [Buceros rhinoceros silvestris]
Length=235

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  6    NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  65

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  66   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  125

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  126  LQAIERYMKQAIVDKVPSVSSSALVSSLHMMKISYDVVKRWINEAQEA  173



>ref|XP_001863075.1| coatomer subunit gamma [Culex quinquefasciatus]
 gb|EDS37978.1| coatomer subunit gamma [Culex quinquefasciatus]
Length=841

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF+ +EK +VLQE R+FNE  ++AR+C H++TK+LYL+NQGE     EATE FFA+TKL
Sbjct  17   NPFLNLEKTSVLQETRMFNETPVNARKCTHILTKILYLINQGEQLGSREATECFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD+ +RRMVYL IKELSP A++VIIVTSSL KDM  + D+YRA AIR LC ITD T+
Sbjct  77   FQSKDVIMRRMVYLGIKELSPIAEDVIIVTSSLTKDMTGKEDLYRAPAIRALCSITDNTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  +ERY+KQ IVD+N  V+S ALVS +HL  T  ++VKRW+NE QEA+
Sbjct  137  LQAVERYMKQCIVDRNAPVSSGALVSSLHLANTAGDVVKRWANEAQEAL  185



>gb|ETN67504.1| coatomer subunit gamma [Anopheles darlingi]
Length=881

 Score =   226 bits (575),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P   +EK AVLQE R+FNE  ++AR+C H++TK+LYL+NQGE     EATE FFA+TKL
Sbjct  17   NPMANLEKTAVLQETRMFNETPVNARKCTHILTKILYLINQGEVLGTREATECFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD+ +RRMVYL IKELSP AD+VIIVTSSL KDM  + ++YRA AIR LC ITD T+
Sbjct  77   FQSKDMVMRRMVYLGIKELSPIADDVIIVTSSLTKDMTGKENLYRAPAIRALCSITDSTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  +ERY+KQ IVD+N  V+S ALVS +HL  T  E+VKRW+NE QEA+
Sbjct  137  LQAVERYMKQCIVDRNAPVSSGALVSSLHLASTAGEVVKRWANEAQEAL  185



>dbj|BAK03541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=885

 Score =   225 bits (574),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P+  +EK +VLQEAR FNE  ++AR+C  ++TK++Y++NQGE   + EATE FFA+TKL
Sbjct  20   NPYKNLEKASVLQEARTFNETPVNARKCIQILTKIIYMINQGEQLGQTEATETFFAMTKL  79

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD+ LRRM+YL IKE+S  A++VIIVTSSL +DM  + D +R  AIR LC+ITD ++
Sbjct  80   FQSKDMMLRRMIYLSIKEMSTVANDVIIVTSSLTRDMTGKEDSHRGPAIRALCKITDASM  139

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            +  +ERY+KQAIVDK P VASAALVS +HL++  PE+VKRW NEVQEAV
Sbjct  140  MQSVERYMKQAIVDKLPSVASAALVSSVHLMRHGPEVVKRWVNEVQEAV  188



>ref|XP_005767681.1| COPG1, gamma subunit of the coatomer, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD15252.1| COPG1, gamma subunit of the coatomer, partial [Emiliania huxleyi 
CCMP1516]
Length=443

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 134/173 (77%), Gaps = 3/173 (2%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            YSPF  ++K AVLQE R FN+ +++ R+C  ++TK+L+LL QGE  T +E TE+FF VTK
Sbjct  41   YSPFQSLQKAAVLQECRCFNDREINPRKCISILTKILWLLAQGEKLTALETTEIFFGVTK  100

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI---T  477
            L   KD  LRR++YL++KEL PS +EVIIV ++L KDMNS+ D+ RANA+RVL  I   T
Sbjct  101  LLMHKDQQLRRLLYLVLKELKPSPEEVIIVCATLTKDMNSKVDLNRANALRVLGAIIART  160

Query  478  DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            D T+L QIER+LKQA+VDKN  VA++ALVSGIHL+  NPE+V+RW NEVQ A+
Sbjct  161  DPTMLAQIERHLKQALVDKNCFVAASALVSGIHLMHVNPEVVRRWVNEVQTAL  213



>ref|XP_011171736.1| PREDICTED: coatomer subunit gamma [Solenopsis invicta]
Length=874

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN   ++ R+CAH++TK+LYLLNQGE     EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNNTPVNPRKCAHILTKILYLLNQGEQLGTTEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG++
Sbjct  77   FQSRDVILRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGSM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++P V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSPAVSSAALVSSLHLTSVSSDVARRWANEAQEAL  185



>ref|XP_011257977.1| PREDICTED: coatomer subunit gamma [Camponotus floridanus]
 gb|EFN67167.1| Coatomer subunit gamma-2 [Camponotus floridanus]
Length=874

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN   ++ R+CAH++TK+LYLLNQGE    +EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNNTPVNPRKCAHILTKILYLLNQGEQLGTMEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG++
Sbjct  77   FQSRDVILRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGSM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++P V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSPAVSSAALVSSLHLTSVSGDVARRWANEAQEAL  185



>gb|EFZ10235.1| hypothetical protein SINV_06617 [Solenopsis invicta]
Length=889

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN   ++ R+CAH++TK+LYLLNQGE     EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNNTPVNPRKCAHILTKILYLLNQGEQLGTTEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG++
Sbjct  77   FQSRDVILRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGSM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++P V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSPAVSSAALVSSLHLTSVSSDVARRWANEAQEAL  185



>ref|XP_636291.1| adaptin N-terminal domain-containing protein [Dictyostelium discoideum 
AX4]
 sp|Q54HL0.1|COPG_DICDI RecName: Full=Coatomer subunit gamma; AltName: Full=Gamma-coat 
protein; Short=Gamma-COP [Dictyostelium discoideum]
 gb|EAL62772.1| adaptin N-terminal domain-containing protein [Dictyostelium discoideum 
AX4]
Length=898

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            F  ++KG V+QE R FNE  +  R+C+ VI++ LYLL++G++FTK EAT++FFA TKLFQ
Sbjct  17   FENLDKGQVIQEKRAFNESPIHPRKCSLVISQFLYLLSRGDSFTKTEATDIFFAATKLFQ  76

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            SKD+ LRR++YL++KELS  + + IIV SSL KDM+ + ++YRANAIR+LC+ITD ++L 
Sbjct  77   SKDIPLRRLMYLLLKELSTISQDAIIVISSLTKDMSHKIELYRANAIRILCKITDSSILP  136

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            QIERY KQ+IV+K+P V+SAALVS IHLL+  PEIVKRW+NEVQEA+
Sbjct  137  QIERYFKQSIVEKDPHVSSAALVSSIHLLKVCPEIVKRWANEVQEAI  183



>ref|XP_002187860.1| PREDICTED: coatomer subunit gamma-2 isoform 1 [Taeniopygia guttata]
Length=871

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  17   NPFQHLEKSAVLQEARLFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  77   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS  H+++ + ++VKRW NE QEA
Sbjct  137  LQAIERYMKQAIVDKVPGVSSSALVSSFHMMKISYDVVKRWINEAQEA  184



>ref|XP_002413239.1| coatomer gamma subunit, putative [Ixodes scapularis]
 gb|EEC16547.1| coatomer gamma subunit, putative, partial [Ixodes scapularis]
Length=874

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK +VLQEAR FNE  +  R+CA ++TK+LYLLNQGEA    EATE FFA+TKL
Sbjct  10   NPFHNLEKTSVLQEARTFNETPVHPRKCAEILTKILYLLNQGEALGTTEATEAFFAMTKL  69

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQ +D  LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC+ITD ++
Sbjct  70   FQCRDTVLRRLVYLGIKELSKVAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCKITDSSM  129

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKN  V+SAAL S +HL+  +P++VKRW NE QEAV
Sbjct  130  LQAIERYMKQAIVDKNCGVSSAALASSLHLMSVSPDVVKRWVNEAQEAV  178



>gb|ERG81812.1| putative coatomer subunit gamma [Ascaris suum]
Length=915

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P+  ++K AVLQEAR FN+  ++AR+C+ +++KLLYL  QGE   + EATE FFAVTKL
Sbjct  24   NPYANLDKTAVLQEARAFNDTPINARKCSLILSKLLYLRQQGETIGRTEATEAFFAVTKL  83

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QSKD  LRR+VYL IKEL   +++VIIVTSSL KDM  R D+YR  AIR LC I D ++
Sbjct  84   WQSKDANLRRLVYLAIKELCDISNDVIIVTSSLTKDMTGREDIYRGPAIRALCCIIDASM  143

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKNP VASAALVS +HLL+ +PE+V+RW+NEVQEAV
Sbjct  144  LQAIERYMKQAIVDKNPAVASAALVSSLHLLKKSPEVVRRWANEVQEAV  192



>ref|XP_005838910.1| coatomer subunit gammma [Guillardia theta CCMP2712]
 gb|EKX51930.1| coatomer subunit gammma [Guillardia theta CCMP2712]
Length=866

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +1

Query  133  PFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATE-VFFAVTKL  309
            PF G++K  V+QEAR+FN+P ++  RC  ++TKLLYLL +GE F+  E+TE +FF +TKL
Sbjct  19   PFRGVDKAHVIQEARMFNDPNVEPARCIQLMTKLLYLLGKGENFSSKESTESIFFPMTKL  78

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD  LRRM+YL+IKEL P +D VIIVTS+L KDMN+  D++RANAIRVLC ITD  +
Sbjct  79   FQSKDEKLRRMMYLVIKELKPDSDCVIIVTSTLTKDMNATNDLFRANAIRVLCTITDTAM  138

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWS  615
            LT IERYLKQAIVDK P+VASAALV+G+ L+++NP++VKRW+
Sbjct  139  LTAIERYLKQAIVDKQPLVASAALVAGMKLMKSNPDVVKRWA  180



>ref|XP_011349357.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Cerapachys biroi]
 gb|EZA47630.1| Coatomer subunit gamma [Cerapachys biroi]
Length=873

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN   ++ R+CAH++TK+LYLLNQGE     EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNNTPVNPRKCAHILTKILYLLNQGEQLGTTEATETFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG++
Sbjct  77   FQSRDVILRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGSM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++P V+SAALVS +HL     ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSPAVSSAALVSSLHLTSVCSDVARRWANEAQEAL  185



>ref|XP_008619222.1| hypothetical protein SDRG_14843 [Saprolegnia diclina VS20]
 gb|EQC27318.1| hypothetical protein SDRG_14843 [Saprolegnia diclina VS20]
Length=892

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF  ++K  VL E ++F++  +     R+C  +ITKLL++L QGE FT  E+T+VFF V
Sbjct  35   SPFQNLDKATVLHETKIFSDAAMVMKQPRKCCQLITKLLHILTQGEPFTSTESTDVFFKV  94

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQ KD  LRRM+YL IKE++   +ADEVIIVT SL KDMN  TD+YRANAIRVLCRI
Sbjct  95   TKLFQGKDANLRRMMYLFIKEVADATAADEVIIVTQSLTKDMNCDTDLYRANAIRVLCRI  154

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             D ++L  IERY+KQAIVDKNP+V+S+ALVSG+HL++ +P++V+RW NEVQEA+
Sbjct  155  IDTSMLAAIERYIKQAIVDKNPLVSSSALVSGMHLMRNSPDVVRRWVNEVQEAL  208



>ref|XP_011349356.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Cerapachys biroi]
Length=879

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN   ++ R+CAH++TK+LYLLNQGE     EATE FFA+TKL
Sbjct  23   NPFQNLEKTTVLQEARTFNNTPVNPRKCAHILTKILYLLNQGEQLGTTEATETFFAMTKL  82

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG++
Sbjct  83   FQSRDVILRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGSM  142

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++P V+SAALVS +HL     ++ +RW+NE QEA+
Sbjct  143  LAAIERYMKQAIVDRSPAVSSAALVSSLHLTSVCSDVARRWANEAQEAL  191



>gb|KDO33518.1| hypothetical protein SPRG_01590 [Saprolegnia parasitica CBS 223.65]
Length=888

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF  ++K  VL E ++F++  +     R+C  +ITKLL++L QGE FT  E+T+VFF V
Sbjct  35   SPFQNLDKATVLHETKIFSDAAMVMKQPRKCCQLITKLLHILTQGEPFTSTESTDVFFKV  94

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQ KD  LRRM+YL IKE++   +ADEVIIVT SL KDMN  TD+YRANAIRVLCRI
Sbjct  95   TKLFQGKDANLRRMMYLFIKEVADATAADEVIIVTQSLTKDMNCDTDLYRANAIRVLCRI  154

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             D ++L  IERY+KQAIVDKNP+V+S+ALVSG+HL++ +P++V+RW NEVQEA+
Sbjct  155  IDTSMLAAIERYIKQAIVDKNPLVSSSALVSGMHLMRNSPDVVRRWVNEVQEAL  208



>ref|XP_004046286.1| PREDICTED: coatomer subunit gamma-2-like, partial [Gorilla gorilla 
gorilla]
Length=246

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  17   NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  77   FQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK   V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  137  LQAIERYMKQAIVDKVSSVSSSALVSSLHMMKISYDVVKRWINEAQEA  184



>dbj|BAE28895.1| unnamed protein product [Mus musculus]
Length=250

 Score =   210 bits (534),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F  +EATE FFA+T+L
Sbjct  17   NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTMEATEAFFAMTRL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  77   FQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  +ERY+KQAIVDK   VAS+ALVS +H+++ + ++VKRW NE QEA
Sbjct  137  LQAVERYMKQAIVDKVSSVASSALVSSLHMMKISYDVVKRWINEAQEA  184



>ref|XP_011439759.1| PREDICTED: coatomer subunit gamma-2-like [Crassostrea gigas]
Length=876

 Score =   223 bits (567),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK +VLQEAR FNE  ++AR+C+H++TK+LYL+NQGE     EATE FFA+TKL
Sbjct  17   NPFHNLEKTSVLQEARTFNETPINARKCSHILTKVLYLINQGEQIGSTEATETFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQ+KD  LRR++YL IKE+S  A +VIIVTSSLMKDM  + D +R  AIR LC ITD T+
Sbjct  77   FQAKDPILRRLMYLGIKEMSKIAQDVIIVTSSLMKDMTGKDDQFRGPAIRALCSITDNTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKN  V+SAALVS +HL + + E+VKRW NE QEAV
Sbjct  137  LQSIERYMKQAIVDKNHAVSSAALVSSLHLSKGSSEVVKRWVNEAQEAV  185



>gb|EKC27123.1| Coatomer subunit gamma-2 [Crassostrea gigas]
Length=873

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK +VLQEAR FNE  ++AR+C+H++TK+LYL+NQGE     EATE FFA+TKL
Sbjct  14   NPFHNLEKTSVLQEARTFNETPINARKCSHILTKVLYLINQGEQIGSTEATETFFAMTKL  73

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQ+KD  LRR++YL IKE+S  A +VIIVTSSLMKDM  + D +R  AIR LC ITD T+
Sbjct  74   FQAKDPILRRLMYLGIKEMSKIAQDVIIVTSSLMKDMTGKDDQFRGPAIRALCSITDNTM  133

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKN  V+SAALVS +HL + + E+VKRW NE QEAV
Sbjct  134  LQSIERYMKQAIVDKNHAVSSAALVSSLHLSKGSSEVVKRWVNEAQEAV  182



>ref|XP_003399738.1| PREDICTED: coatomer subunit gamma-like [Bombus terrestris]
Length=875

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE    +EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTMEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD  +
Sbjct  77   FQSRDVVLRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDSGM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++P V+SAALVS +HL + + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSPAVSSAALVSSLHLTKVSGDVARRWANEAQEAL  185



>ref|XP_005714029.1| Coatomer subunit gamma [Chondrus crispus]
 emb|CDF34210.1| Coatomer subunit gamma [Chondrus crispus]
Length=914

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            SPF GIEKGAVLQE R+FN+ QL+ RRC  V+ +LLYL+ QG+  +  EAT VFF+VTKL
Sbjct  19   SPFDGIEKGAVLQECRIFNDLQLNTRRCEQVLIRLLYLVGQGDHLSSEEATNVFFSVTKL  78

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQ+ +  LRR+VYL IKEL+ +A+EVIIVT+ L KD+NS  DMYRANA RVLC+ITD  +
Sbjct  79   FQANEPSLRRLVYLAIKELAHTAEEVIIVTNCLTKDINSDVDMYRANATRVLCKITDAQM  138

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNP-EIVKRWSNEVQEAV  636
            + QIERYLKQ IVD+NPVVASAALVSG  L+  N  ++V+RW NEV +A+
Sbjct  139  VQQIERYLKQEIVDRNPVVASAALVSGQQLIMHNKGDVVRRWVNEVTQAL  188



>emb|CCI47579.1| unnamed protein product [Albugo candida]
Length=926

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++        ++C  +I KLL++L QGE FT  E T+VFF V
Sbjct  48   SPFQGLDKATVLQETKIFSDATTVTKHPKKCCQLIIKLLHILTQGEPFTSKETTDVFFGV  107

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANA+RVLCRI
Sbjct  108  TKLFQSKDAHLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSEVDLYRANALRVLCRI  167

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSG+HL+Q N E+V+RW NEV+EAV
Sbjct  168  IDGSMLNAIERYIKQAIVDRNAIVASSALVSGLHLIQDNSEVVRRWVNEVKEAV  221



>gb|KDR23235.1| Coatomer subunit gamma-2 [Zootermopsis nevadensis]
Length=892

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  IEK  VLQE R+FN+  +D+R+C H++TK+LYLLNQGE     EATE FFA+TKL
Sbjct  17   NPFQNIEKTTVLQETRIFNDCPVDSRKCTHILTKILYLLNQGEQLGTTEATETFFAITKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRRM+YL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD ++
Sbjct  77   FQSQDVILRRMMYLGIKELSTIAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDVSM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD+N  V+SAALVS +HL +   ++VKRW NE QEAV
Sbjct  137  LQAIERYMKQAIVDRNSGVSSAALVSSLHLTKIAGDVVKRWVNEAQEAV  185



>emb|CCI47577.1| unnamed protein product [Albugo candida]
Length=927

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++        ++C  +I KLL++L QGE FT  E T+VFF V
Sbjct  49   SPFQGLDKATVLQETKIFSDATTVTKHPKKCCQLIIKLLHILTQGEPFTSKETTDVFFGV  108

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANA+RVLCRI
Sbjct  109  TKLFQSKDAHLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSEVDLYRANALRVLCRI  168

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSG+HL+Q N E+V+RW NEV+EAV
Sbjct  169  IDGSMLNAIERYIKQAIVDRNAIVASSALVSGLHLIQDNSEVVRRWVNEVKEAV  222



>ref|NP_001036846.1| nonclathrin coat protein gamma1-COP [Bombyx mori]
 dbj|BAA93047.2| nonclathrin coat protein gamma1-COP [Bombyx mori]
Length=861

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            F  ++K  +LQEAR FN   +  R+C H++TK+LYLLNQGE  T  EAT++FFA TKLFQ
Sbjct  15   FQNLDKTTLLQEARYFNSTPVHPRKCIHILTKILYLLNQGEELTTQEATDIFFATTKLFQ  74

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            SKD+ LRR+VYL IKELSP A +VIIVTSSL KDM  + D YR  AIR LC ITD T+L 
Sbjct  75   SKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKDDEYRPAAIRALCSITDSTMLQ  134

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             IERY+KQAIVDKNP V SAALVS +HL  T P++V+RW NE QEA+
Sbjct  135  AIERYMKQAIVDKNPAVGSAALVSALHLSATVPDLVRRWINEAQEAM  181



>ref|XP_011050148.1| PREDICTED: coatomer subunit gamma [Acromyrmex echinatior]
 gb|EGI68058.1| Coatomer subunit gamma-2 [Acromyrmex echinatior]
Length=874

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN   ++ R+CAH++TK+LYLLNQGE     EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNNTPVNPRKCAHILTKILYLLNQGEQLGTTEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD ++
Sbjct  77   FQSRDVILRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDSSM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAI+D++P V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIIDRSPAVSSAALVSSLHLTSVSSDVARRWANEAQEAL  185



>emb|CCI47580.1| unnamed protein product [Albugo candida]
Length=933

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++        ++C  +I KLL++L QGE FT  E T+VFF V
Sbjct  48   SPFQGLDKATVLQETKIFSDATTVTKHPKKCCQLIIKLLHILTQGEPFTSKETTDVFFGV  107

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANA+RVLCRI
Sbjct  108  TKLFQSKDAHLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSEVDLYRANALRVLCRI  167

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSG+HL+Q N E+V+RW NEV+EAV
Sbjct  168  IDGSMLNAIERYIKQAIVDRNAIVASSALVSGLHLIQDNSEVVRRWVNEVKEAV  221



>ref|XP_011149849.1| PREDICTED: coatomer subunit gamma [Harpegnathos saltator]
 ref|XP_011149850.1| PREDICTED: coatomer subunit gamma [Harpegnathos saltator]
 gb|EFN77599.1| Coatomer subunit gamma-2 [Harpegnathos saltator]
Length=874

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN   ++ R+CAH++TK+LYLLNQGE     EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNNTPVNPRKCAHILTKILYLLNQGEQLGTTEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD ++
Sbjct  77   FQSRDVILRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDSSM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++P V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSPAVSSAALVSSLHLTSVSGDVARRWANEAQEAL  185



>emb|CCI47578.1| unnamed protein product [Albugo candida]
Length=934

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++        ++C  +I KLL++L QGE FT  E T+VFF V
Sbjct  49   SPFQGLDKATVLQETKIFSDATTVTKHPKKCCQLIIKLLHILTQGEPFTSKETTDVFFGV  108

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANA+RVLCRI
Sbjct  109  TKLFQSKDAHLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSEVDLYRANALRVLCRI  168

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSG+HL+Q N E+V+RW NEV+EAV
Sbjct  169  IDGSMLNAIERYIKQAIVDRNAIVASSALVSGLHLIQDNSEVVRRWVNEVKEAV  222



>emb|CCA20227.1| hypothetical protein ARALYDRAFT_900277 [Albugo laibachii Nc14]
Length=916

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 136/174 (78%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF G++K  VLQE ++F++        ++C  +I KLL++L QGE FT  E T+VFF V
Sbjct  49   SPFQGLDKATVLQETKIFSDATTVTKHPKKCCQLIIKLLHILTQGEPFTSKETTDVFFGV  108

Query  301  TKLFQSKDLGLRRMVYLIIKELS--PSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQSKD  LRRM+YL IKE++   +ADEVIIVT SL KDM+S  D+YRANA+RVLCRI
Sbjct  109  TKLFQSKDAHLRRMMYLFIKEVAEATAADEVIIVTQSLTKDMSSEVDLYRANALRVLCRI  168

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             DG++L  IERY+KQAIVD+N +VAS+ALVSG+HL+Q N E+++RW NEV+EAV
Sbjct  169  IDGSMLNAIERYIKQAIVDRNAIVASSALVSGLHLIQNNSEVIRRWVNEVKEAV  222



>gb|EHJ75334.1| nonclathrin coat protein gamma2-COP [Danaus plexippus]
Length=863

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            F  ++K  VLQE+R FNE  ++ R+C  ++TK+L+LLNQGE F+  EATE FFA+TKLFQ
Sbjct  19   FQNLDKTIVLQESRYFNETPVNPRKCTQILTKILFLLNQGETFSTQEATEAFFAITKLFQ  78

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            S D+ LRRMVYL IKELS  A +VIIVTSSL KDM  + D+YRA AIR LC +TD T++ 
Sbjct  79   SNDVILRRMVYLCIKELSKLAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSVTDSTMIQ  138

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             IERY+KQAIVD+NP V+SAALVS +HL  T+P++VKRW++E QEA+
Sbjct  139  AIERYMKQAIVDRNPAVSSAALVSSLHLSSTSPDLVKRWTSEAQEAL  185



>ref|XP_003700498.1| PREDICTED: coatomer subunit gamma-like [Megachile rotundata]
Length=875

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            F  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE    +EAT+VFFA+TKLFQ
Sbjct  19   FQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTMEATDVFFAMTKLFQ  78

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            S+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG +L 
Sbjct  79   SRDVVLRRLVYLGIKELSSVAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGGMLA  138

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             IERY+KQAIVD++P V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  139  AIERYMKQAIVDRSPAVSSAALVSSLHLTNVSGDVARRWANEAQEAL  185



>ref|XP_003493763.1| PREDICTED: coatomer subunit gamma-like [Bombus impatiens]
Length=875

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE    +EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTMEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD  +
Sbjct  77   FQSRDVVLRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDSGM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            +  IERY+KQAIVD++P V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  IAAIERYMKQAIVDRSPAVSSAALVSSLHLTNVSGDVARRWANEAQEAL  185



>gb|EFA81100.1| adaptin N-terminal domain-containing protein [Polysphondylium 
pallidum PN500]
Length=887

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +1

Query  133  PFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLF  312
            PF  ++KG V+QE RVFN+ Q+  R+C+ VI++ LYLL +G+ FTK EAT+VFFA TKLF
Sbjct  15   PFEHLDKGQVVQEKRVFNDTQIHPRKCSFVISEFLYLLARGDTFTKTEATDVFFAATKLF  74

Query  313  QSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLL  492
            QSKD+ LRRM YL++KE S  + + IIVTSSL+KDM+ + ++YRAN+IR+LC+I D + L
Sbjct  75   QSKDIPLRRMTYLLLKEFSTISQDAIIVTSSLIKDMSHKIELYRANSIRILCKIIDASSL  134

Query  493  TQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             Q+ER+ KQ+IV+K+P V+SAALVS IHLL+  P+ VKRW+NEVQEA+
Sbjct  135  PQLERHFKQSIVEKDPHVSSAALVSSIHLLRVAPDTVKRWANEVQEAI  182



>ref|XP_006611321.1| PREDICTED: coatomer subunit gamma-like isoform X2 [Apis dorsata]
Length=876

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE    +EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTMEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG +
Sbjct  77   FQSRDVVLRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGGM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++  V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSAAVSSAALVSTLHLTNVSGDVARRWANEAQEAL  185



>ref|XP_003691218.1| PREDICTED: coatomer subunit gamma-like [Apis florea]
Length=876

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE    +EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTMEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG +
Sbjct  77   FQSRDVVLRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGGM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++  V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSAAVSSAALVSTLHLTNVSGDVARRWANEAQEAL  185



>ref|XP_006559437.1| PREDICTED: coatomer subunit gamma isoform X2 [Apis mellifera]
Length=876

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE    +EATE FFA+TKL
Sbjct  17   NPFQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTMEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG +
Sbjct  77   FQSRDVVLRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGGM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++  V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDRSAAVSSAALVSTLHLTNVSGDVARRWANEAQEAL  185



>ref|XP_784737.3| PREDICTED: coatomer subunit gamma-2-like [Strongylocentrotus 
purpuratus]
Length=872

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P+  +++  VLQEARVFN   ++ R+C H++TK++Y++NQGE+    EATE FFA+TKL
Sbjct  16   NPYQNLDRSVVLQEARVFNATPINPRKCCHILTKIMYIINQGESIGTTEATETFFAMTKL  75

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D+ LRRMVYL+IKE++  A++VIIVTSSL KDM  + D+YRA AIR LC+ITD ++
Sbjct  76   FQSNDVMLRRMVYLMIKEMANLAEDVIIVTSSLTKDMTGKEDLYRAAAIRSLCKITDSSM  135

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK   V+SAAL S +HLL+ +PE+VKRW NEVQEA
Sbjct  136  LQGIERYMKQAIVDKVSGVSSAALCSSLHLLKQSPEVVKRWVNEVQEA  183



>ref|XP_001632631.1| predicted protein [Nematostella vectensis]
 gb|EDO40568.1| predicted protein [Nematostella vectensis]
Length=881

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  ++KG VLQEARVFNE  ++ R+C H++TK+LYL+NQG      E TE FFA+TKL
Sbjct  17   NPFQNLDKGQVLQEARVFNETPINVRKCIHILTKILYLINQGTHIGTSEGTETFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKDL LRRMVYL IKEL+  A++VIIVTSSL KDM  + DM+RA+AIR LCRITD T+
Sbjct  77   FQSKDLMLRRMVYLAIKELANIAEDVIIVTSSLTKDMTGKEDMFRASAIRALCRITDNTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERYLKQA+VDKNP V+SAALVS +HLL+ N ++VKRW NE QEAV
Sbjct  137  LQGIERYLKQAVVDKNPSVSSAALVSSLHLLKPNFDVVKRWVNEAQEAV  185



>ref|XP_006559436.1| PREDICTED: coatomer subunit gamma isoform X1 [Apis mellifera]
Length=899

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE    +EATE FFA+TKL
Sbjct  40   NPFQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTMEATEAFFAMTKL  99

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG +
Sbjct  100  FQSRDVVLRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGGM  159

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++  V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  160  LAAIERYMKQAIVDRSAAVSSAALVSTLHLTNVSGDVARRWANEAQEAL  208



>ref|XP_010135111.1| PREDICTED: coatomer subunit gamma-2, partial [Buceros rhinoceros 
silvestris]
Length=426

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  4    NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  63

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  64   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  123

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  124  LQAIERYMKQAIVDKVPSVSSSALVSSLHMMKISYDVVKRWINEAQEA  171



>ref|XP_004361518.1| adaptin N-terminal domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG23667.1| adaptin N-terminal domain-containing protein [Dictyostelium fasciculatum]
Length=890

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = +1

Query  133  PFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLF  312
            PF  ++KG V+QE RVFNE Q++AR+C+ VI++ LYLL++G+ FT  EAT+V+FA TKLF
Sbjct  15   PFESLDKGQVIQEKRVFNENQINARKCSFVISEFLYLLSRGDTFTNTEATDVYFAATKLF  74

Query  313  QSKDLGLRRMVYLIIKELSP--SADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGT  486
            QSKD+ LRR+ YL++KE S   S +  +I TSSL+KDM+ + ++YRAN+IRVLC+I D  
Sbjct  75   QSKDIPLRRLTYLLLKEFSTIMSQEMSLIATSSLVKDMSHKIELYRANSIRVLCKIIDNQ  134

Query  487  LLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            LL+Q+ER++KQ IVDK+P V+SAALVS IHLL+ +P+ VKRW+NEVQE++
Sbjct  135  LLSQVERHIKQCIVDKDPHVSSAALVSSIHLLKVSPDTVKRWANEVQESI  184



>ref|XP_006611320.1| PREDICTED: coatomer subunit gamma-like isoform X1 [Apis dorsata]
Length=899

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE    +EATE FFA+TKL
Sbjct  40   NPFQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTMEATEAFFAMTKL  99

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG +
Sbjct  100  FQSRDVVLRRLVYLGIKELSSLAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGGM  159

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD++  V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  160  LAAIERYMKQAIVDRSAAVSSAALVSTLHLTNVSGDVARRWANEAQEAL  208



>gb|EHJ74076.1| nonclathrin coat protein gamma1-COP [Danaus plexippus]
Length=864

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            F  ++K A+LQEAR FN   +  ++C  ++TK+LYLLNQGE  T  EAT++FFA TKLFQ
Sbjct  19   FQNLDKTALLQEARYFNSTPVIPKKCVQILTKILYLLNQGEKLTTQEATDIFFATTKLFQ  78

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            SKD+ LRR+VYL IKELS  A +VIIVTSSL KDM  + D+YRA AIR LC ITD T+L 
Sbjct  79   SKDVVLRRLVYLCIKELSSMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDSTMLQ  138

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             IERY+KQAIVDKNP V+SAALVS +HL  T PE+V+RW N+ QEA+
Sbjct  139  AIERYMKQAIVDKNPAVSSAALVSALHLSATVPELVRRWVNDAQEAI  185



>emb|CDW55059.1| coatomer subunit gamma [Trichuris trichiura]
Length=869

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P++  +K  VLQE+R FNE  ++AR+C  +++K LY+L QGE  T+ EAT+ FF +TKL
Sbjct  15   NPYVNCDKTTVLQESRQFNETAINARQCTSILSKFLYILGQGEKLTRKEATDAFFLITKL  74

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            +QS D  LRR+VYL +KEL+P AD+VIIVTSSL KDM  + ++YRA AIR LCRITD ++
Sbjct  75   WQSNDTILRRLVYLAVKELAPQADDVIIVTSSLTKDMTGKENIYRAAAIRALCRITDASM  134

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVD+ P VASAALVS +HLL+ NP+ ++RW+NE++EA+
Sbjct  135  LQAIERYMKQAIVDRVPAVASAALVSSLHLLKKNPDCIRRWANEIREAI  183



>dbj|BAA93048.2| nonclathrin coat protein gamma2-COP [Bombyx mori]
Length=860

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 131/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P+  ++K  VLQE R FN+  +  R+C+ ++TK+LYLLNQGE FT  EAT+ FFA TKL
Sbjct  14   NPYQNLDKTIVLQETREFNQTLVIPRKCSLILTKILYLLNQGENFTTQEATDAFFATTKL  73

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSK++ LRRMVYL IKELS  A +VIIVTSSL KDM  + D+YRA AIR LC ITD ++
Sbjct  74   FQSKEIMLRRMVYLCIKELSKLAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDASM  133

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKNP V+SAALVS +HL  T P++V+RW+NE QE +
Sbjct  134  LQAIERYMKQAIVDKNPAVSSAALVSALHLSSTAPDLVRRWANEAQETI  182



>ref|XP_009839265.1| hypothetical protein H257_13452 [Aphanomyces astaci]
 gb|ETV71325.1| hypothetical protein H257_13452 [Aphanomyces astaci]
Length=890

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF  ++K  VL E ++F++ Q+     R+C  +ITKLL++L QGE FT  E T+VFF V
Sbjct  36   SPFQNLDKATVLHETKIFSDAQMVMKQPRKCCQLITKLLHILTQGEPFTSNEITDVFFKV  95

Query  301  TKLFQSKDLGLRRMVYLIIKELSPS--ADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQ KD  LRRM+YL IKE++ +  +D VIIVT SL KDMNS TD+YRANAIRVLCRI
Sbjct  96   TKLFQGKDANLRRMMYLFIKEVADATPSDSVIIVTQSLSKDMNSDTDLYRANAIRVLCRI  155

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             D + L+ IERY+KQAIVDKNP+V+S+ALVSG+HL++ + ++V+RW+NEVQEA+
Sbjct  156  IDTSTLSAIERYIKQAIVDKNPLVSSSALVSGMHLMRHSADVVRRWTNEVQEAL  209



>dbj|BAE37449.1| unnamed protein product [Mus musculus]
Length=382

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F  +EATE FFA+T+L
Sbjct  17   NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTMEATEAFFAMTRL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  77   FQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  +ERY+KQAIVDK   VAS+ALVS +H+++ + ++VKRW NE QEA
Sbjct  137  LQAVERYMKQAIVDKVSSVASSALVSSLHMMKISYDVVKRWINEAQEA  184



>ref|XP_008067061.1| PREDICTED: coatomer subunit gamma-2-like, partial [Tarsius syrichta]
Length=357

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  61   NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  120

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  121  FQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  180

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK   V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  181  LQAIERYMKQAIVDKVSSVSSSALVSSLHMMKISYDVVKRWINEAQEA  228



>gb|KFP62193.1| Coatomer subunit gamma-2, partial [Cariama cristata]
Length=489

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  17   NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  77   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  137  LQAIERYMKQAIVDKVPSVSSSALVSSLHMMKISYDVVKRWINEAQEA  184



>ref|XP_009708813.1| PREDICTED: coatomer subunit gamma-2 [Cariama cristata]
Length=493

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  17   NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  77   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  137  LQAIERYMKQAIVDKVPSVSSSALVSSLHMMKISYDVVKRWINEAQEA  184



>gb|KFV94911.1| Coatomer subunit gamma-2, partial [Eurypyga helias]
Length=503

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  5    NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  64

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  65   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  124

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  125  LQAIERYMKQAIVDKVPSVSSSALVSSLHMMKISYDVVKRWINEAQEA  172



>ref|XP_010154042.1| PREDICTED: coatomer subunit gamma-2, partial [Eurypyga helias]
Length=502

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK+LYLLNQGE F   EATE FFA+T+L
Sbjct  4    NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTRL  63

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITDGT+
Sbjct  64   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTM  123

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  124  LQAIERYMKQAIVDKVPSVSSSALVSSLHMMKISYDVVKRWINEAQEA  171



>gb|ERL89814.1| hypothetical protein D910_07175 [Dendroctonus ponderosae]
Length=826

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = +1

Query  133  PFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLF  312
            PF  IEK AVLQEAR+FNE  ++ R+   V+TKLLY+LNQGE  +  EAT+VFFA+TKLF
Sbjct  37   PFQNIEKSAVLQEARIFNEASVNPRKSTAVLTKLLYMLNQGERLSPKEATDVFFAMTKLF  96

Query  313  QSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLL  492
            QS+DL LRR+VY+ IKELS  A++VIIVTSSL KDM  + DMYRA AIR LC IT+  +L
Sbjct  97   QSRDLVLRRLVYMGIKELSTMAEDVIIVTSSLTKDMTGKEDMYRAGAIRALCSITEAGML  156

Query  493  TQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
              IERY+KQAIVD++P V+SAAL+S +H+     E VKRW NE QEAV
Sbjct  157  PSIERYMKQAIVDRSPAVSSAALISAMHMTWFAAEGVKRWVNEAQEAV  204



>ref|XP_011495854.1| PREDICTED: coatomer subunit gamma isoform X2 [Ceratosolen solmsi 
marchali]
Length=873

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            F  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE     EATE FFA+TKLFQ
Sbjct  18   FQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTTEATETFFAMTKLFQ  77

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            S+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG +L 
Sbjct  78   SRDVVLRRLVYLGIKELSSIAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGAMLA  137

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             IERY+KQAIVD++  V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  138  AIERYMKQAIVDRSAAVSSAALVSSLHLTTVSGDVARRWANEAQEAL  184



>ref|XP_011495853.1| PREDICTED: coatomer subunit gamma isoform X1 [Ceratosolen solmsi 
marchali]
Length=889

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            F  +EK  VLQEAR FN+  ++ R+CAH++TK+LYLLNQGE     EATE FFA+TKLFQ
Sbjct  34   FQNLEKTTVLQEARTFNDTPVNPRKCAHILTKILYLLNQGEQLGTTEATETFFAMTKLFQ  93

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            S+D+ LRR+VYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITDG +L 
Sbjct  94   SRDVVLRRLVYLGIKELSSIAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDGAMLA  153

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             IERY+KQAIVD++  V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  154  AIERYMKQAIVDRSAAVSSAALVSSLHLTTVSGDVARRWANEAQEAL  200



>ref|XP_008864270.1| hypothetical protein H310_02513, partial [Aphanomyces invadans]
 gb|ETW08177.1| hypothetical protein H310_02513, partial [Aphanomyces invadans]
Length=899

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 135/174 (78%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQL---DARRCAHVITKLLYLLNQGEAFTKVEATEVFFAV  300
            SPF  ++K  VL E ++F++ Q+     R+C  +ITKLL++L QGE FT  E T+VFF V
Sbjct  48   SPFQNLDKATVLHETKIFSDAQMVMKQPRKCCQLITKLLHILTQGEPFTSNEITDVFFKV  107

Query  301  TKLFQSKDLGLRRMVYLIIKELSPS--ADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI  474
            TKLFQ KD  LRRM+YL IKE++ +  +D VIIVT SL KDMNS TD+YRANAIRVLCRI
Sbjct  108  TKLFQGKDANLRRMMYLFIKEVADATPSDSVIIVTQSLSKDMNSDTDLYRANAIRVLCRI  167

Query  475  TDGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             D + L  IERY+KQAIVDKNP+V+S+ALVSG+HL++ + ++V+RW NEVQEA+
Sbjct  168  IDTSTLAAIERYIKQAIVDKNPLVSSSALVSGMHLMRHSADVVRRWVNEVQEAL  221



>ref|XP_005793200.1| COPG1, gamma subunit of the coatomer [Emiliania huxleyi CCMP1516]
 gb|EOD40771.1| COPG1, gamma subunit of the coatomer [Emiliania huxleyi CCMP1516]
Length=916

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 134/173 (77%), Gaps = 3/173 (2%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            YSPF  ++K AVLQE R FN+ +++ R+C  ++TK+L+LL QGE  T +E TE+FF VTK
Sbjct  41   YSPFQSLQKAAVLQECRCFNDREINPRKCISILTKILWLLAQGEKLTALETTEIFFGVTK  100

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI---T  477
            L   KD  LRR++YL++KEL PS +EVIIV ++L KDMNS+ D+ RANA+RVL  I   T
Sbjct  101  LLMHKDQQLRRLLYLVLKELKPSPEEVIIVCATLTKDMNSKVDLNRANALRVLGAIIART  160

Query  478  DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            D T+L QIER+LKQA+VDKN  VA++ALVSGIHL+  NPE+V+RW NEVQ A+
Sbjct  161  DPTMLAQIERHLKQALVDKNCFVAASALVSGIHLMHVNPEVVRRWVNEVQTAL  213



>ref|XP_005793201.1| coatomer protein gamma 2 subunit [Emiliania huxleyi CCMP1516]
 gb|EOD40772.1| coatomer protein gamma 2 subunit [Emiliania huxleyi CCMP1516]
Length=873

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 134/173 (77%), Gaps = 3/173 (2%)
 Frame = +1

Query  127  YSPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTK  306
            YSPF  ++K AVLQE R FN+ +++ R+C  ++TK+L+LL QGE  T +E TE+FF VTK
Sbjct  41   YSPFQSLQKAAVLQECRCFNDREINPRKCISILTKILWLLAQGEKLTALETTEIFFGVTK  100

Query  307  LFQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRI---T  477
            L   KD  LRR++YL++KEL PS +EVIIV ++L KDMNS+ D+ RANA+RVL  I   T
Sbjct  101  LLMHKDQQLRRLLYLVLKELKPSPEEVIIVCATLTKDMNSKVDLNRANALRVLGAIIART  160

Query  478  DGTLLTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            D T+L QIER+LKQA+VDKN  VA++ALVSGIHL+  NPE+V+RW NEVQ A+
Sbjct  161  DPTMLAQIERHLKQALVDKNCFVAASALVSGIHLMHVNPEVVRRWVNEVQTAL  213



>ref|XP_008557515.1| PREDICTED: coatomer subunit gamma [Microplitis demolitor]
 gb|EZA45901.1| Coatomer subunit gamma-2 [Microplitis demolitor]
Length=877

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQE+R FN+  ++ R+C+ ++TK+LYLLNQGE   K EATE FFA+TKL
Sbjct  17   NPFQNLEKTAVLQESRTFNDTPVNPRKCSIIMTKILYLLNQGELLGKAEATETFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS+D+ LRR+VYL IK+LS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD  +
Sbjct  77   FQSRDVILRRLVYLGIKDLSTVAEDVIIVTSSLTKDMTGKEDLYRAPAIRALCTITDAGM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDK+P V+SAALVS +HL   + ++ +RW+NE QEA+
Sbjct  137  LAAIERYMKQAIVDKSPAVSSAALVSSLHLSNVSGDVARRWANEAQEAL  185



>gb|AAH45918.1| Copg2 protein [Danio rerio]
Length=299

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEAR+FNE  ++ RRC H++TK++YLL+QGE F   EATE FFA+T+L
Sbjct  17   NPFQHLEKSAVLQEARIFNETPINPRRCLHILTKIIYLLDQGEHFGTTEATEAFFAMTRL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE++  +++VIIVTSSL KDM  + D+YR  AIR LCRITD T+
Sbjct  77   FQSNDQTLRRMCYLTIKEMANISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDTTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +H+++ + ++VKRW NE QEA
Sbjct  137  LQAIERYMKQAIVDKVPSVSSSALVSSLHMVKMSFDVVKRWVNEAQEA  184



>gb|KFZ54001.1| Coatomer subunit gamma-1, partial [Caprimulgus carolinensis]
Length=231

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEARVFNE  ++ R+CAH++TK+LYL+NQGE    +EATE FFA+TKL
Sbjct  6    NPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEHLGVMEATESFFAMTKL  65

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE+S  A++VIIVTSSL KDM  + D YR  A+R LC+ITD T+
Sbjct  66   FQSNDPTLRRMCYLTIKEMSSIAEDVIIVTSSLTKDMTGKDDNYRGPAVRALCQITDSTM  125

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +HLL+T+ ++VKRW NE QEA
Sbjct  126  LQAIERYMKQAIVDKVPSVSSSALVSSLHLLKTSYDVVKRWVNEAQEA  173



>ref|XP_010161636.1| PREDICTED: coatomer subunit gamma-1-like, partial [Caprimulgus 
carolinensis]
Length=233

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEARVFNE  ++ R+CAH++TK+LYL+NQGE    +EATE FFA+TKL
Sbjct  4    NPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEHLGVMEATESFFAMTKL  63

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE+S  A++VIIVTSSL KDM  + D YR  A+R LC+ITD T+
Sbjct  64   FQSNDPTLRRMCYLTIKEMSSIAEDVIIVTSSLTKDMTGKDDNYRGPAVRALCQITDSTM  123

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAIVDK P V+S+ALVS +HLL+T+ ++VKRW NE QEA
Sbjct  124  LQAIERYMKQAIVDKVPSVSSSALVSSLHLLKTSYDVVKRWVNEAQEA  171



>ref|XP_004930789.1| PREDICTED: coatomer subunit gamma [Bombyx mori]
Length=863

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +P+  ++K  VLQE R FN+  +  R+C+ ++TK+LYL NQGE FT  EAT+ FFA TKL
Sbjct  17   NPYQNLDKTIVLQETREFNQTLVIPRKCSLILTKILYLRNQGENFTTQEATDAFFATTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSK++ LRRMVYL IKELS  A +VIIVTSSL KDM  + D+YRA AIR LC ITD ++
Sbjct  77   FQSKEIMLRRMVYLCIKELSKLAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDASM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDKNP V+SAALVS +HL  T P++V+RW+NE QE +
Sbjct  137  LQAIERYMKQAIVDKNPAVSSAALVSALHLSSTAPDLVRRWANEAQETI  185



>gb|AAX28445.2| SJCHGC05579 protein [Schistosoma japonicum]
Length=237

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            +  ++K AVLQEAR+FN+  L+ R+C H++TK+L +L Q +   KVEAT+ FFA+TKLFQ
Sbjct  24   YAKLDKTAVLQEARLFNQTPLNPRKCVHILTKILVILGQSDKVGKVEATDTFFAMTKLFQ  83

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            S D  LRRM+YL+IKEL+  AD+VIIVTSSL KDM      +R  AIR LC ITD  ++ 
Sbjct  84   SNDQNLRRMLYLVIKELATIADDVIIVTSSLTKDMTGPEVAFRGPAIRALCAITDSAMVQ  143

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
             IERYLKQAIVDK+P +ASA L S   L+   PEI+KRW+NE+QEA
Sbjct  144  SIERYLKQAIVDKSPAIASAVLTSAYQLMAVCPEIIKRWTNEIQEA  189



>ref|XP_002053897.1| GJ23086 [Drosophila virilis]
 gb|EDW67417.1| GJ23086 [Drosophila virilis]
Length=877

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            +  +EK +VLQE R+FNE  ++AR+C H++TK+LYL+NQGE     EAT+ FFA+TKLFQ
Sbjct  19   YQNLEKTSVLQETRIFNETPVNARKCIHILTKILYLMNQGEQLVPREATDCFFAMTKLFQ  78

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            SKD+ LRRMVYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD T+L 
Sbjct  79   SKDVVLRRMVYLGIKELSSVAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDHTMLQ  138

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             +ERY+KQ IVDKN  V+ AALVS + L  T  ++VKRW+NE QEA+
Sbjct  139  AVERYMKQCIVDKNAAVSCAALVSSLRLANTAGDVVKRWANEAQEAL  185



>ref|XP_005992625.1| PREDICTED: coatomer subunit gamma-1 [Latimeria chalumnae]
Length=831

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK AVLQEARVFNE  ++ R+C H++TK+LYL+NQGE     EATE FFA+TKL
Sbjct  17   NPFQQLEKSAVLQEARVFNETPINPRKCVHILTKILYLINQGEHLGSTEATEAFFAMTKL  76

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQS D  LRRM YL IKE+S  +D+VIIVTSSL KDM  + D YR  A+R LC+ITD T+
Sbjct  77   FQSNDPILRRMCYLTIKEMSTISDDVIIVTSSLTKDMTGKDDSYRGPAVRALCKITDNTM  136

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEA  633
            L  IERY+KQAI+DK   V+S+ L+S +HLL+T+ ++VKRW NE QEA
Sbjct  137  LQAIERYMKQAIIDKVSSVSSSGLISALHLLKTSFDVVKRWVNEAQEA  184



>ref|XP_001964590.1| GF22968 [Drosophila ananassae]
 gb|EDV30386.1| GF22968 [Drosophila ananassae]
Length=878

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  FMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKLFQ  315
            +  +EK +VLQE R FNE  ++AR+C H++TK+LYL+NQGE     EAT+ FFA+TKLFQ
Sbjct  19   YQNLEKTSVLQETRTFNETPVNARKCIHILTKILYLINQGEQLVAREATDCFFAMTKLFQ  78

Query  316  SKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTLLT  495
            SKD+ LRRMVYL IKELS  A++VIIVTSSL KDM  + D+YRA AIR LC ITD T+L 
Sbjct  79   SKDVVLRRMVYLGIKELSSIAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDNTMLQ  138

Query  496  QIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
             +ERY+KQ IVDKN  V+ AALVS + L  T+ ++VKRW+NE QEA+
Sbjct  139  AVERYMKQCIVDKNAAVSCAALVSSLRLASTSGDVVKRWANEAQEAL  185



>ref|XP_009058878.1| hypothetical protein LOTGIDRAFT_191967 [Lottia gigantea]
 gb|ESO90558.1| hypothetical protein LOTGIDRAFT_191967 [Lottia gigantea]
Length=876

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SPFMGIEKGAVLQEARVFNEPQLDARRCAHVITKLLYLLNQGEAFTKVEATEVFFAVTKL  309
            +PF  +EK +VLQEAR FNE  ++ R+C H++TK+LYL+NQGE     EATE FFA+TKL
Sbjct  15   NPFSNLEKSSVLQEARTFNETPINPRKCGHILTKILYLINQGETIGATEATEAFFAMTKL  74

Query  310  FQSKDLGLRRMVYLIIKELSPSADEVIIVTSSLMKDMNSRTDMYRANAIRVLCRITDGTL  489
            FQSKD  LRR+VYL IKE+S  A++VIIVTSSLMKDM  + D +R  +IR LC ITD  +
Sbjct  75   FQSKDTTLRRLVYLGIKEMSKIANDVIIVTSSLMKDMTGKEDQFRGPSIRALCSITDQMM  134

Query  490  LTQIERYLKQAIVDKNPVVASAALVSGIHLLQTNPEIVKRWSNEVQEAV  636
            L  IERY+KQAIVDK   V+SAALVS +HL + + ++ KRW NE QEAV
Sbjct  135  LQSIERYMKQAIVDKVSAVSSAALVSSMHLGRGSQDVTKRWVNEAQEAV  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125