BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038J07

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACJ06186.1|  peptidylprolyl isomerase                                258   2e-82   Ipomoea batatas [batate]
gb|AGH32899.1|  cyclophilin b                                           187   1e-54   Camellia oleifera [abura-tsubaki]
gb|AHI54562.1|  cyclophilin                                             175   5e-50   Camellia japonica [common camellia]
ref|XP_011086840.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    172   6e-49   Sesamum indicum [beniseed]
ref|XP_002265030.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    172   1e-48   Vitis vinifera
ref|XP_011020813.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   1e-47   Populus euphratica
ref|XP_002303772.1|  peptidyl-prolyl cis-trans isomerase cyclophi...    169   2e-47   Populus trichocarpa [western balsam poplar]
ref|XP_004228428.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    168   2e-47   Solanum lycopersicum
ref|XP_002299326.2|  hypothetical protein POPTR_0001s13480g             168   3e-47   Populus trichocarpa [western balsam poplar]
gb|EYU37403.1|  hypothetical protein MIMGU_mgv1a012269mg                167   3e-47   Erythranthe guttata [common monkey flower]
ref|XP_010090669.1|  Peptidyl-prolyl cis-trans isomerase CYP20-2        167   8e-47   Morus notabilis
ref|XP_007043900.1|  Peptidyl-prolyl cis-trans isomerase isoform 1      166   1e-46   Theobroma cacao [chocolate]
gb|KDP26847.1|  hypothetical protein JCGZ_18005                         166   2e-46   Jatropha curcas
ref|XP_010556115.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-46   Tarenaya hassleriana [spider flower]
ref|XP_002514874.1|  peptidyl-prolyl cis-trans isomerase, putative      165   4e-46   Ricinus communis
ref|XP_010556114.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   7e-46   
ref|XP_008340246.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   8e-46   
ref|XP_009372242.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    163   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_011036120.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    163   2e-45   Populus euphratica
ref|XP_006363774.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    162   3e-45   Solanum tuberosum [potatoes]
ref|XP_008390136.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    160   1e-44   
ref|XP_009792707.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    160   3e-44   Nicotiana sylvestris
ref|XP_010250635.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    159   5e-44   Nelumbo nucifera [Indian lotus]
ref|XP_007223392.1|  hypothetical protein PRUPE_ppa010146mg             159   6e-44   Prunus persica
ref|XP_006484168.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    157   3e-43   Citrus sinensis [apfelsine]
ref|XP_009616511.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    157   4e-43   Nicotiana tomentosiformis
gb|KJB12528.1|  hypothetical protein B456_002G023000                    156   7e-43   Gossypium raimondii
gb|KHG17795.1|  Peptidyl-prolyl cis-trans isomerase CYP20-2, chlo...    156   9e-43   Gossypium arboreum [tree cotton]
ref|XP_008222210.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   1e-42   Prunus mume [ume]
gb|KJB12529.1|  hypothetical protein B456_002G023000                    155   3e-42   Gossypium raimondii
ref|XP_006437971.1|  hypothetical protein CICLE_v10032474mg             155   3e-42   Citrus clementina [clementine]
emb|CDP13378.1|  unnamed protein product                                155   3e-42   Coffea canephora [robusta coffee]
ref|XP_010025286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    154   3e-42   Eucalyptus grandis [rose gum]
ref|XP_010492057.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    152   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010453368.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    152   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010419878.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    151   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_003569145.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    151   6e-41   Brachypodium distachyon [annual false brome]
ref|XP_008778781.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    151   8e-41   
ref|XP_009343126.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    150   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_004310109.1|  PREDICTED: photosynthetic NDH subunit of lum...    150   2e-40   Fragaria vesca subsp. vesca
ref|XP_002439092.1|  hypothetical protein SORBIDRAFT_09g000350          150   2e-40   Sorghum bicolor [broomcorn]
ref|XP_002873599.1|  hypothetical protein ARALYDRAFT_488128             150   2e-40   
ref|XP_004960938.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    150   2e-40   Setaria italica
ref|NP_001190299.1|  peptidyl-prolyl cis-trans isomerase CYP20-2        150   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61726.1|  peptidyl-prolyl cis-trans isomerase                     147   3e-40   Genlisea aurea
gb|AAM65904.1|  peptidylprolyl isomerase-like protein                   150   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196816.1|  peptidyl-prolyl cis-trans isomerase CYP20-2           149   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AFW75093.1|  putative peptidyl-prolyl cis-trans isomerase fami...    149   3e-40   
ref|XP_009131319.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    149   4e-40   Brassica rapa
ref|XP_004960937.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    150   6e-40   
ref|NP_001149265.1|  peptidyl-prolyl cis-trans isomerase                148   7e-40   Zea mays [maize]
emb|CAC05440.1|  peptidylprolyl isomerase-like protein                  149   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001054392.1|  Os05g0103200                                       148   8e-40   
gb|AAP44537.1|  cyclophilin-like protein                                148   8e-40   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ90691.1|  predicted protein                                      148   8e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX78508.1|  BnaA03g04200D                                          148   8e-40   
ref|XP_008459881.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   9e-40   Cucumis melo [Oriental melon]
gb|ABO37960.1|  peptidylprolyl isomerase                                148   1e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006653937.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   1e-39   Oryza brachyantha
emb|CDX70495.1|  BnaC03g05790D                                          148   1e-39   
gb|KCW61911.1|  hypothetical protein EUGRSUZ_H04606                     146   1e-39   Eucalyptus grandis [rose gum]
ref|XP_009390393.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912997.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   2e-39   Elaeis guineensis
gb|KCW61910.1|  hypothetical protein EUGRSUZ_H04606                     145   2e-39   Eucalyptus grandis [rose gum]
ref|XP_008648685.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   2e-39   
gb|KFK25546.1|  hypothetical protein AALP_AA8G128900                    147   3e-39   Arabis alpina [alpine rockcress]
emb|CAN82436.1|  hypothetical protein VITISV_040459                     145   3e-39   Vitis vinifera
gb|AAP44535.1|  cyclophilin-like protein                                146   4e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004140542.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    146   5e-39   Cucumis sativus [cucumbers]
ref|XP_003556583.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    146   5e-39   
ref|XP_006288490.1|  hypothetical protein CARUB_v10001755mg             146   6e-39   Capsella rubella
ref|XP_006399800.1|  hypothetical protein EUTSA_v10014434mg             146   7e-39   Eutrema salsugineum [saltwater cress]
gb|ACU19042.1|  unknown                                                 144   3e-38   Glycine max [soybeans]
gb|KHN37252.1|  Peptidyl-prolyl cis-trans isomerase CYP20-2, chlo...    143   6e-38   Glycine soja [wild soybean]
ref|XP_010682710.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    143   8e-38   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ87839.1|  predicted protein                                      144   9e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003536816.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    143   9e-38   
ref|XP_010929720.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    141   2e-37   
ref|XP_004497425.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    142   2e-37   Cicer arietinum [garbanzo]
gb|EMT15783.1|  Peptidyl-prolyl cis-trans isomerase CYP20-2, chlo...    145   3e-37   
ref|XP_009628829.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    139   4e-37   Nicotiana tomentosiformis
gb|AGV54525.1|  peptidyl-prolyl cis-trans isomerase                     139   3e-36   Phaseolus vulgaris [French bean]
ref|XP_007142599.1|  hypothetical protein PHAVU_007G001100g             139   3e-36   Phaseolus vulgaris [French bean]
gb|AFK36387.1|  unknown                                                 135   7e-35   Medicago truncatula
gb|ACJ85448.1|  unknown                                                 135   8e-35   Medicago truncatula
ref|XP_009404751.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006844622.1|  hypothetical protein AMTR_s00016p00225920          132   8e-34   Amborella trichopoda
emb|CCI55395.1|  NDH subunit PnsL5                                      127   1e-31   Marchantia polymorpha
gb|ABK21441.1|  unknown                                                 125   8e-31   Picea sitchensis
ref|XP_006290277.1|  hypothetical protein CARUB_v10017856mg             122   1e-29   Capsella rubella
ref|NP_001190159.1|  peptidyl-prolyl cis-trans isomerase CYP20-3        120   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63944.1|  peptidylprolyl isomerase ROC4                           120   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KEH43161.1|  peptidyl-prolyl cis-trans isomerase                     120   5e-29   Medicago truncatula
ref|XP_002876654.1|  hypothetical protein ARALYDRAFT_486711             119   5e-29   
gb|AAG40378.1|AF325026_1  AT3g62030                                     120   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191762.1|  peptidyl-prolyl cis-trans isomerase CYP20-3           120   5e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76611.1|  BnaC08g31970D                                          120   5e-29   
gb|KDO86742.1|  hypothetical protein CISIN_1g024387mg                   118   9e-29   Citrus sinensis [apfelsine]
ref|XP_010468991.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010413313.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   1e-28   Camelina sativa [gold-of-pleasure]
ref|NP_001154684.1|  peptidyl-prolyl cis-trans isomerase CYP20-3        119   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AFK38232.1|  unknown                                                 118   2e-28   Lotus japonicus
ref|XP_006444641.1|  hypothetical protein CICLE_v10021681mg             117   2e-28   
emb|CDY58761.1|  BnaA04g27460D                                          118   3e-28   Brassica napus [oilseed rape]
emb|CDX93994.1|  BnaC04g21530D                                          118   3e-28   
gb|KDO86743.1|  hypothetical protein CISIN_1g024387mg                   118   3e-28   Citrus sinensis [apfelsine]
ref|XP_006444642.1|  hypothetical protein CICLE_v10021681mg             118   3e-28   Citrus clementina [clementine]
ref|XP_009116878.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   5e-28   Brassica rapa
ref|XP_010045506.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     117   5e-28   Eucalyptus grandis [rose gum]
ref|XP_010512589.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   6e-28   Camelina sativa [gold-of-pleasure]
gb|ABC41015.1|  chloroplast-localized cyclophilin                       114   9e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010523872.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_002515157.1|  peptidyl-prolyl cis-trans isomerase, putative      116   1e-27   
ref|XP_007163259.1|  hypothetical protein PHAVU_001G219400g             116   1e-27   Phaseolus vulgaris [French bean]
emb|CDY11395.1|  BnaA09g39610D                                          115   2e-27   Brassica napus [oilseed rape]
emb|CAN69876.1|  hypothetical protein VITISV_015631                     115   3e-27   Vitis vinifera
ref|XP_002273421.2|  PREDICTED: peptidyl-prolyl cis-trans isomerase     115   3e-27   Vitis vinifera
gb|KGN49788.1|  Peptidyl-prolyl cis-trans isomerase                     114   4e-27   Cucumis sativus [cucumbers]
gb|ABC41017.1|  chloroplast-localized cyclophilin                       112   5e-27   Triticum aestivum [Canadian hard winter wheat]
gb|KJB12530.1|  hypothetical protein B456_002G023000                    114   6e-27   Gossypium raimondii
gb|KDP28363.1|  hypothetical protein JCGZ_14134                         114   7e-27   Jatropha curcas
ref|XP_006402419.1|  hypothetical protein EUTSA_v10006185mg             114   7e-27   Eutrema salsugineum [saltwater cress]
ref|XP_008466218.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   9e-27   Cucumis melo [Oriental melon]
ref|NP_001288530.1|  uncharacterized protein LOC103634647               112   1e-26   Zea mays [maize]
ref|XP_008655470.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   2e-26   
ref|XP_006444643.1|  hypothetical protein CICLE_v10021681mg             113   2e-26   Citrus clementina [clementine]
ref|NP_001150495.1|  peptidyl-prolyl cis-trans isomerase                112   2e-26   
ref|XP_002951189.1|  hypothetical protein VOLCADRAFT_81413              111   2e-26   Volvox carteri f. nagariensis
ref|XP_002990069.1|  hypothetical protein SELMODRAFT_229509             112   3e-26   
ref|XP_002986930.1|  hypothetical protein SELMODRAFT_229229             112   3e-26   
ref|XP_004288662.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     112   3e-26   Fragaria vesca subsp. vesca
ref|XP_004149480.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    112   4e-26   
ref|XP_009138740.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   4e-26   Brassica rapa
gb|KJB24499.1|  hypothetical protein B456_004G147800                    112   4e-26   Gossypium raimondii
ref|XP_004494484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   4e-26   
ref|XP_004164092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   4e-26   
ref|XP_004494482.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   4e-26   Cicer arietinum [garbanzo]
gb|KDB12004.1|  peptidyl-prolyl cis-trans isomerase B precursor         112   5e-26   Ustilaginoidea virens
gb|ABC41018.1|  chloroplast-localized cyclophilin                       109   6e-26   Triticum aestivum [Canadian hard winter wheat]
emb|CBQ70421.1|  probable cyclophilin b                                 110   7e-26   Sporisorium reilianum SRZ2
ref|XP_010240836.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    110   8e-26   Nelumbo nucifera [Indian lotus]
ref|NP_001240987.1|  uncharacterized protein LOC100785805               111   8e-26   Glycine max [soybeans]
gb|KCW88624.1|  hypothetical protein EUGRSUZ_A00992                     110   9e-26   Eucalyptus grandis [rose gum]
gb|KCW88623.1|  hypothetical protein EUGRSUZ_A00992                     109   1e-25   Eucalyptus grandis [rose gum]
ref|XP_010240835.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008776537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   1e-25   Phoenix dactylifera
ref|XP_007510149.1|  peptidyl-prolyl cis-trans isomerase B              110   1e-25   Bathycoccus prasinos
ref|XP_008227761.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   2e-25   Prunus mume [ume]
gb|ABI14285.1|  cyclophilin-like protein                                109   2e-25   Pfiesteria piscicida
ref|XP_002508058.1|  peptidylprolyl isomerase, precursor                109   2e-25   Micromonas commoda
ref|XP_010672482.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    110   3e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC70431.1|  hypothetical protein OsI_01440                          109   3e-25   Oryza sativa Indica Group [Indian rice]
gb|ACU15989.1|  unknown                                                 109   4e-25   Glycine max [soybeans]
ref|XP_008227760.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   5e-25   Prunus mume [ume]
ref|XP_008227759.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   5e-25   Prunus mume [ume]
ref|XP_004495847.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   5e-25   Cicer arietinum [garbanzo]
ref|XP_003567459.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     108   5e-25   Brachypodium distachyon [annual false brome]
ref|XP_007221498.1|  hypothetical protein PRUPE_ppa010357mg             109   6e-25   Prunus persica
ref|XP_009829338.1|  peptidyl-prolyl cis-trans isomerase                108   6e-25   Aphanomyces astaci
ref|XP_003536011.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   6e-25   
ref|XP_002301464.2|  cyclophilin family protein                         109   6e-25   
ref|XP_001766197.1|  predicted protein                                  107   7e-25   
ref|XP_007051330.1|  Peptidyl-prolyl cis-trans isomerase                108   8e-25   
ref|XP_504296.1|  YALI0E23155p                                          108   9e-25   Yarrowia lipolytica CLIB122
gb|KFK35389.1|  hypothetical protein AALP_AA5G278800                    112   9e-25   Arabis alpina [alpine rockcress]
ref|XP_002455482.1|  hypothetical protein SORBIDRAFT_03g011610          108   9e-25   Sorghum bicolor [broomcorn]
gb|ABA01141.1|  peptidylprolyl isomerase/cyclophilin-like protein       107   1e-24   Chlamydomonas incerta
gb|EMF10215.1|  peptidyl-prolyl cis-trans isomerase B precursor         107   1e-24   Sphaerulina musiva SO2202
ref|XP_005829570.1|  cyclophilin B                                      106   1e-24   Guillardia theta CCMP2712
gb|AIG55642.1|  secreted protein                                        107   1e-24   Thraustotheca clavata
sp|Q01490.1|PPIB_ORPSP  RecName: Full=Peptidyl-prolyl cis-trans i...    106   2e-24   Orpinomyces sp. PC-2
gb|EEE54351.1|  hypothetical protein OsJ_01342                          107   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|ABC47329.1|  cyclophilin B precursor                                 106   2e-24   Orpinomyces sp. PC-2
ref|XP_004967648.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   2e-24   Setaria italica
gb|EJW80238.1|  cyclophilin-type peptidyl-prolyl cis-trans isomer...    106   2e-24   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KEI40562.1|  hypothetical protein L969DRAFT_338716                   106   3e-24   Mixia osmundae IAM 14324
gb|KDO32415.1|  hypothetical protein SPRG_02892                         105   3e-24   Saprolegnia parasitica CBS 223.65
ref|XP_011116201.1|  hypothetical protein H072_10767                    107   3e-24   
ref|XP_001700546.1|  peptidyl-prolyl cis-trans isomerase, cycloph...    105   3e-24   Chlamydomonas reinhardtii
emb|CDJ26558.1|  unnamed protein product                                105   3e-24   Triticum aestivum [Canadian hard winter wheat]
gb|KHN95402.1|  peptidyl-prolyl cis-trans isomerase B precursor         107   4e-24   Metarhizium album ARSEF 1941
dbj|BAB39968.1|  putative peptidyl-prolyl cis-trans isomerase, ch...    106   4e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006840420.1|  hypothetical protein AMTR_s00045p00158000          107   4e-24   Amborella trichopoda
ref|XP_011025284.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     107   4e-24   Populus euphratica
gb|EME39331.1|  hypothetical protein DOTSEDRAFT_75145                   105   5e-24   Dothistroma septosporum NZE10
sp|Q41651.1|CYPB_VICFA  RecName: Full=Peptidyl-prolyl cis-trans i...    106   5e-24   Vicia faba [broad bean]
emb|CDP90818.1|  Protein Bm13780                                        105   6e-24   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001896264.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    105   6e-24   Brugia malayi [agent of lymphatic filariasis]
ref|XP_662071.1|  hypothetical protein AN4467.2                         105   7e-24   Aspergillus nidulans FGSC A4
gb|ERG83631.1|  peptidyl-prolyl cis-trans isomerase b                   105   7e-24   
ref|XP_001748242.1|  hypothetical protein                               104   9e-24   Monosiga brevicollis MX1
gb|AIG55930.1|  secreted protein                                        104   1e-23   Achlya hypogyna
ref|XP_010907913.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    105   1e-23   
ref|XP_008878745.1|  peptidyl-prolyl cis-trans isomerase                104   1e-23   Aphanomyces invadans
emb|CDJ93250.1|  Peptidyl-prolyl cis-trans isomerase domain conta...    104   1e-23   Haemonchus contortus [red stomach worm]
ref|XP_008604422.1|  peptidyl-prolyl cis-trans isomerase B (cyclo...    104   1e-23   Saprolegnia diclina VS20
ref|XP_002110986.1|  expressed hypothetical protein                     104   1e-23   Trichoplax adhaerens
gb|EKV19754.1|  Peptidyl-prolyl cis-trans isomerase B                   105   1e-23   Penicillium digitatum PHI26
ref|XP_004990131.1|  peptidyl-prolyl cis-trans isomerase                103   2e-23   Salpingoeca rosetta
ref|XP_001774447.1|  predicted protein                                  101   2e-23   
gb|KGO76066.1|  hypothetical protein PITC_006090                        106   2e-23   Penicillium italicum
dbj|GAC97260.1|  peptidyl-prolyl cis-trans isomerase                    103   2e-23   Pseudozyma hubeiensis SY62
ref|XP_002796880.1|  peptidyl-prolyl cis-trans isomerase B              103   2e-23   Paracoccidioides lutzii Pb01
gb|AFK44786.1|  unknown                                                 103   2e-23   Lotus japonicus
gb|EIT78368.1|  peptidyl-prolyl cis-trans isomerase                     103   3e-23   Aspergillus oryzae 3.042
ref|XP_004500254.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-23   Cicer arietinum [garbanzo]
emb|CCO27209.1|  peptidyl-prolyl cis-trans isomerase B (cyclophil...    102   3e-23   Rhizoctonia solani AG-1 IB
ref|XP_002565809.1|  Pc22g19060                                         104   3e-23   Penicillium rubens Wisconsin 54-1255
ref|XP_003058664.1|  predicted protein                                  103   3e-23   Micromonas pusilla CCMP1545
ref|XP_007235156.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-23   
ref|XP_003626095.1|  Peptidyl-prolyl cis-trans isomerase                104   4e-23   
gb|KFH46236.1|  Peptidyl-prolyl cis-trans isomerase B-like protein      103   4e-23   Acremonium chrysogenum ATCC 11550
gb|EPS28743.1|  hypothetical protein PDE_03689                          103   4e-23   Penicillium oxalicum 114-2
gb|AFK43472.1|  unknown                                                 104   4e-23   Medicago truncatula
gb|ACO10021.1|  Peptidyl-prolyl cis-trans isomerase B precursor         103   4e-23   Osmerus mordax
ref|NP_180557.1|  peptidyl-prolyl cis-trans isomerase CYP19-4           102   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63088.1|  cyclophilin                                             102   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010685556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   5e-23   Beta vulgaris subsp. vulgaris [field beet]
emb|CDM27801.1|  Cyclophilin-like peptidyl-prolyl cis-trans isome...    103   5e-23   Penicillium roqueforti FM164
ref|NP_001077978.1|  peptidyl-prolyl cis-trans isomerase CYP19-4        102   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797942.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   5e-23   Phoenix dactylifera
gb|KGO40196.1|  hypothetical protein PEXP_035800                        103   6e-23   Penicillium expansum
ref|XP_002881077.1|  cyclophilin                                        102   6e-23   
ref|XP_001401570.2|  peptidyl-prolyl cis-trans isomerase B              102   6e-23   Aspergillus niger CBS 513.88
gb|AAB71401.1|  cyclophilin                                             102   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007876711.1|  hypothetical protein PFL1_01020                    104   7e-23   Anthracocystis flocculosa PF-1
ref|XP_008777294.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   7e-23   Phoenix dactylifera
ref|NP_998184.1|  peptidyl-prolyl cis-trans isomerase B                 102   8e-23   Danio rerio [leopard danio]
emb|CDS10860.1|  hypothetical protein LRAMOSA11346                      102   8e-23   Lichtheimia ramosa
gb|KIN03862.1|  hypothetical protein OIDMADRAFT_18066                   102   8e-23   Oidiodendron maius Zn
ref|XP_003067447.1|  cyclophilin B, putative                            102   8e-23   Coccidioides posadasii C735 delta SOWgp
gb|EFO27785.2|  cyclophilin-type peptidyl-prolyl cis-trans isomer...    102   8e-23   Loa loa
gb|EFW19740.1|  cyclophilin type peptidyl-prolyl cis-trans isomerase    102   8e-23   Coccidioides posadasii str. Silveira
gb|EYB84042.1|  hypothetical protein Y032_0323g2468                     102   9e-23   Ancylostoma ceylanicum
ref|XP_001775768.1|  predicted protein                                  101   1e-22   
ref|XP_011398089.1|  Peptidyl-prolyl cis-trans isomerase B              102   1e-22   Auxenochlorella protothecoides
ref|XP_001271658.1|  peptidyl-prolyl cis-trans isomerase (CypB), ...    102   1e-22   Aspergillus clavatus NRRL 1
gb|KJB34586.1|  hypothetical protein B456_006G106600                    100   1e-22   Gossypium raimondii
ref|XP_006260964.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-22   Alligator mississippiensis
ref|XP_008343225.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-22   
ref|XP_008343228.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-22   
ref|XP_003136287.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    102   1e-22   
ref|XP_008343227.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-22   
ref|XP_008343226.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-22   
ref|XP_780268.2|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    102   1e-22   Strongylocentrotus purpuratus [purple urchin]
gb|EST06371.1|  cyclophilin                                             101   2e-22   Kalmanozyma brasiliensis GHG001
gb|EYE94910.1|  hypothetical protein EURHEDRAFT_412752                  102   2e-22   Aspergillus ruber CBS 135680
gb|AHK24889.1|  peptidyl-prolyl cis-trans isomerase                     100   2e-22   Lilium lancifolium [true tiger lily]
emb|CAL00689.1|  unnamed protein product                                102   2e-22   Aspergillus niger
gb|KIW62098.1|  peptidyl-prolyl cis-trans isomerase B, variant 1        101   2e-22   Exophiala xenobiotica
gb|EPE05394.1|  peptidyl-prolyl cis-trans isomerase b                   103   2e-22   Ophiostoma piceae UAMH 11346
ref|XP_001821315.2|  peptidyl-prolyl cis-trans isomerase B              102   2e-22   
dbj|GAM82492.1|  hypothetical protein ANO11243_004720                   101   2e-22   fungal sp. No.11243
gb|AFK34845.1|  unknown                                                 100   2e-22   Medicago truncatula
gb|EKG14833.1|  Peptidyl-prolyl cis-trans isomerase cyclophilin-type    102   2e-22   Macrophomina phaseolina MS6
ref|XP_006748527.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   2e-22   Leptonychotes weddellii
gb|ERS98637.1|  peptidyl-prolyl cis-trans isomerase B                   102   3e-22   Sporothrix schenckii ATCC 58251
ref|XP_004456948.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   3e-22   Dasypus novemcinctus
emb|CEF99496.1|  Cyclophilin-type peptidyl-prolyl cis-trans isome...    101   3e-22   Ostreococcus tauri
ref|XP_010759717.1|  peptidyl-prolyl cis-trans isomerase B              100   3e-22   Paracoccidioides brasiliensis Pb18
gb|AAT09096.1|  cyclophilin                                             100   3e-22   Bigelowiella natans
emb|CEL60807.1|  peptidyl-prolyl cis-trans isomerase B (cyclophil...    102   3e-22   Rhizoctonia solani AG-1 IB
ref|XP_004402631.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   3e-22   
ref|XP_008797941.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   3e-22   
gb|EGE86767.1|  peptidyl-prolyl cis-trans isomerase A                   100   3e-22   
gb|KDN62476.1|  putative cyclophilin type peptidyl-prolyl cis-tra...    100   3e-22   Colletotrichum sublineola
ref|XP_003172074.1|  peptidyl-prolyl cis-trans isomerase B              101   3e-22   Nannizzia gypsea CBS 118893
ref|XP_010510426.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003344533.1|  hypothetical protein SMAC_07541                    100   3e-22   Sordaria macrospora k-hell
emb|CDI51937.1|  probable cyclophilin b                                 102   3e-22   Melanopsichium pennsylvanicum 4
ref|NP_001290690.1|  peptidylprolyl isomerase B (cyclophilin B)         100   3e-22   Esox lucius
ref|XP_002627161.1|  peptidyl-prolyl cis-trans isomerase A              100   3e-22   Blastomyces gilchristii SLH14081
gb|AFK38976.1|  unknown                                                 100   3e-22   Lotus japonicus
ref|XP_006628998.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   3e-22   Lepisosteus oculatus
ref|XP_007929095.1|  hypothetical protein MYCFIDRAFT_211936             100   3e-22   Pseudocercospora fijiensis CIRAD86
ref|NP_001187168.1|  cyclophilin B                                      100   4e-22   Ictalurus punctatus
emb|CDY55458.1|  BnaC04g54560D                                          100   4e-22   Brassica napus [oilseed rape]
ref|XP_009144343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   4e-22   Brassica rapa
gb|KJB34587.1|  hypothetical protein B456_006G106600                    100   4e-22   Gossypium raimondii
emb|CEP19173.1|  hypothetical protein                                   100   4e-22   
gb|ELR04007.1|  hypothetical protein GMDG_06522                         100   4e-22   
ref|XP_009066227.1|  hypothetical protein LOTGIDRAFT_197622             100   4e-22   
ref|XP_005666774.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   4e-22   
ref|XP_011386997.1|  putative cyclophilin b                             100   4e-22   
ref|XP_001225362.1|  hypothetical protein CHGG_07706                    100   4e-22   
ref|XP_001911375.1|  hypothetical protein                               100   4e-22   
ref|XP_006669124.1|  peptidyl-prolyl cis-trans isomerase B precursor    100   4e-22   
ref|XP_752060.1|  peptidyl-prolyl cis-trans isomerase (CypB)            100   4e-22   
gb|EDP50143.1|  peptidyl-prolyl cis-trans isomerase (CypB), putative    100   4e-22   
gb|EHK27517.1|  hypothetical protein TRIVIDRAFT_110996                  100   5e-22   
gb|EHK27516.1|  hypothetical protein TRIVIDRAFT_110996                  101   5e-22   
ref|XP_001420044.1|  predicted protein                                  100   5e-22   
sp|O93826.1|PPIB_ARTBE  RecName: Full=Peptidyl-prolyl cis-trans i...    100   5e-22   
gb|KIW37125.1|  peptidyl-prolyl cis-trans isomerase B, variant 1        100   5e-22   
ref|XP_004631390.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   5e-22   
ref|XP_003236848.1|  peptidyl-prolyl cis-trans isomerase                100   5e-22   
gb|KFG85290.1|  peptidyl-prolyl cis-trans isomerase B precursor         100   5e-22   
gb|KID98291.1|  peptidyl-prolyl cis-trans isomerase B precursor         100   5e-22   
ref|NP_001134342.1|  peptidyl-prolyl cis-trans isomerase B              100   5e-22   
gb|EWG47793.1|  peptidyl-prolyl cis-trans isomerase B                   100   5e-22   
ref|NP_001236075.1|  uncharacterized protein LOC100305485 precursor     100   5e-22   
ref|XP_006657326.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   5e-22   
gb|KEY67381.1|  hypothetical protein S7711_07591                        101   5e-22   
ref|XP_008989861.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    5e-22   
ref|XP_007823009.1|  hypothetical protein MAA_06820                     100   5e-22   
gb|ACI68543.1|  Peptidyl-prolyl cis-trans isomerase B precursor         100   5e-22   
ref|XP_003055075.1|  predicted protein                                  100   5e-22   
gb|ABY55262.1|  peptidylprolyl isomerase B                              100   5e-22   
gb|KFA62631.1|  hypothetical protein S40285_05192                       101   6e-22   
ref|XP_004716344.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   6e-22   
ref|XP_010469913.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   6e-22   
gb|EXK43005.1|  peptidyl-prolyl cis-trans isomerase B                   100   6e-22   
gb|EZF34889.1|  peptidyl-prolyl cis-trans isomerase B                   100   6e-22   
gb|EWY99570.1|  peptidyl-prolyl cis-trans isomerase B                   100   6e-22   
ref|XP_009648598.1|  peptidyl-prolyl cis-trans isomerase B              100   6e-22   
gb|ACI69995.1|  Peptidyl-prolyl cis-trans isomerase B precursor         100   6e-22   
gb|EGD96688.1|  peptidyl-prolyl cis-trans isomerase                     100   6e-22   
gb|ACF49500.1|  cyclophilin B-B                                         100   6e-22   
gb|ACF49501.1|  cyclophilin B-A                                         100   6e-22   
ref|XP_001771085.1|  predicted protein                                  100   7e-22   
gb|EWG47792.1|  peptidyl-prolyl cis-trans isomerase B                   100   7e-22   
gb|KEQ84151.1|  peptidyl-prolyl cis-trans isomerase B                 99.8    7e-22   
ref|XP_003480383.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    7e-22   
ref|XP_002979746.1|  hypothetical protein SELMODRAFT_111263           99.8    7e-22   
gb|EFQ28064.1|  cyclophilin type peptidyl-prolyl cis-trans isomer...  99.8    7e-22   
ref|XP_001693941.1|  peptidyl-prolyl cis-trans isomerase, cycloph...    100   7e-22   
gb|AFK42902.1|  unknown                                               99.4    7e-22   
gb|KFK24386.1|  hypothetical protein AALP_AAs72209U000300             99.8    7e-22   
emb|CCT65533.1|  probable cyclophilin                                   100   7e-22   
ref|XP_009420416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    7e-22   
gb|EXK43004.1|  peptidyl-prolyl cis-trans isomerase B                   100   7e-22   
ref|XP_010997124.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    8e-22   
ref|XP_007111689.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    8e-22   
ref|NP_001088413.1|  uncharacterized protein LOC495270                  100   8e-22   
emb|CEJ94528.1|  Putative Peptidyl-prolyl cis-trans isomerase         99.8    8e-22   
ref|XP_010969843.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    8e-22   
gb|AAP76508.1|  cyclophilin                                             100   8e-22   
ref|XP_006216559.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    8e-22   
gb|KID77583.1|  peptidyl-prolyl cis-trans isomerase B precursor         100   8e-22   
gb|EGU82230.1|  hypothetical protein FOXB_07290                         100   8e-22   
ref|XP_001540375.1|  peptidyl-prolyl cis-trans isomerase A            99.8    8e-22   
ref|XP_002953624.1|  hypothetical protein VOLCADRAFT_109223             100   8e-22   
ref|XP_009409921.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    8e-22   
ref|NP_001040172.1|  peptidyl-prolyl cis-trans isomerase              99.4    8e-22   
gb|EXL62949.1|  peptidyl-prolyl cis-trans isomerase B                   100   8e-22   
ref|XP_007188544.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    8e-22   
ref|XP_008891344.1|  peptidyl-prolyl cis-trans isomerase              99.8    8e-22   
gb|EMT64980.1|  Peptidyl-prolyl cis-trans isomerase B                   100   8e-22   
gb|EXX53905.1|  peptidylprolyl isomerase family protein CPR5          99.8    8e-22   
ref|XP_007008975.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...  99.8    9e-22   
ref|XP_009116285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   9e-22   
ref|XP_003800009.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    9e-22   
gb|KID63882.1|  peptidyl-prolyl cis-trans isomerase B precursor         100   9e-22   
emb|CDX72190.1|  BnaC08g26840D                                        99.8    9e-22   
gb|KIW62097.1|  peptidyl-prolyl cis-trans isomerase B                   100   9e-22   
ref|NP_001017063.1|  peptidyl-prolyl cis-trans isomerase B precursor  99.4    9e-22   
ref|XP_001626729.1|  predicted protein                                99.4    9e-22   
gb|EMD90907.1|  hypothetical protein COCHEDRAFT_1021706               99.4    1e-21   
ref|XP_852389.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...  99.8    1e-21   
ref|XP_004409478.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    1e-21   
ref|NP_001265776.1|  peptidyl-prolyl cis-trans isomerase B            99.8    1e-21   
ref|XP_006920335.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    1e-21   
ref|XP_004758782.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    1e-21   
ref|XP_009341538.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   1e-21   
gb|ENH78805.1|  peptidyl-prolyl cis-trans isomerase b precursor         100   1e-21   
gb|KHG08655.1|  Peptidyl-prolyl cis-trans isomerase CYP20-1 -like...  99.4    1e-21   
ref|XP_002914286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-21   
ref|XP_007260835.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-21   
ref|XP_003354302.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-21   
ref|XP_009341536.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   1e-21   
ref|XP_007791043.1|  putative peptidyl-prolyl cis-trans isomerase...    100   1e-21   
ref|XP_002988391.1|  hypothetical protein SELMODRAFT_447339           99.4    1e-21   
ref|XP_010414329.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-21   
ref|XP_009341537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   1e-21   
ref|XP_009409920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-21   
ref|NP_001093231.1|  peptidyl-prolyl cis-trans isomerase B            99.4    1e-21   
gb|KIW17876.1|  peptidyl-prolyl cis-trans isomerase B                 99.4    1e-21   
gb|ACF49505.1|  cyclophilin B-D                                       99.4    1e-21   
ref|XP_004795805.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-21   
ref|XP_004421741.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-21   
ref|XP_007584954.1|  putative peptidyl-prolyl cis-trans isomerase...  99.4    1e-21   
ref|XP_006093465.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-21   
gb|ENI06010.1|  hypothetical protein COCC4DRAFT_80920                   100   1e-21   
gb|EEH10637.1|  peptidyl-prolyl cis-trans isomerase B                 99.0    1e-21   
gb|EPY38658.1|  cyclophilin                                           99.0    1e-21   
ref|XP_001561947.1|  cyclophilin 2                                    98.6    1e-21   
ref|XP_011231183.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    1e-21   
gb|KIW37124.1|  peptidyl-prolyl cis-trans isomerase B                   100   1e-21   
ref|XP_007146769.1|  hypothetical protein PHAVU_006G068200g           99.0    1e-21   
ref|XP_006410046.1|  hypothetical protein EUTSA_v10016970mg             100   2e-21   
ref|XP_004854538.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    2e-21   
ref|XP_003661719.1|  hypothetical protein MYCTH_2301478               99.0    2e-21   
ref|XP_011394481.1|  peptidyl-prolyl cis-trans isomerase B, variant   99.0    2e-21   
ref|XP_004610008.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
gb|KCW85439.1|  hypothetical protein EUGRSUZ_B02252                   97.1    2e-21   
sp|Q2UGK2.1|PPIB_ASPOR  RecName: Full=Peptidyl-prolyl cis-trans i...  98.6    2e-21   
ref|XP_006913379.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    2e-21   
ref|XP_003293545.1|  hypothetical protein DICPUDRAFT_90286            98.6    2e-21   
gb|KJB34588.1|  hypothetical protein B456_006G106600                  99.8    2e-21   
ref|XP_005764454.1|  peptidyl-prolyl cis-trans isomerase              97.8    2e-21   
pdb|2RMC|A  Chain A, Crystal Structure Of Murine Cyclophilin C Co...  98.2    2e-21   
gb|ABB86261.1|  cyclophilin ROC7-like                                 98.6    2e-21   
ref|XP_006350839.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|XP_011356603.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    2e-21   
ref|XP_004267474.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    2e-21   
emb|CDR39798.1|  RHTO0S04e09670g2_1                                   98.6    2e-21   
gb|KJB74296.1|  hypothetical protein B456_011G287900                  98.2    2e-21   
ref|XP_001366685.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    2e-21   
ref|XP_006403401.1|  hypothetical protein EUTSA_v10010699mg           99.0    2e-21   
ref|XP_005711788.1|  peptidyl-prolyl cis-trans isomerase              98.2    2e-21   
ref|XP_007681645.1|  hypothetical protein BAUCODRAFT_127134           98.6    2e-21   
ref|XP_005770377.1|  peptidyl-prolyl isomerase                        98.6    2e-21   
gb|EER44701.1|  peptidyl-prolyl cis-trans isomerase B                 98.6    2e-21   
gb|EHK50516.1|  peptidyl-prolyl cis-trans isomerase cyclophilin B...  99.8    2e-21   
ref|XP_007016102.1|  Cyclophilin 5                                    98.6    2e-21   
ref|XP_007205915.1|  hypothetical protein PRUPE_ppa011595mg           97.4    2e-21   
ref|XP_010535384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|XP_004555816.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|NP_001232251.1|  putative peptidylprolyl isomerase B (cycloph...  98.6    2e-21   
ref|XP_008139565.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|XP_006294680.1|  hypothetical protein CARUB_v10023717mg             100   2e-21   
ref|XP_002744707.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|XP_003920703.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
pdb|2ESL|A  Chain A, Human Cyclophilin C In Complex With Cyclospo...  97.8    2e-21   
ref|XP_007455315.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|XP_005142557.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|XP_006899681.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|XP_007166051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    2e-21   
ref|XP_002294318.1|  predicted protein                                97.4    2e-21   
gb|KEQ98072.1|  hypothetical protein AUEXF2481DRAFT_63321             98.2    2e-21   
ref|XP_009848062.1|  peptidyl-prolyl cis-trans isomerase B            99.8    3e-21   
gb|EMS19251.1|  peptidyl-prolyl cis-trans isomerase B (cyclophili...  98.2    3e-21   
ref|XP_008600518.1|  peptidyl-prolyl cis-trans isomerase B            98.2    3e-21   
ref|XP_010359710.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    3e-21   
ref|XP_003444551.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
gb|KDE05685.1|  peptidyl-prolyl cis-trans isomerase B                 98.2    3e-21   
ref|XP_009773253.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
gb|EHK50515.1|  peptidyl-prolyl cis-trans isomerase cyclophilin B...  98.2    3e-21   
ref|XP_006969110.1|  peptidyl-prolyl isomerase                        98.2    3e-21   
ref|NP_032934.1|  peptidyl-prolyl cis-trans isomerase C precursor     98.2    3e-21   
ref|XP_003538292.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
gb|EFX06086.1|  peptidyl-prolyl cis-trans isomerase b precursor       99.8    3e-21   
ref|XP_008355066.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
gb|KEQ68287.1|  peptidyl-prolyl cis-trans isomerase B                 98.2    3e-21   
ref|XP_005281008.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    3e-21   
gb|ACJ54439.1|  cyclophilin B                                         98.2    3e-21   
gb|KGQ05779.1|  Peptidyl-prolyl cis-trans isomerase B                 98.2    3e-21   
ref|XP_004042460.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
ref|XP_007274074.1|  peptidyl-prolyl cis-trans isomerase b precursor  99.4    3e-21   
ref|XP_010748753.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
ref|XP_008384800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
ref|XP_008358961.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
gb|KEQ63560.1|  peptidyl-prolyl cis-trans isomerase B                 98.2    3e-21   
dbj|BAF83010.1|  unnamed protein product                              98.2    3e-21   
ref|XP_004241161.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    3e-21   
ref|XP_006831608.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
ref|XP_010227456.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
gb|KFY10966.1|  hypothetical protein V491_07396                       98.6    3e-21   
ref|XP_003480239.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
ref|XP_010933260.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
gb|EMP34777.1|  Peptidyl-prolyl cis-trans isomerase C                 97.8    3e-21   
ref|NP_000934.1|  peptidyl-prolyl cis-trans isomerase C precursor     98.2    3e-21   
ref|NP_990792.1|  peptidyl-prolyl cis-trans isomerase B precursor     97.8    3e-21   
gb|EWC43901.1|  peptidyl-prolyl cis-trans isomerase B                 99.4    3e-21   
ref|XP_010043430.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    3e-21   
ref|XP_002844166.1|  peptidyl-prolyl cis-trans isomerase B            98.6    3e-21   
ref|XP_002901150.1|  peptidyl-prolyl cis-trans isomerase CYP19-4 ...  97.8    3e-21   
ref|XP_010516184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    3e-21   
gb|KIX00141.1|  peptidyl-prolyl cis-trans isomerase B                 97.8    3e-21   
gb|KEF51912.1|  peptidyl-prolyl cis-trans isomerase B                 97.8    3e-21   
dbj|GAD96413.1|  peptidyl-prolyl cis-trans isomerase                  99.0    3e-21   
ref|XP_002815869.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    3e-21   
ref|XP_003851185.1|  hypothetical protein MYCGRDRAFT_44978            97.8    3e-21   
gb|EQB56800.1|  hypothetical protein CGLO_03165                       99.0    3e-21   
ref|XP_004420323.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    4e-21   
ref|XP_008253173.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    4e-21   
ref|XP_005069173.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    4e-21   
ref|XP_001508975.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    4e-21   
ref|XP_003310839.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    4e-21   
ref|NP_001070378.1|  peptidyl-prolyl cis-trans isomerase C precursor  97.8    4e-21   
ref|XP_007956090.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    4e-21   
ref|XP_011281722.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    4e-21   
gb|KJB74297.1|  hypothetical protein B456_011G287900                  97.8    4e-21   
ref|XP_011327211.1|  peptidyl-prolyl cis-trans isomerase B precursor  98.6    4e-21   
ref|XP_009260793.1|  hypothetical protein FPSE_09401                  98.6    4e-21   
ref|XP_003418399.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    4e-21   
ref|XP_006987549.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    4e-21   
gb|KIL91196.1|  peptidyl-prolyl cis-trans isomerase b                 98.6    4e-21   
ref|XP_006059568.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    4e-21   
gb|KIV95406.1|  peptidyl-prolyl cis-trans isomerase B, variant 1      97.8    4e-21   
ref|XP_007633768.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    4e-21   
ref|NP_001080505.1|  peptidyl-prolyl cis-trans isomerase B            97.8    4e-21   
gb|KJB74295.1|  hypothetical protein B456_011G287900                  98.2    4e-21   
gb|KDO68980.1|  hypothetical protein CISIN_1g027222mg                 97.4    4e-21   
ref|XP_003050333.1|  predicted protein                                97.8    4e-21   
ref|XP_011394482.1|  peptidyl-prolyl cis-trans isomerase B            99.0    4e-21   
ref|XP_009347261.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    4e-21   
ref|XP_008722831.1|  peptidyl-prolyl cis-trans isomerase B            97.8    4e-21   
ref|XP_005809803.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    4e-21   
ref|XP_004337460.1|  peptidylprolyl cis-trans isomerase               97.1    4e-21   



>gb|ACJ06186.1| peptidylprolyl isomerase [Ipomoea batatas]
Length=260

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 171/191 (90%), Gaps = 4/191 (2%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MALPFAALANAGSLSVPRNLAPVKVSSS+CSYSKLPRS+SA   +S  SS   S      
Sbjct  1    MALPFAALANAGSLSVPRNLAPVKVSSSVCSYSKLPRSSSASSQSSFSSSAFISGSLRL-  59

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
               QKF SCSVQVKS RPLAPV+ATAQVAEPQSKVTSQVYFDISIGNPVGKA GRIVIGL
Sbjct  60   ---QKFPSCSVQVKSVRPLAPVQATAQVAEPQSKVTSQVYFDISIGNPVGKAVGRIVIGL  116

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGDEVPQTAENFRALCTGEKGFGFKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  117  YGDEVPQTAENFRALCTGEKGFGFKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  176

Query  644  DENFKLVHAGP  676
            DENFKLVHAGP
Sbjct  177  DENFKLVHAGP  187



>gb|AGH32899.1| cyclophilin b [Camellia oleifera]
Length=264

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 150/192 (78%), Gaps = 2/192 (1%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA+PF AL+N GS S  R+L+ + + S  C+  KLP S    DT+SSL S SS    S  
Sbjct  1    MAVPFTALSNIGSFSCSRSLSQMNLVSPSCTSKKLPTSTLPSDTSSSLLSSSSLLSRSLR  60

Query  284  lrlQKFSS-CSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
            L    +SS  S Q K+G P + VRA A+VAE QSKVT +VYFD+SIGNPVGK AGRIVIG
Sbjct  61   LVPLPYSSGTSFQRKTGNP-SSVRAIAEVAELQSKVTQKVYFDVSIGNPVGKLAGRIVIG  119

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            LYGD+VPQTAENFRALCTGEKGFGFKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTF
Sbjct  120  LYGDDVPQTAENFRALCTGEKGFGFKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTF  179

Query  641  KDENFKLVHAGP  676
            KDENFKL H GP
Sbjct  180  KDENFKLSHIGP  191



>gb|AHI54562.1| cyclophilin [Camellia japonica]
Length=262

 Score =   175 bits (443),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA+PF AL+N GSLS PRNL+ +K   S  +Y+ +     +   + +  S S  A     
Sbjct  1    MAVPFTALSNVGSLSGPRNLSQIK-PLSPAAYASINNVRKSALASDASLSSSLFAPPLRL  59

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
              L+  S+ S   K+G  L+ VRA+A+VAE QSKVT +VYFD+SIGNPVGK  GRIVIGL
Sbjct  60   SPLKCSSNTSSHRKTG-ILSSVRASAEVAELQSKVTQKVYFDVSIGNPVGKLVGRIVIGL  118

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQTAENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  119  YGDDVPQTAENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  178

Query  644  DENFKLVHAGP  676
            DENFKL H GP
Sbjct  179  DENFKLTHVGP  189



>ref|XP_011086840.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Sesamum indicum]
Length=256

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 143/191 (75%), Gaps = 8/191 (4%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA+ +A+L+N  S+S  R+L+P K +SS+CS++ L    SA  ++S  S   S +     
Sbjct  1    MAVSYASLSNISSVSAQRSLSPTKTTSSVCSFASLKLRKSAFSSSSFFSGSLSLSSLHLD  60

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
                      V+ ++G     VRA A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGL
Sbjct  61   R--------PVRSRAGPMSFSVRAMAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGL  112

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQTAENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  113  YGDDVPQTAENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  172

Query  644  DENFKLVHAGP  676
            DENFKL+H GP
Sbjct  173  DENFKLIHTGP  183



>ref|XP_002265030.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Vitis vinifera]
 emb|CBI38153.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 142/191 (74%), Gaps = 2/191 (1%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA     L+N GSLS PR++A +K     C+  KLPRS    + +SS SS   S  F   
Sbjct  1    MAASLTTLSNVGSLSSPRSVAQIKALGPTCNALKLPRSPFPSNVSSSSSSSFVSGSFRLV  60

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
                  + CS + ++G  L+ +RA+AQ A  QSKVT +VYFDISIGNPVGK  GRIVIGL
Sbjct  61   PLTSSLNPCSRR-RTGL-LSSLRASAQEAPLQSKVTQKVYFDISIGNPVGKVVGRIVIGL  118

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            +GD+VPQTAENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  119  FGDDVPQTAENFRALCTGEKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  178

Query  644  DENFKLVHAGP  676
            DENFKL H GP
Sbjct  179  DENFKLAHVGP  189



>ref|XP_011020813.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Populus euphratica]
Length=263

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 138/194 (71%), Gaps = 9/194 (5%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRN--LAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffs  277
            MA+ F  L N GSLS P+N  L    V S+ C+  + P  N      SS SS    +   
Sbjct  1    MAVSFTTLTNVGSLSTPQNTMLQVKSVRSTQCNAVRFPTRNVLPSNVSSSSSSCFFSGPL  60

Query  278  gslrlQKFSSCSVQV-KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIV  454
                  +F+S S    K  R L+ VRA+ +VAE QSKVT++VYFDI IGNPVG+  GR+V
Sbjct  61   ------RFASLSTSSPKKSRVLSSVRASTEVAELQSKVTNKVYFDIGIGNPVGRLVGRVV  114

Query  455  IGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGR  634
            IGL+GD+VPQT ENFRALCTGEKGFG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGR
Sbjct  115  IGLFGDDVPQTVENFRALCTGEKGFGYKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGR  174

Query  635  TFKDENFKLVHAGP  676
            TFKDENFKL H+GP
Sbjct  175  TFKDENFKLSHSGP  188



>ref|XP_002303772.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein 
[Populus trichocarpa]
 gb|EEE78751.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein 
[Populus trichocarpa]
Length=263

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 137/194 (71%), Gaps = 9/194 (5%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRN--LAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffs  277
            MA  F  L N GSLS P+N  L    V S+ C+  + P  N      SS SS    +   
Sbjct  1    MAASFTTLTNVGSLSTPQNTMLQVKSVRSTQCNAVRFPTRNVLPSNVSSSSSSFFFSGPL  60

Query  278  gslrlQKFSSCSVQV-KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIV  454
                  +F+S +    K  R L+ VRA+A+VAE QSKVT++VYFDI IGNPVG+  GR+V
Sbjct  61   ------RFASFTTSSPKKSRVLSSVRASAEVAELQSKVTNKVYFDIGIGNPVGRLVGRVV  114

Query  455  IGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGR  634
            IGLYGD+VPQT ENFRALCTGEKGFG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGR
Sbjct  115  IGLYGDDVPQTVENFRALCTGEKGFGYKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGR  174

Query  635  TFKDENFKLVHAGP  676
            TFKDENFKL H GP
Sbjct  175  TFKDENFKLSHIGP  188



>ref|XP_004228428.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Solanum lycopersicum]
Length=248

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 140/191 (73%), Gaps = 16/191 (8%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA  FA+++N GS+SVPR   P        +Y+  P+   +  ++SSL   S     S  
Sbjct  1    MAATFASVSNLGSISVPRVANP--------TYAAYPKLLKSSFSSSSLFGGSLRLDTS--  50

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
                  S+ SV  K+G     ++A  +VA+ QSKVT++VYFDISIGNPVGK AGRIVIGL
Sbjct  51   ------SNRSVHKKTGGSSGSIQAAVEVADLQSKVTNKVYFDISIGNPVGKLAGRIVIGL  104

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQTAENFRALCTGEKGFGFK S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  105  YGDDVPQTAENFRALCTGEKGFGFKDSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  164

Query  644  DENFKLVHAGP  676
            DENFKLVH GP
Sbjct  165  DENFKLVHTGP  175



>ref|XP_002299326.2| hypothetical protein POPTR_0001s13480g [Populus trichocarpa]
 gb|EEE84131.2| hypothetical protein POPTR_0001s13480g [Populus trichocarpa]
Length=263

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 139/194 (72%), Gaps = 9/194 (5%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRN-LAPVKV-SSSMCSYSKLPRSNSAEDTTsslssfsssaffs  277
            MA  F  L N GSL  P N ++ VK  SS+ C+  K P  N      SS SS    +   
Sbjct  1    MAASFTTLPNVGSLFSPINTMSRVKSGSSTACNAVKFPSRNLLPSNVSSSSSSLFFSGS-  59

Query  278  gslrlQKFSSCSVQV-KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIV  454
                  +F+S +    K  R L+ VRA+A+VAE QSKVT++VYFDI IGNPVGK  GRIV
Sbjct  60   -----LRFASVTTSSPKKSRVLSSVRASAEVAELQSKVTNKVYFDIGIGNPVGKLVGRIV  114

Query  455  IGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGR  634
            IGL+GD+VPQTAENFRALCTGEKGFGFK S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGR
Sbjct  115  IGLFGDDVPQTAENFRALCTGEKGFGFKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGR  174

Query  635  TFKDENFKLVHAGP  676
            TFKDENFKL H GP
Sbjct  175  TFKDENFKLSHIGP  188



>gb|EYU37403.1| hypothetical protein MIMGU_mgv1a012269mg [Erythranthe guttata]
Length=256

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 141/191 (74%), Gaps = 8/191 (4%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA+ +A+L+N  S+S PR+    K +S +CS++ +    SA          S S+  S S
Sbjct  1    MAVSYASLSNMSSISAPRSFPRAKAASPVCSFAPVNLRKSA--------ISSFSSSNSFS  52

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
                + SS  +  ++      VRA A+ A  QSKVT++VYFDISIGNPVGK AGRIVIGL
Sbjct  53   GGSFRLSSSRLASRTSSIPFSVRAMAEEATLQSKVTNKVYFDISIGNPVGKLAGRIVIGL  112

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQTAENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  113  YGDDVPQTAENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  172

Query  644  DENFKLVHAGP  676
            DENF+LVH GP
Sbjct  173  DENFQLVHTGP  183



>ref|XP_010090669.1| Peptidyl-prolyl cis-trans isomerase CYP20-2 [Morus notabilis]
 gb|EXB40333.1| Peptidyl-prolyl cis-trans isomerase CYP20-2 [Morus notabilis]
Length=261

 Score =   167 bits (422),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            RP + +RATA+VA  QSKVT++VYFDISIGNPVGK AGRIVIGLYGD+VPQTAENFRALC
Sbjct  74   RPFSSIRATAEVAPLQSKVTNKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTAENFRALC  133

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  134  TGEKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  188



>ref|XP_007043900.1| Peptidyl-prolyl cis-trans isomerase isoform 1 [Theobroma cacao]
 ref|XP_007043901.1| Peptidyl-prolyl cis-trans isomerase isoform 1 [Theobroma cacao]
 gb|EOX99731.1| Peptidyl-prolyl cis-trans isomerase isoform 1 [Theobroma cacao]
 gb|EOX99732.1| Peptidyl-prolyl cis-trans isomerase isoform 1 [Theobroma cacao]
Length=258

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 143/191 (75%), Gaps = 8/191 (4%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA PF+ L+N G LS  R+L+     S  C+  KLP        + S S   S+  FSGS
Sbjct  1    MAAPFSTLSNVGMLSGTRSLSKNPTLSPTCNAVKLP-----GKVSISSSISFSAGLFSGS  55

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
            LRL  F+S     ++ R L PVRA+A+VA  QSKVT +VY DISIGNP GK AGRIVIGL
Sbjct  56   LRLLPFTSSP---RNSRVLRPVRASAEVATLQSKVTHKVYLDISIGNPAGKVAGRIVIGL  112

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQTAENFRALCTGE+GFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  113  YGDDVPQTAENFRALCTGERGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  172

Query  644  DENFKLVHAGP  676
            DENFKL H GP
Sbjct  173  DENFKLSHTGP  183



>gb|KDP26847.1| hypothetical protein JCGZ_18005 [Jatropha curcas]
Length=260

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 141/194 (73%), Gaps = 12/194 (6%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRS---NSAEDTTsslssfsssaff  274
            MA  F  L N GSL  PRN++PVK  + +C+  KLP     +S+  +     S S ++  
Sbjct  1    MAASFTTLPNIGSLPGPRNVSPVKALNPVCNAVKLPGKVNVSSSPSSLFFAGSLSLASLT  60

Query  275  sgslrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIV  454
              S   Q+ +           L+ +RA+++VA+ QSKVT++VYFDIS+GNPV K  GRIV
Sbjct  61   ISSSSSQRKTHL---------LSSIRASSEVADLQSKVTNKVYFDISVGNPVPKLVGRIV  111

Query  455  IGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGR  634
            IGLYGD+VPQTAENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGR
Sbjct  112  IGLYGDDVPQTAENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGR  171

Query  635  TFKDENFKLVHAGP  676
            TFKDENFKL H GP
Sbjct  172  TFKDENFKLAHVGP  185



>ref|XP_010556115.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=254

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 141/195 (72%), Gaps = 20/195 (10%)
 Frame = +2

Query  104  MALPFAALANAGSLSV-PRNLAPVKVSSSMCSYSKLPRS---NSAEDTTsslssfsssaf  271
            MA  F  L+NA SLS  PR+    K+++  CS  +L +    NSA  +     S      
Sbjct  1    MAASFTTLSNARSLSAAPRSFTQPKIAAPTCSSLRLGKRFAFNSAMFSCQRSFSG-----  55

Query  272  fsgslrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRI  451
                      SSC V  ++ R  + V+A+++VA+ QSK+T +VYFDIS+GNPVGK AGRI
Sbjct  56   ----------SSCLVTSRTNRYFS-VQASSEVADVQSKITHKVYFDISVGNPVGKLAGRI  104

Query  452  VIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYG  631
            VIGLYGD+VPQTAENFRALCTG+KGFG+KGS+FHRVIKDFMIQGGDF+KGNGTGGKS+YG
Sbjct  105  VIGLYGDDVPQTAENFRALCTGDKGFGYKGSTFHRVIKDFMIQGGDFEKGNGTGGKSVYG  164

Query  632  RTFKDENFKLVHAGP  676
            RTFKDENFKL H+GP
Sbjct  165  RTFKDENFKLSHSGP  179



>ref|XP_002514874.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF47428.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=256

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 138/190 (73%), Gaps = 10/190 (5%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA PF  L N GS+  PRN+  VK  SS     K+ ++ +    +SS S FS S     +
Sbjct  1    MAAPFTTLPNVGSIPSPRNVPQVKALSSTFKAVKVSKATNVSYLSSSSSFFSGSFSSLTT  60

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
                K           R ++ +RAT++VA+ QSKVT++VYFDISIGNPV K AGRIVIGL
Sbjct  61   SSKHKT----------RFISSIRATSEVADLQSKVTNKVYFDISIGNPVPKLAGRIVIGL  110

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQTAENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  111  YGDDVPQTAENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  170

Query  644  DENFKLVHAG  673
            DENFKL H G
Sbjct  171  DENFKLAHTG  180



>ref|XP_010556114.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=277

 Score =   165 bits (417),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 141/195 (72%), Gaps = 20/195 (10%)
 Frame = +2

Query  104  MALPFAALANAGSLSV-PRNLAPVKVSSSMCSYSKLPRS---NSAEDTTsslssfsssaf  271
            MA  F  L+NA SLS  PR+    K+++  CS  +L +    NSA  +     S      
Sbjct  1    MAASFTTLSNARSLSAAPRSFTQPKIAAPTCSSLRLGKRFAFNSAMFSCQRSFSG-----  55

Query  272  fsgslrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRI  451
                      SSC V  ++ R  + V+A+++VA+ QSK+T +VYFDIS+GNPVGK AGRI
Sbjct  56   ----------SSCLVTSRTNRYFS-VQASSEVADVQSKITHKVYFDISVGNPVGKLAGRI  104

Query  452  VIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYG  631
            VIGLYGD+VPQTAENFRALCTG+KGFG+KGS+FHRVIKDFMIQGGDF+KGNGTGGKS+YG
Sbjct  105  VIGLYGDDVPQTAENFRALCTGDKGFGYKGSTFHRVIKDFMIQGGDFEKGNGTGGKSVYG  164

Query  632  RTFKDENFKLVHAGP  676
            RTFKDENFKL H+GP
Sbjct  165  RTFKDENFKLSHSGP  179



>ref|XP_008340246.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Malus domestica]
Length=259

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA P   L+N GSL   R+++ ++V +  CS   +P S+       +    SS    S  
Sbjct  1    MAAPLTTLSNVGSLPASRSVSQIRVLTPTCSSVTIPSSSH-----KTAXLSSSLFSRSSR  55

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
            L    FSS     K       VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGL
Sbjct  56   LSSLTFSSNPSSRKRTSLAGSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGL  115

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQT ENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  116  YGDDVPQTVENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  175

Query  644  DENFKLVHAGP  676
            DENFKL H GP
Sbjct  176  DENFKLSHTGP  186



>ref|XP_009372242.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Pyrus x bretschneideri]
Length=259

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA P A L+N GSL   R++  ++V +  CS   +P S        + S  SS    S  
Sbjct  1    MAAPLATLSNIGSLPASRSVCQIRVLTPTCSSVTIPSS-----PNKTASLSSSLFSRSSR  55

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
            L    FSS     K       VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGL
Sbjct  56   LSSLTFSSNPSSRKRTSLAGSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGL  115

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQT ENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  116  YGDDVPQTVENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  175

Query  644  DENFKLVHAGP  676
            DENFKL H GP
Sbjct  176  DENFKLSHTGP  186



>ref|XP_011036120.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Populus euphratica]
Length=263

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 136/194 (70%), Gaps = 9/194 (5%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRN-LAPVKVSSSMC-SYSKLPRSNSAEDTTsslssfsssaffs  277
            MA     L N GSL  P N ++ VK  SS   +  K P  N      SS SS    +   
Sbjct  1    MAASLTTLPNVGSLFSPINTMSRVKSGSSTAFNAVKFPSRNLLPSNVSSSSSSLFFSGS-  59

Query  278  gslrlQKFSSCSVQV-KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIV  454
                  +F+S +    K  R L+ VRA+A+VAE QSKVT++VYFDI IGNPVGK  GRIV
Sbjct  60   -----LRFASLTTSSPKKSRVLSSVRASAEVAELQSKVTNKVYFDIGIGNPVGKLVGRIV  114

Query  455  IGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGR  634
            IGLYGD+VPQTAENFRALCTGEKGFG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGR
Sbjct  115  IGLYGDDVPQTAENFRALCTGEKGFGYKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGR  174

Query  635  TFKDENFKLVHAGP  676
            TFKDENFKL H GP
Sbjct  175  TFKDENFKLSHIGP  188



>ref|XP_006363774.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Solanum tuberosum]
Length=248

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 136/191 (71%), Gaps = 16/191 (8%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA  FA ++N GS+SVPR   P        +Y+  P+   +  ++SSL   S     S  
Sbjct  1    MAATFATVSNLGSISVPRVANP--------TYAASPKLLKSSFSSSSLFGGSLRLETS--  50

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
                  S+ SV  K+G     ++A  +  + QSKVT +VYFDISIGNPVGK AGRIVIGL
Sbjct  51   ------SNRSVHRKTGGSSGSIQAAVEAVDLQSKVTHKVYFDISIGNPVGKLAGRIVIGL  104

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQTAENFRALCTGEKGFGFK S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  105  YGDDVPQTAENFRALCTGEKGFGFKDSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  164

Query  644  DENFKLVHAGP  676
            DENFKLVH GP
Sbjct  165  DENFKLVHTGP  175



>ref|XP_008390136.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Malus domestica]
Length=245

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 135/191 (71%), Gaps = 5/191 (3%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA P   L+N GS    R+++ +KV +  CS   +P S     +  + S  SS    S  
Sbjct  1    MAAPLTTLSNVGSPPASRSVSQIKVLTPTCSSVTVPSS-----SNKTASLSSSFFSRSSR  55

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
            L    FSS     K     + VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGL
Sbjct  56   LSPLTFSSNPSSGKRTSLASSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGL  115

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQT ENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  116  YGDDVPQTVENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  175

Query  644  DENFKLVHAGP  676
            DENFKL H GP
Sbjct  176  DENFKLSHTGP  186



>ref|XP_009792707.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Nicotiana sylvestris]
Length=248

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 128/192 (67%), Gaps = 18/192 (9%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLA-PVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsg  280
            MA  FA ++N GSLS PR  A P   S  +   S    S  +     + S          
Sbjct  1    MAATFATVSNLGSLSAPRAAANPTYASPKLVKSSFSSSSFFSGSLRLATSLNR-------  53

Query  281  slrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
                      SV  K+G     ++A  Q AE QSKVT +VYFDISIGNPVGK AGRIVIG
Sbjct  54   ----------SVLRKTGALSGSIQAAVQAAEVQSKVTHKVYFDISIGNPVGKLAGRIVIG  103

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            LYGD+VPQTAENFRALCTGEKGFG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTF
Sbjct  104  LYGDDVPQTAENFRALCTGEKGFGYKDSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTF  163

Query  641  KDENFKLVHAGP  676
            KDENFKL H GP
Sbjct  164  KDENFKLTHTGP  175



>ref|XP_010250635.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Nelumbo nucifera]
Length=261

 Score =   159 bits (403),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 138/192 (72%), Gaps = 5/192 (3%)
 Frame = +2

Query  104  MALPFAALANAGS-LSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsg  280
            MA  F ++AN G+ +S PR ++  KV S  C+  +L +  S  D +S  +  S S     
Sbjct  1    MATSFPSIANIGTRVSGPRTISQCKVISPSCNTLRLQKCTSPSDISSLSTFLSGSLLCPP  60

Query  281  slrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
                 + SS     +     +  RA+AQ A  QSKVT++VYFDISIGNPVGK AGRIVIG
Sbjct  61   L----RSSSFPSSQRRNAFFSSTRASAQEAPLQSKVTNKVYFDISIGNPVGKLAGRIVIG  116

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            L+GD+VPQTAENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTF
Sbjct  117  LFGDDVPQTAENFRALCTGEKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTF  176

Query  641  KDENFKLVHAGP  676
            KDENFKL H GP
Sbjct  177  KDENFKLSHIGP  188



>ref|XP_007223392.1| hypothetical protein PRUPE_ppa010146mg [Prunus persica]
 gb|EMJ24591.1| hypothetical protein PRUPE_ppa010146mg [Prunus persica]
Length=262

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 139/194 (72%), Gaps = 8/194 (4%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPR---SNSAEDTTsslssfsssaff  274
            MA P   L+N GSL   R+++ ++  +  C+   LP    S++ + T SS     SS   
Sbjct  1    MAAPLTTLSNVGSLPGSRSVSQIRALTPTCTSVTLPTIPLSSNKKATLSSSFLSRSSRLS  60

Query  275  sgslrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIV  454
              +     FSS     K    ++ VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIV
Sbjct  61   PLT-----FSSNPNSQKRASLVSSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIV  115

Query  455  IGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGR  634
            IGL+GD+VPQTAENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGR
Sbjct  116  IGLFGDDVPQTAENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGR  175

Query  635  TFKDENFKLVHAGP  676
            TFKDENFKL H GP
Sbjct  176  TFKDENFKLSHTGP  189



>ref|XP_006484168.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Citrus sinensis]
 gb|KDO81813.1| hypothetical protein CISIN_1g024818mg [Citrus sinensis]
Length=262

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  347  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  526
            VRA+A+VA+ QSKVT++VYFD+SIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKG
Sbjct  78   VRASAEVADLQSKVTNKVYFDVSIGNPVGKLAGRIVIGLYGDDVPQTAENFRALCTGEKG  137

Query  527  fgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  138  FGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHIGP  187



>ref|XP_009616511.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=248

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  347  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  526
            ++A  Q AE QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKG
Sbjct  66   IQAAVQAAEVQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTAENFRALCTGEKG  125

Query  527  fgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  126  FGYKDSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLTHTGP  175



>gb|KJB12528.1| hypothetical protein B456_002G023000 [Gossypium raimondii]
Length=259

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 141/191 (74%), Gaps = 7/191 (4%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA     L+N G LS PR     +  S+ C+    PR+      + S    SSS+ FSGS
Sbjct  1    MASSLTTLSNVGLLSSPRTPPKNQPISTSCNSFNFPRT-----LSLSPKISSSSSSFSGS  55

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
             R  +F+S   Q  + R    VRATA+VA  QSK+T++V+FD+SIGNPVGK AG+IVIGL
Sbjct  56   FRFPRFNS--PQTNNHRVRRSVRATAEVAPIQSKITNKVFFDVSIGNPVGKLAGKIVIGL  113

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            YGD+VPQT ENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  114  YGDDVPQTTENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  173

Query  644  DENFKLVHAGP  676
            DENFKL HAGP
Sbjct  174  DENFKLSHAGP  184



>gb|KHG17795.1| Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic -like 
protein [Gossypium arboreum]
Length=259

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +2

Query  317  QVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  496
            Q  + R    VRATA+VA  QSK+T++V+FDISIGNPVGK AG+IVIGLYGD+VPQT EN
Sbjct  65   QTNNHRVRRSVRATAEVAPIQSKITNKVFFDISIGNPVGKLAGKIVIGLYGDDVPQTTEN  124

Query  497  FRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL HAGP
Sbjct  125  FRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHAGP  184



>ref|XP_008222210.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Prunus mume]
Length=262

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 141/194 (73%), Gaps = 8/194 (4%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPR---SNSAEDTTsslssfsssaff  274
            MA P   L+N GSL   R+++ ++     C+   LP    S++ + T SS   F SS   
Sbjct  1    MAAPLTTLSNVGSLPGSRSVSQIRALIPTCTSVTLPTIPLSSNKKATLSSSFLFRSSRLS  60

Query  275  sgslrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIV  454
              +     FS+ + Q K    ++ VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIV
Sbjct  61   PLTF----FSNPNSQ-KRASLVSSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIV  115

Query  455  IGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGR  634
            IGL+GD+VPQTAENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGR
Sbjct  116  IGLFGDDVPQTAENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGR  175

Query  635  TFKDENFKLVHAGP  676
            TFKDENFKL H GP
Sbjct  176  TFKDENFKLSHTGP  189



>gb|KJB12529.1| hypothetical protein B456_002G023000 [Gossypium raimondii]
Length=263

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +2

Query  317  QVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  496
            Q  + R    VRATA+VA  QSK+T++V+FD+SIGNPVGK AG+IVIGLYGD+VPQT EN
Sbjct  69   QTNNHRVRRSVRATAEVAPIQSKITNKVFFDVSIGNPVGKLAGKIVIGLYGDDVPQTTEN  128

Query  497  FRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL HAGP
Sbjct  129  FRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHAGP  188



>ref|XP_006437971.1| hypothetical protein CICLE_v10032474mg [Citrus clementina]
 gb|ESR51211.1| hypothetical protein CICLE_v10032474mg [Citrus clementina]
Length=262

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  347  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  526
            V A+A+VA+ QSKVT++VYFD+SIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKG
Sbjct  78   VWASAEVADLQSKVTNKVYFDVSIGNPVGKLAGRIVIGLYGDDVPQTAENFRALCTGEKG  137

Query  527  fgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  138  FGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHIGP  187



>emb|CDP13378.1| unnamed protein product [Coffea canephora]
Length=257

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 134/192 (70%), Gaps = 9/192 (5%)
 Frame = +2

Query  104  MALPFAALANAGSLSVP-RNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsg  280
            MA+PFA L+N GS+S P R L P+K+S        LP+   A  T S+ S  +  +  S 
Sbjct  1    MAVPFATLSNVGSVSAPIRTLCPLKISRISIPSCCLPKRIPA--TVSTASHSTFLSGSSR  58

Query  281  slrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
                   S+  +  K G  L         A  QSKVT +VY DISIGNPVGK AGRIVIG
Sbjct  59   LTSSSNSSNPLLLSKRGAFLL------SEASLQSKVTHKVYLDISIGNPVGKLAGRIVIG  112

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            LYGD+VPQTAENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTF
Sbjct  113  LYGDDVPQTAENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTF  172

Query  641  KDENFKLVHAGP  676
            KDENFKL H GP
Sbjct  173  KDENFKLSHTGP  184



>ref|XP_010025286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Eucalyptus grandis]
 gb|KCW61909.1| hypothetical protein EUGRSUZ_H04606 [Eucalyptus grandis]
Length=257

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 134/195 (69%), Gaps = 15/195 (8%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSK----LPRSNSAEDTTsslssfsssaf  271
            MA  F AL+N GSLS PRN + ++     CS +     LP       ++SS  S S    
Sbjct  1    MAASFTALSNVGSLSSPRNGSEIRRFGPSCSVAASVRPLPLKAGLSASSSSSFSGSLRPI  60

Query  272  fsgslrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRI  451
               S   +K   CSV           RA+A+ A  QSKVT++VY DISIGNPVGK  GRI
Sbjct  61   PLSSSPQRKSRPCSV-----------RASAEAAAAQSKVTNKVYLDISIGNPVGKLVGRI  109

Query  452  VIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYG  631
            VIGLYGD+VPQTAENFRALCTGEKGFG+KGS+ HRVIKDFMIQGGDFDKGNGTGGKSIYG
Sbjct  110  VIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHRVIKDFMIQGGDFDKGNGTGGKSIYG  169

Query  632  RTFKDENFKLVHAGP  676
            RTFKDENFKL H GP
Sbjct  170  RTFKDENFKLSHVGP  184



>ref|XP_010492057.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Camelina sativa]
Length=256

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            VAEPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  78   VAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  137

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVIKDFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  138  TFHRVIKDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGP  181



>ref|XP_010453368.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Camelina sativa]
Length=259

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVIKDFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  141  TFHRVIKDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGP  184



>ref|XP_010419878.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Camelina sativa]
Length=259

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVIKDFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  141  TFHRVIKDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGP  184



>ref|XP_003569145.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Brachypodium distachyon]
Length=242

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +    A  + AE QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALC
Sbjct  55   RFVTSASAEPKAAELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVENFRALC  114

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  115  TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  169



>ref|XP_008778781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like, partial 
[Phoenix dactylifera]
Length=264

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  323  KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  502
            +S R     RA  + AE QSKVT++V+FDISIGNPVGK  GRIVIGLYGD+VPQTAENFR
Sbjct  71   RSARYTTSARAELKEAELQSKVTNKVFFDISIGNPVGKLVGRIVIGLYGDDVPQTAENFR  130

Query  503  ALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            ALCTGEKGFG+KGS FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+L H GP
Sbjct  131  ALCTGEKGFGYKGSMFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFRLSHVGP  188



>ref|XP_009343126.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=259

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  347  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  526
            VRA+A+    QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+VPQT ENFRALCTG+KG
Sbjct  77   VRASAEEVTLQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGDKG  136

Query  527  fgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  137  FGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHTGP  186



>ref|XP_004310109.1| PREDICTED: photosynthetic NDH subunit of lumenal location 5, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=254

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R ++ VRA+A+    Q KVT++VYFDISIGNPVGK AGR+VIGL+GD+VPQT ENFR+LC
Sbjct  67   RTISSVRASAEEPALQGKVTNKVYFDISIGNPVGKLAGRVVIGLFGDDVPQTVENFRSLC  126

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL+H GP
Sbjct  127  TGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLLHTGP  181



>ref|XP_002439092.1| hypothetical protein SORBIDRAFT_09g000350 [Sorghum bicolor]
 gb|EES17522.1| hypothetical protein SORBIDRAFT_09g000350 [Sorghum bicolor]
Length=249

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 5/113 (4%)
 Frame = +2

Query  353  ATAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            AT+  AEP     QSK+T++VYFDISIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTG
Sbjct  64   ATSASAEPKEADLQSKITNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTAENFRALCTG  123

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKGFG+KGSSFHRVI DFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  124  EKGFGYKGSSFHRVISDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  176



>ref|XP_002873599.1| hypothetical protein ARALYDRAFT_488128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49858.1| hypothetical protein ARALYDRAFT_488128 [Arabidopsis lyrata subsp. 
lyrata]
Length=278

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V+EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VSEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVI+DFMIQGGDFDKGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  141  TFHRVIRDFMIQGGDFDKGNGTGGKSVYGRTFKDENFKLSHVGP  184



>ref|XP_004960938.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
isoform X2 [Setaria italica]
Length=253

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+ QSKVT++VYFDISIGNPVGK  GRIVIGL+GD+VPQTAENFRALCTGEKGFG+KGSS
Sbjct  78   ADIQSKVTNKVYFDISIGNPVGKNVGRIVIGLFGDDVPQTAENFRALCTGEKGFGYKGSS  137

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  138  FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  180



>ref|NP_001190299.1| peptidyl-prolyl cis-trans isomerase CYP20-2 [Arabidopsis thaliana]
 gb|AED91853.1| peptidyl-prolyl cis-trans isomerase CYP20-2 [Arabidopsis thaliana]
Length=255

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  77   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  136

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  137  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGP  180



>gb|EPS61726.1| peptidyl-prolyl cis-trans isomerase, partial [Genlisea aurea]
Length=167

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +2

Query  347  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  526
            VRA A+VA  QSKVT++VY DISIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKG
Sbjct  64   VRAAAEVASLQSKVTTKVYLDISIGNPVGKPAGRIVIGLYGDDVPQTAENFRALCTGEKG  123

Query  527  fgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFK  658
            FG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK
Sbjct  124  FGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK  167



>gb|AAM65904.1| peptidylprolyl isomerase-like protein [Arabidopsis thaliana]
Length=259

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  141  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGP  184



>ref|NP_196816.1| peptidyl-prolyl cis-trans isomerase CYP20-2 [Arabidopsis thaliana]
 sp|Q9ASS6.1|PNSL5_ARATH RecName: Full=Photosynthetic NDH subunit of lumenal location 
5, chloroplastic; AltName: Full=Cyclophilin of 20 kDa 2; AltName: 
Full=Peptidyl-prolyl cis-trans isomerase CYP20-2; Short=PPIase 
CYP20-2; AltName: Full=Rotamase CYP20-2; AltName: Full=Thylakoid 
lumen PPIase of 20 kDa; Short=TLP20; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32894.1|AF367307_1 AT5g13120/T19L5_80 [Arabidopsis thaliana]
 gb|AAL15377.1| AT5g13120/T19L5_80 [Arabidopsis thaliana]
 gb|AAS75300.1| thylakoid lumen single domain cyclophilin type peptidyl-prolyl 
cis-trans isomerase [Arabidopsis thaliana]
 gb|AED91852.1| peptidyl-prolyl cis-trans isomerase CYP20-2 [Arabidopsis thaliana]
Length=259

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  141  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGP  184



>gb|AFW75093.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=251

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 5/113 (4%)
 Frame = +2

Query  353  ATAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            AT+  AEP     QSK+T++VYFDISIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTG
Sbjct  66   ATSASAEPKEADLQSKITNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTAENFRALCTG  125

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKGFG+KGSSFHRVI DFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  126  EKGFGYKGSSFHRVISDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  178



>ref|XP_009131319.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Brassica rapa]
Length=257

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 126/177 (71%), Gaps = 10/177 (6%)
 Frame = +2

Query  146  SVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgslrlQKFSSCSVQVK  325
            + PR L+P+  +S++ S S    + S  D+    S  +SS     S   +     SVQ  
Sbjct  16   AAPRRLSPINNTSALSSTSFRLNTKSTFDSIKFPSLIASSLLLHTSSTKRNRRCLSVQ-S  74

Query  326  SGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRA  505
            S  PLA         EPQSK+T +VYFDIS+GNPVGK AGRIVIGL+GD+VPQT ENFRA
Sbjct  75   SAEPLA---------EPQSKITHKVYFDISVGNPVGKLAGRIVIGLFGDDVPQTVENFRA  125

Query  506  LCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            LCTGEKGFG+KGS+FHRVI+DFMIQGGDFDKGNGTGGKS+YGRTFKDENF L H GP
Sbjct  126  LCTGEKGFGYKGSTFHRVIRDFMIQGGDFDKGNGTGGKSVYGRTFKDENFNLSHVGP  182



>ref|XP_004960937.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
isoform X1 [Setaria italica]
Length=294

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+ QSKVT++VYFDISIGNPVGK  GRIVIGL+GD+VPQTAENFRALCTGEKGFG+KGSS
Sbjct  78   ADIQSKVTNKVYFDISIGNPVGKNVGRIVIGLFGDDVPQTAENFRALCTGEKGFGYKGSS  137

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  138  FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  180



>ref|NP_001149265.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|ACG34782.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|AFW82939.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=248

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            AE QSK+T++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGSS
Sbjct  73   AELQSKITNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTTENFRALCTGEKGFGYKGSS  132

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVI DFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  133  FHRVISDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  175



>emb|CAC05440.1| peptidylprolyl isomerase-like protein [Arabidopsis thaliana]
Length=259

 Score =   149 bits (375),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  141  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGP  184



>ref|NP_001054392.1| Os05g0103200 [Oryza sativa Japonica Group]
 gb|AAS88825.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAF16306.1| Os05g0103200 [Oryza sativa Japonica Group]
 gb|EAY96206.1| hypothetical protein OsI_18093 [Oryza sativa Indica Group]
 dbj|BAG96494.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88005.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96717.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62007.1| hypothetical protein OsJ_16789 [Oryza sativa Japonica Group]
Length=250

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            QSK+T++VYFDISIGNPVGK  GR+VIGLYGD+VPQTAENFRALCTGEKGFG+KGSSFHR
Sbjct  78   QSKITNKVYFDISIGNPVGKNVGRVVIGLYGDDVPQTAENFRALCTGEKGFGYKGSSFHR  137

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  138  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  177



>gb|AAP44537.1| cyclophilin-like protein [Triticum aestivum]
Length=245

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +A   A     E QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALC
Sbjct  58   RFVASASAEPYAPELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVENFRALC  117

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LVH GP
Sbjct  118  TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGP  172



>dbj|BAJ90691.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=243

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  305  SCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQ  484
            S S+Q ++ R +A   A     E QSKVT++VYFDI+IGNPVGK  GRIVIGLYGD+VPQ
Sbjct  48   SVSLQTRA-RFVASASAEPYAPELQSKVTNKVYFDINIGNPVGKNVGRIVIGLYGDDVPQ  106

Query  485  TAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLV  664
            T ENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LV
Sbjct  107  TVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLV  166

Query  665  HAGP  676
            H GP
Sbjct  167  HTGP  170



>emb|CDX78508.1| BnaA03g04200D [Brassica napus]
Length=256

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +2

Query  323  KSGRPLAPVRATAQ-VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  499
            K  R    V+++A+ +AEPQSK+T +VYFDIS+GNPVGK AGRIVIGL+GD+VPQT ENF
Sbjct  63   KRNRRCLSVQSSAEPLAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLFGDDVPQTVENF  122

Query  500  RALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            RALCTGEKGFG+KGS+FHRVI+DFMIQGGDFDKGNGTGGKS+YGRTFKDENF L H GP
Sbjct  123  RALCTGEKGFGYKGSTFHRVIRDFMIQGGDFDKGNGTGGKSVYGRTFKDENFNLSHVGP  181



>ref|XP_008459881.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Cucumis melo]
Length=250

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +2

Query  347  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  526
            VRA+A+V   Q+KVT++VYFD+SIGNPVGK AGRIVIGL+GD+VP+TAENFRALCTGEKG
Sbjct  68   VRASAEVPPLQAKVTNKVYFDVSIGNPVGKLAGRIVIGLFGDDVPKTAENFRALCTGEKG  127

Query  527  fgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GP
Sbjct  128  FGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGP  177



>gb|ABO37960.1| peptidylprolyl isomerase [Triticum aestivum]
Length=245

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +2

Query  317  QVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  496
            Q    R +A   A     E QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT EN
Sbjct  53   QQSRARFVASASAEPYAPELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVEN  112

Query  497  FRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LVH GP
Sbjct  113  FRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGP  172



>ref|XP_006653937.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Oryza brachyantha]
Length=246

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+ QSK+T++VYFDISIGNPVG+  GR+VIGLYGD+VPQTAENFRALCTGEKGFG+KGSS
Sbjct  71   ADLQSKITNKVYFDISIGNPVGRNVGRVVIGLYGDDVPQTAENFRALCTGEKGFGYKGSS  130

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  131  FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  173



>emb|CDX70495.1| BnaC03g05790D [Brassica napus]
Length=257

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = +2

Query  332  RPLAPVRATAQ-VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRAL  508
            R    V+++A+ +AEPQSK+T +VYFDIS+GNPVGK AGRIVIGL+GD+VPQT ENFRAL
Sbjct  67   RSCLSVQSSAEPLAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLFGDDVPQTVENFRAL  126

Query  509  CTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            CTGEKGFG+KGS+FHRVI+DFMIQGGDFDKGNGTGGKS+YGRTFKDENF L H GP
Sbjct  127  CTGEKGFGYKGSTFHRVIRDFMIQGGDFDKGNGTGGKSVYGRTFKDENFNLSHVGP  182



>gb|KCW61911.1| hypothetical protein EUGRSUZ_H04606 [Eucalyptus grandis]
Length=188

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 130/189 (69%), Gaps = 15/189 (8%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSK----LPRSNSAEDTTsslssfsssaf  271
            MA  F AL+N GSLS PRN + ++     CS +     LP       ++SS  S S    
Sbjct  1    MAASFTALSNVGSLSSPRNGSEIRRFGPSCSVAASVRPLPLKAGLSASSSSSFSGSLRPI  60

Query  272  fsgslrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRI  451
               S   +K   CSV           RA+A+ A  QSKVT++VY DISIGNPVGK  GRI
Sbjct  61   PLSSSPQRKSRPCSV-----------RASAEAAAAQSKVTNKVYLDISIGNPVGKLVGRI  109

Query  452  VIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYG  631
            VIGLYGD+VPQTAENFRALCTGEKGFG+KGS+ HRVIKDFMIQGGDFDKGNGTGGKSIYG
Sbjct  110  VIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHRVIKDFMIQGGDFDKGNGTGGKSIYG  169

Query  632  RTFKDENFK  658
            RTFKDENFK
Sbjct  170  RTFKDENFK  178



>ref|XP_009390393.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=249

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  350  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  529
            RA  + AE QSKVT++VYFDISIGNPVGK  GRIVIGL+GD+ PQTAENFRALCTGEKGF
Sbjct  68   RAELKEAEVQSKVTTKVYFDISIGNPVGKDVGRIVIGLFGDDCPQTAENFRALCTGEKGF  127

Query  530  gfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            G+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  128  GYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHLGP  176



>ref|XP_010912997.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Elaeis guineensis]
Length=258

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R     RA  + AE QSKVT++V+FDISIGNPVG   GRIVIGLYGD+VPQTAENFRALC
Sbjct  71   RYATSARAELKEAELQSKVTNKVFFDISIGNPVGNLVGRIVIGLYGDDVPQTAENFRALC  130

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKGFG+KGS+FHRVIK+FMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  131  TGEKGFGYKGSAFHRVIKEFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHLGP  185



>gb|KCW61910.1| hypothetical protein EUGRSUZ_H04606 [Eucalyptus grandis]
Length=196

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 130/189 (69%), Gaps = 15/189 (8%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSK----LPRSNSAEDTTsslssfsssaf  271
            MA  F AL+N GSLS PRN + ++     CS +     LP       ++SS  S S    
Sbjct  1    MAASFTALSNVGSLSSPRNGSEIRRFGPSCSVAASVRPLPLKAGLSASSSSSFSGSLRPI  60

Query  272  fsgslrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRI  451
               S   +K   CSV           RA+A+ A  QSKVT++VY DISIGNPVGK  GRI
Sbjct  61   PLSSSPQRKSRPCSV-----------RASAEAAAAQSKVTNKVYLDISIGNPVGKLVGRI  109

Query  452  VIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYG  631
            VIGLYGD+VPQTAENFRALCTGEKGFG+KGS+ HRVIKDFMIQGGDFDKGNGTGGKSIYG
Sbjct  110  VIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHRVIKDFMIQGGDFDKGNGTGGKSIYG  169

Query  632  RTFKDENFK  658
            RTFKDENFK
Sbjct  170  RTFKDENFK  178



>ref|XP_008648685.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Zea mays]
Length=301

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 5/113 (4%)
 Frame = +2

Query  353  ATAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            AT+  AEP     QSK+T++VYFDISIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTG
Sbjct  116  ATSASAEPKEADLQSKITNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTAENFRALCTG  175

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKGFG+KGSSFHRVI DFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GP
Sbjct  176  EKGFGYKGSSFHRVISDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGP  228



>gb|KFK25546.1| hypothetical protein AALP_AA8G128900 [Arabis alpina]
Length=253

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +2

Query  347  VRATAQVA-EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEk  523
            V++ A+V  EPQSK+T +VY DIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEK
Sbjct  68   VQSNAEVVIEPQSKITHKVYLDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEK  127

Query  524  gfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            GFG+KGS+FHRVIKDFMIQGGDF+KGNGTGGKS+YG+TFKDENFKL H GP
Sbjct  128  GFGYKGSTFHRVIKDFMIQGGDFEKGNGTGGKSVYGKTFKDENFKLSHVGP  178



>emb|CAN82436.1| hypothetical protein VITISV_040459 [Vitis vinifera]
Length=180

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            QSKVT +VYFDISIGNPVGK  GRIVIGL+GD+VPQTAENFRALCTGEKGFG+KGS+FHR
Sbjct  8    QSKVTQKVYFDISIGNPVGKVVGRIVIGLFGDDVPQTAENFRALCTGEKGFGYKGSTFHR  67

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  68   VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLAHVGP  107



>gb|AAP44535.1| cyclophilin-like protein [Triticum aestivum]
Length=245

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 111/142 (78%), Gaps = 15/142 (11%)
 Frame = +2

Query  296  KFSSCSVQVKSGRPLAPVRATAQ----------VAEP-----QSKVTSQVYFDISIGNPV  430
            K  S ++ ++ GR  +P  + +Q           AEP     QSKVT++VYFDISIGNPV
Sbjct  31   KVPSSALSLRGGRVASPALSVSQQSRARFVASASAEPYAPELQSKVTNKVYFDISIGNPV  90

Query  431  GKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngt  610
            GK  GRIVIGLYGD+VPQT ENFRALC GEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGT
Sbjct  91   GKNVGRIVIGLYGDDVPQTVENFRALCAGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGT  150

Query  611  ggkSIYGRTFKDENFKLVHAGP  676
            GGKSIYGRTFKDENF+LVH GP
Sbjct  151  GGKSIYGRTFKDENFQLVHTGP  172



>ref|XP_004140542.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004170245.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46438.1| hypothetical protein Csa_6G093090 [Cucumis sativus]
Length=250

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  347  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  526
            VRA+A+V   Q+KVT++VYFD+SIGNPVGK AGRIVIGL+GD+VP+TAENFRALCTGEKG
Sbjct  68   VRASAEVPPLQAKVTNKVYFDVSIGNPVGKLAGRIVIGLFGDDVPKTAENFRALCTGEKG  127

Query  527  fgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FGFKGS FHRVI+DFMIQGGDF+KGNGTGGKSIYGRTFKDENF L H GP
Sbjct  128  FGFKGSVFHRVIEDFMIQGGDFEKGNGTGGKSIYGRTFKDENFNLSHTGP  177



>ref|XP_003556583.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
isoform 1 [Glycine max]
Length=253

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 108/136 (79%), Gaps = 10/136 (7%)
 Frame = +2

Query  299  FSSCS---VQVKS----GRPLAPVRATAQVAEP---QSKVTSQVYFDISIGNPVGKAAGR  448
            F  CS   V V+     GR    VRA++   E    QSKVT +V+FD+SIGNPVGK  GR
Sbjct  45   FGGCSGVAVGVRERKGIGRVRVRVRASSSSDEAVSAQSKVTQKVFFDVSIGNPVGKLVGR  104

Query  449  IVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIY  628
            IVIGLYGD+VPQTAENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIY
Sbjct  105  IVIGLYGDDVPQTAENFRALCTGEKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIY  164

Query  629  GRTFKDENFKLVHAGP  676
            GRTFKDENF L H GP
Sbjct  165  GRTFKDENFNLSHTGP  180



>ref|XP_006288490.1| hypothetical protein CARUB_v10001755mg [Capsella rubella]
 gb|EOA21388.1| hypothetical protein CARUB_v10001755mg [Capsella rubella]
Length=259

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            VAEPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YG  FKDENFKL H GP
Sbjct  141  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGSRFKDENFKLSHVGP  184



>ref|XP_006399800.1| hypothetical protein EUTSA_v10014434mg [Eutrema salsugineum]
 gb|ESQ41253.1| hypothetical protein EUTSA_v10014434mg [Eutrema salsugineum]
Length=260

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            + EPQSK+T +VY DIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  82   LTEPQSKITHKVYLDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  141

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GP
Sbjct  142  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGP  185



>gb|ACU19042.1| unknown [Glycine max]
Length=253

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 108/136 (79%), Gaps = 10/136 (7%)
 Frame = +2

Query  299  FSSCS---VQVKS----GRPLAPVRATAQVAEP---QSKVTSQVYFDISIGNPVGKAAGR  448
            F  CS   V V+     GR    VRA++   E    QSKVT +V+FD+SIGNPVGK  GR
Sbjct  45   FGGCSGVAVGVRERKGIGRVRVRVRASSSSDEAVSAQSKVTQKVFFDVSIGNPVGKLVGR  104

Query  449  IVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIY  628
            IVIGLYGD+VPQTAENFRALCTGEKGFG+KGS+FHRVIK+FMIQGGDFDKGNGTGGKSIY
Sbjct  105  IVIGLYGDDVPQTAENFRALCTGEKGFGYKGSTFHRVIKNFMIQGGDFDKGNGTGGKSIY  164

Query  629  GRTFKDENFKLVHAGP  676
            GRTFKDENF L H GP
Sbjct  165  GRTFKDENFNLSHTGP  180



>gb|KHN37252.1| Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic [Glycine 
soja]
Length=250

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            QSKVT +VYFD+SIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTGEKGFG+KGS+ HR
Sbjct  78   QSKVTQKVYFDVSIGNPVGKFVGRIVIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHR  137

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GP
Sbjct  138  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGP  177



>ref|XP_010682710.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=257

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 130/205 (63%), Gaps = 37/205 (18%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNL--APVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffs  277
            MA  FA  AN  S+S  +++  A   V+S+  S  KLPRS  +                 
Sbjct  1    MAASFATQANVTSISSKKDVISANSVVNSAARSSLKLPRSPLSSSN--------------  46

Query  278  gslrlQKFSSCSVQVKSGRP---------LAPVRATA----QVAEPQSKVTSQVYFDISI  418
                    S C V  K   P         L  VRA+A    Q    QSKVT++VYFDIS+
Sbjct  47   --------SFCCVSFKCSSPSSLHRKPNFLTSVRASAESNLQETPLQSKVTNKVYFDISV  98

Query  419  GNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdk  598
            GNPVGK AGRIVIGL+GD+VP+T ENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDK
Sbjct  99   GNPVGKLAGRIVIGLFGDDVPRTTENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDK  158

Query  599  gngtggkSIYGRTFKDENFKLVHAG  673
            GNGTGGKSIYGRTFKDENF L H G
Sbjct  159  GNGTGGKSIYGRTFKDENFNLSHIG  183



>dbj|BAJ87839.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +2

Query  305  SCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQ  484
            S S+Q ++ R +A   A     E QSKVT++VYFDI+IGNPVGK   RIVIGLYGD+VPQ
Sbjct  84   SVSLQTRA-RFVASASAEPYAPELQSKVTNKVYFDINIGNPVGKNVRRIVIGLYGDDVPQ  142

Query  485  TAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLV  664
            T ENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LV
Sbjct  143  TVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLV  202

Query  665  HAGP  676
            H GP
Sbjct  203  HTGP  206



>ref|XP_003536816.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Glycine max]
Length=251

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            QSKVT +VYFD+SIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTGEKGFG+KGS+ HR
Sbjct  79   QSKVTQKVYFDVSIGNPVGKFVGRIVIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHR  138

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GP
Sbjct  139  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGP  178



>ref|XP_010929720.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like, 
partial [Elaeis guineensis]
Length=210

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  350  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  529
            RA  + AE QSKVT++V+FDISIGNP G   GRIVIGLYGD+VPQTAENFR LCTGEKGF
Sbjct  29   RAELKEAELQSKVTNKVFFDISIGNPEGNVVGRIVIGLYGDDVPQTAENFRVLCTGEKGF  88

Query  530  gfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            G+KGS+FHR+I+DFMIQGGDF+KGNGTGGKSIYGRTF+DENFKL H GP
Sbjct  89   GYKGSAFHRIIQDFMIQGGDFEKGNGTGGKSIYGRTFRDENFKLSHVGP  137



>ref|XP_004497425.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Cicer arietinum]
Length=253

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 98/119 (82%), Gaps = 4/119 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEP----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  499
            R    VRA +  +E     QSKVT +VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENF
Sbjct  62   RKTMKVRAGSSSSEEEVIVQSKVTHKVYFDISIGNPVGKLVGRIVIGLYGDDVPQTVENF  121

Query  500  RALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            RALCTGEKGFG+K SSFHRVI  FMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  122  RALCTGEKGFGYKASSFHRVINQFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHTGP  180



>gb|EMT15783.1| Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic [Aegilops 
tauschii]
Length=462

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +2

Query  371  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssf  550
            E QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGSSF
Sbjct  34   ELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGSSF  93

Query  551  HRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            HRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LVH GP
Sbjct  94   HRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGP  135



>ref|XP_009628829.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=185

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            +A   AT  VAE QSKVT +VYFDISIGNP GK AGRIVIGLYGD+VP TA+NFRALCTG
Sbjct  1    MAATFATV-VAEVQSKVTHKVYFDISIGNPDGKLAGRIVIGLYGDDVPVTAKNFRALCTG  59

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            E GFG+K S+FHRVI++FMIQGGDFDKGNG GGKSIYGRTF+DENFKL H GP
Sbjct  60   ENGFGYKDSAFHRVIRNFMIQGGDFDKGNGIGGKSIYGRTFEDENFKLTHTGP  112



>gb|AGV54525.1| peptidyl-prolyl cis-trans isomerase [Phaseolus vulgaris]
Length=253

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R  A   ++ + A  Q+KVT +V+FDI IGNPVGK  GR+VIGLYGD+VPQTAENFRALC
Sbjct  66   RVRASSSSSGEDAIVQAKVTQKVFFDIGIGNPVGKLVGRVVIGLYGDDVPQTAENFRALC  125

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GP
Sbjct  126  TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFVLSHTGP  180



>ref|XP_007142599.1| hypothetical protein PHAVU_007G001100g [Phaseolus vulgaris]
 gb|ESW14593.1| hypothetical protein PHAVU_007G001100g [Phaseolus vulgaris]
Length=265

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R  A   ++ + A  Q+KVT +V+FDI IGNPVGK  GR+VIGLYGD+VPQTAENFRALC
Sbjct  78   RVRASSSSSGEDAIVQAKVTQKVFFDIGIGNPVGKLVGRVVIGLYGDDVPQTAENFRALC  137

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GP
Sbjct  138  TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFVLSHTGP  192



>gb|AFK36387.1| unknown [Medicago truncatula]
 gb|KEH44554.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
 gb|KEH44555.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=244

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            QSKVT +V+FD+SIGNPVGK  GRIVIGL+GD+VPQT ENFRAL TGEKGFG+K S+FHR
Sbjct  72   QSKVTHKVFFDVSIGNPVGKLVGRIVIGLFGDDVPQTVENFRALSTGEKGFGYKSSTFHR  131

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GP
Sbjct  132  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGP  171



>gb|ACJ85448.1| unknown [Medicago truncatula]
Length=244

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            QSKVT +V+FD+SIGNPVGK  GRIVIGL+GD+VPQT ENFRAL TGEKGFG+K S+FHR
Sbjct  72   QSKVTHKVFFDVSIGNPVGKLVGRIVIGLFGDDVPQTVENFRALSTGEKGFGYKSSTFHR  131

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GP
Sbjct  132  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGP  171



>ref|XP_009404751.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 97/109 (89%), Gaps = 4/109 (4%)
 Frame = +2

Query  350  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  529
            RA  +V++ QS VT++V+FDISIG  VG    RIVIGLYGD+VPQTAENFRALCTGEKGF
Sbjct  69   RAELKVSDLQSTVTTKVFFDISIGGHVG----RIVIGLYGDDVPQTAENFRALCTGEKGF  124

Query  530  gfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            G+KGS+FHRVIKDFMIQGGDFD+GNGTGGKSIYGRTFKDENFKL H GP
Sbjct  125  GYKGSAFHRVIKDFMIQGGDFDQGNGTGGKSIYGRTFKDENFKLTHLGP  173



>ref|XP_006844622.1| hypothetical protein AMTR_s00016p00225920 [Amborella trichopoda]
 gb|ERN06297.1| hypothetical protein AMTR_s00016p00225920 [Amborella trichopoda]
Length=252

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 4/113 (4%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
             + VRA A   E Q+KVT +VYFDI+IG PVG    RI++GL+GDEVPQT ENF+ALCTG
Sbjct  71   FSSVRAEATSPELQAKVTKKVYFDITIGKPVG----RILMGLFGDEVPQTVENFKALCTG  126

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GP
Sbjct  127  EKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLAHLGP  179



>emb|CCI55395.1| NDH subunit PnsL5 [Marchantia polymorpha]
Length=252

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 92/110 (84%), Gaps = 3/110 (3%)
 Frame = +2

Query  347  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  526
            VRA A   E Q+KVT++VYFDI IG   GK AG+I++GL+GD VP+TAENFRALCTGEKG
Sbjct  75   VRAMASEKEYQAKVTNKVYFDIEIG---GKPAGKIILGLFGDVVPKTAENFRALCTGEKG  131

Query  527  fgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FGFKGS+FHRVIKDFMIQGGDF  GNGTGGKSIYG  F DENFKL H GP
Sbjct  132  FGFKGSAFHRVIKDFMIQGGDFTAGNGTGGKSIYGNKFADENFKLTHTGP  181



>gb|ABK21441.1| unknown [Picea sitchensis]
Length=261

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 3/109 (3%)
 Frame = +2

Query  350  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  529
            RA +Q A  QSKVTS+ +FDI IG   G  AGRIV+GL+G++VP+T ENFRALCTGEKGF
Sbjct  85   RAMSQDAAFQSKVTSKCFFDIEIG---GAPAGRIVLGLFGEDVPKTTENFRALCTGEKGF  141

Query  530  gfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            G+KGSSFHR+IKDFM+QGGDFD+ +GTGGKSIYGRTF+DENFKL H GP
Sbjct  142  GYKGSSFHRIIKDFMLQGGDFDREDGTGGKSIYGRTFEDENFKLTHVGP  190



>ref|XP_006290277.1| hypothetical protein CARUB_v10017856mg [Capsella rubella]
 gb|EOA23175.1| hypothetical protein CARUB_v10017856mg [Capsella rubella]
Length=262

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
            ++FS      K  R  A V+A A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  61   KQFSGVCATTKHQRT-ACVKAMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  116

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            L+GD VP+T ENFR LCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  117  LFGDVVPKTVENFRVLCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  176

Query  641  KDENFKLVHAGP  676
            +DENF L H GP
Sbjct  177  EDENFTLKHTGP  188



>ref|NP_001190159.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
 gb|AEE80299.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
Length=259

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 98/130 (75%), Gaps = 5/130 (4%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRP--LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLY  466
            ++FS      K  R   +  + A  +V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+
Sbjct  59   KQFSGVYATTKHQRTACVKSMAAEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMGLF  115

Query  467  GDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKD  646
            G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F+D
Sbjct  116  GEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFED  175

Query  647  ENFKLVHAGP  676
            ENF L H GP
Sbjct  176  ENFTLKHTGP  185



>gb|AAM63944.1| peptidylprolyl isomerase ROC4 [Arabidopsis thaliana]
Length=260

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  59   KQFSGVYATTKHQRT-ACVKSMAAEEEEVTEPQAKVTNKVYFDVEIG---GEVAGRIVMG  114

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  115  LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  174

Query  641  KDENFKLVHAGP  676
            +DENF L H GP
Sbjct  175  EDENFTLKHTGP  186



>gb|KEH43161.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=251

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 91/108 (84%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            ++A  A+ Q+KVTS+V+FD+ IG   G++AGRIVIGL+GD VP+T ENFRALCTGEKG+G
Sbjct  72   SSANAADLQAKVTSKVFFDVVIG---GESAGRIVIGLFGDVVPKTVENFRALCTGEKGYG  128

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +K S+FHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  129  YKDSTFHRIIKDFMIQGGDFTEGNGTGGVSIYGGKFEDENFALKHVGP  176



>ref|XP_002876654.1| hypothetical protein ARALYDRAFT_486711 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52913.1| hypothetical protein ARALYDRAFT_486711 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  41   KQFSGVHASTKHQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  96

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  97   LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  156

Query  641  KDENFKLVHAGP  676
            +DENF L H GP
Sbjct  157  EDENFTLKHTGP  168



>gb|AAG40378.1|AF325026_1 AT3g62030 [Arabidopsis thaliana]
Length=260

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  59   KQFSGVYATTKHQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  114

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  115  LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  174

Query  641  KDENFKLVHAGP  676
            +DENF L H GP
Sbjct  175  EDENFTLKHTGP  186



>ref|NP_191762.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
 sp|P34791.1|CP20C_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic; 
Short=PPIase CYP20-3; AltName: Full=Cyclophilin 
of 20 kDa 3; AltName: Full=Cyclosporin A-binding protein; AltName: 
Full=Rotamase CYP20-3; AltName: Full=Rotamase cyclophilin-4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA20048.1| cyclophilin [Arabidopsis thaliana]
 gb|AAB96831.1| cyclophilin [Arabidopsis thaliana]
 emb|CAB71910.1| peptidylprolyl isomerase ROC4 [Arabidopsis thaliana]
 gb|AAL24325.1| peptidylprolyl isomerase ROC4 [Arabidopsis thaliana]
 gb|AAM13283.1| peptidylprolyl isomerase ROC4 [Arabidopsis thaliana]
 gb|AEE80297.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
Length=260

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  59   KQFSGVYATTKHQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  114

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  115  LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  174

Query  641  KDENFKLVHAGP  676
            +DENF L H GP
Sbjct  175  EDENFTLKHTGP  186



>emb|CDX76611.1| BnaC08g31970D [Brassica napus]
Length=253

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
            + FS     +K+ R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AG+IV+G
Sbjct  52   KHFSGAYATIKNQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGKIVMG  107

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            L+GD VP+T ENFR LCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  108  LFGDVVPKTVENFRVLCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  167

Query  641  KDENFKLVHAGP  676
            +DENF L H GP
Sbjct  168  EDENFTLKHTGP  179



>gb|KDO86742.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=225

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  82   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  138

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GP
Sbjct  139  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGP  193



>ref|XP_010468991.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+GD VP+T ENFR LCTGEK +G+KGS
Sbjct  91   VIEPQAKVTNKVYFDVEIG---GEVAGRIVMGLFGDVVPKTVENFRVLCTGEKKYGYKGS  147

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  148  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  191



>ref|XP_010413313.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic 
[Camelina sativa]
Length=264

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+GD VP+T ENFR LCTGEK +G+KGS
Sbjct  90   VIEPQAKVTNKVYFDVEIG---GEVAGRIVMGLFGDVVPKTVENFRVLCTGEKKYGYKGS  146

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  147  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  190



>ref|NP_001154684.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
 gb|AEE80298.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
Length=313

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  460
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  112  KQFSGVYATTKHQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  167

Query  461  LYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTF  640
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  168  LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  227

Query  641  KDENFKLVHAGP  676
            +DENF L H GP
Sbjct  228  EDENFTLKHTGP  239



>gb|AFK38232.1| unknown [Lotus japonicus]
Length=262

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +2

Query  371  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssf  550
            E Q+KVTS+V+FD++IG   G+AAGRIV GL+GD VP+TAENFRALCTGEKG+GFK   F
Sbjct  89   ELQAKVTSKVFFDVTIG---GEAAGRIVFGLFGDVVPKTAENFRALCTGEKGYGFKDCYF  145

Query  551  HRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            HR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  146  HRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFSLKHVGP  187



>ref|XP_006444641.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 ref|XP_006444644.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 ref|XP_006492443.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR57881.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|ESR57884.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|KDO86744.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
 gb|KDO86745.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=237

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  52   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  108

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GP
Sbjct  109  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGP  163



>emb|CDY58761.1| BnaA04g27460D [Brassica napus]
Length=258

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            +A PQ+KVT +VYFD+ IG   G+ AGRIV+GL+GD VP+T ENFRALCTGEK +G+KGS
Sbjct  84   LAPPQAKVTHKVYFDVEIG---GEVAGRIVMGLFGDVVPRTVENFRALCTGEKKYGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  141  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  184



>emb|CDX93994.1| BnaC04g21530D [Brassica napus]
Length=261

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            +A PQ+KVT +VYFD+ IG   G+ AGRIV+GL+GD VP+T ENFRALCTGEK +G+KGS
Sbjct  87   LAPPQAKVTHKVYFDVEIG---GEVAGRIVMGLFGDVVPKTVENFRALCTGEKKYGYKGS  143

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  144  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  187



>gb|KDO86743.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=255

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  70   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  126

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GP
Sbjct  127  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGP  181



>ref|XP_006444642.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 ref|XP_006492442.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR57882.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|KDO86741.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=267

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  82   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  138

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GP
Sbjct  139  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGP  193



>ref|XP_009116878.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic 
[Brassica rapa]
Length=257

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 87/105 (83%), Gaps = 3/105 (3%)
 Frame = +2

Query  362  QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg  541
            +V EPQ+KVT++VYFD+ IG   G+ AGRI +GL+GD VP+T ENFR LCTGEK +G+KG
Sbjct  82   EVIEPQAKVTNKVYFDVEIG---GEVAGRIEMGLFGDVVPKTVENFRVLCTGEKKYGYKG  138

Query  542  ssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SSFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  139  SSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  183



>ref|XP_010045506.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Eucalyptus grandis]
 gb|KCW88621.1| hypothetical protein EUGRSUZ_A00992 [Eucalyptus grandis]
Length=262

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            +  ++A A     Q+KVT++ +FD+ IG   G+ AGRIVIGL+GD+VP+T ENFRALCTG
Sbjct  79   MVEIKAMATDLGLQAKVTNKCFFDVEIG---GEPAGRIVIGLFGDDVPKTVENFRALCTG  135

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKGFG+KG SFHR+IKDFMIQGGDF +GNGTGGKSIYG TF+DENF L H GP
Sbjct  136  EKGFGYKGCSFHRIIKDFMIQGGDFTRGNGTGGKSIYGSTFEDENFALKHVGP  188



>ref|XP_010512589.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
[Camelina sativa]
Length=263

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 100/133 (75%), Gaps = 9/133 (7%)
 Frame = +2

Query  293  QKFSS-CSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVI  457
            ++FS  C+   K  R  A V++ A    +V EP +KVT++VYFD+ IG   G+ AGRIV+
Sbjct  61   KQFSGVCATTTKHQRT-ACVKSMAAEEEEVIEPIAKVTNKVYFDVEIG---GEVAGRIVM  116

Query  458  GLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRT  637
            GL+GD VP+T ENFR LCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  
Sbjct  117  GLFGDVVPKTVENFRVLCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAK  176

Query  638  FKDENFKLVHAGP  676
            F+DENF L H GP
Sbjct  177  FEDENFTLKHTGP  189



>gb|ABC41015.1| chloroplast-localized cyclophilin, partial [Triticum aestivum]
Length=150

 Score =   114 bits (284),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +2

Query  428  VGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgng  607
            VGK  GRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNG
Sbjct  1    VGKNVGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNG  60

Query  608  tggkSIYGRTFKDENFKLVHAGP  676
            TGGKSIYGRTFKDENF+LVH GP
Sbjct  61   TGGKSIYGRTFKDENFQLVHTGP  83



>ref|XP_010523872.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic 
[Tarenaya hassleriana]
Length=256

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +A V+A A     Q+KVT +V+FD+ IG   G+ +GRIVIGL+GD VP+T ENFR LC
Sbjct  71   RRMACVKAMATEEALQAKVTKKVFFDVEIG---GEPSGRIVIGLFGDVVPKTVENFRVLC  127

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHR+IKDFMIQGGDF +GNGTGG SIYG +F+DENF L H GP
Sbjct  128  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGNGTGGVSIYGSSFEDENFTLKHVGP  182



>ref|XP_002515157.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF47141.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=261

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            +A ++A A   E Q+KVT++V+FD+ IG   G+ AGRIV+GL+GD VP+TAENFRALCTG
Sbjct  78   MACIKAMANDLEVQAKVTTKVFFDVDIG---GEPAGRIVMGLFGDVVPKTAENFRALCTG  134

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +KG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SI+G +F+DE+F L H GP
Sbjct  135  DKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGVSIFGSSFEDESFDLKHVGP  187



>ref|XP_007163259.1| hypothetical protein PHAVU_001G219400g [Phaseolus vulgaris]
 gb|ESW35253.1| hypothetical protein PHAVU_001G219400g [Phaseolus vulgaris]
Length=259

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +  V AT    E Q+KVT++ +FD+  G   G+A GRIV+GL+G++VP+TAENFRALC
Sbjct  74   RSMTCVNATDNALELQAKVTTKCFFDVEAG---GEALGRIVLGLFGEDVPKTAENFRALC  130

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG +FKDE+F L H GP
Sbjct  131  TGEKGYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGPSFKDESFSLKHTGP  185



>emb|CDY11395.1| BnaA09g39610D [Brassica napus]
Length=258

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 3/105 (3%)
 Frame = +2

Query  362  QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg  541
            +V EPQ+KVT++V+FD+ IG   G+ AGRI +GL+GD VP+T ENFR LCTGEK +G+KG
Sbjct  83   EVIEPQAKVTNKVFFDVEIG---GEVAGRIEMGLFGDVVPKTVENFRVLCTGEKKYGYKG  139

Query  542  ssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SSFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  140  SSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  184



>emb|CAN69876.1| hypothetical protein VITISV_015631 [Vitis vinifera]
Length=253

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R L  V + A   E Q+KVT++ +FD+ IG   G+  GRIVIGL+G+ VP+TAENFR LC
Sbjct  68   RRLMCVNSMANEVELQAKVTTKCFFDVDIG---GEPVGRIVIGLFGEVVPKTAENFRVLC  124

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DENF L H GP
Sbjct  125  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDENFALTHVGP  179



>ref|XP_002273421.2| PREDICTED: peptidyl-prolyl cis-trans isomerase [Vitis vinifera]
 emb|CBI37036.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R L  V + A   E Q+KVT++ +FD+ IG   G+  GRIVIGL+G+ VP+TAENFR LC
Sbjct  68   RRLMCVNSMANEVELQAKVTTKCFFDVDIG---GEPVGRIVIGLFGEVVPKTAENFRVLC  124

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DENF L H GP
Sbjct  125  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDENFALTHVGP  179



>gb|KGN49788.1| Peptidyl-prolyl cis-trans isomerase [Cucumis sativus]
Length=252

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 4/119 (3%)
 Frame = +2

Query  320  VKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  499
            VK+ R +    AT  V E Q++V+++ +FD+ IG   G++AGRIVIGL+GD VP+T ENF
Sbjct  63   VKNRRLICANSATKNV-ELQAEVSTKCFFDVEIG---GESAGRIVIGLFGDVVPRTVENF  118

Query  500  RALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            RALCTGEKG+G+KG SFHRVIKDFMIQGGDF  G+GTGG SIYG +F+DENF L H GP
Sbjct  119  RALCTGEKGYGYKGCSFHRVIKDFMIQGGDFTNGDGTGGISIYGPSFRDENFSLKHVGP  177



>gb|ABC41017.1| chloroplast-localized cyclophilin, partial [Triticum aestivum]
Length=150

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  428  VGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgng  607
            VGK  GRIVIGLYGD+VPQT ENFRALC GEKGFG+KGSSFHRVIKDFMIQGGDFDKGNG
Sbjct  1    VGKNVGRIVIGLYGDDVPQTVENFRALCAGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNG  60

Query  608  tggkSIYGRTFKDENFKLVHAGP  676
            TGGKSIYGRTFKDENF+LVH GP
Sbjct  61   TGGKSIYGRTFKDENFQLVHTGP  83



>gb|KJB12530.1| hypothetical protein B456_002G023000 [Gossypium raimondii]
Length=243

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 126/191 (66%), Gaps = 23/191 (12%)
 Frame = +2

Query  104  MALPFAALANAGSLSVPRNLAPVKVSSSMCSYSKLPRSNSAEDTTsslssfsssaffsgs  283
            MA     L+N G LS PR     +  S+ C+    PR+      + S    SSS+ FSGS
Sbjct  1    MASSLTTLSNVGLLSSPRTPPKNQPISTSCNSFNFPRT-----LSLSPKISSSSSSFSGS  55

Query  284  lrlQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGL  463
             R  +F+S   Q  + R    VRATA+VA  QSK+T++V+FD+SIGNPVGK AG+IVIGL
Sbjct  56   FRFPRFNSP--QTNNHRVRRSVRATAEVAPIQSKITNKVFFDVSIGNPVGKLAGKIVIGL  113

Query  464  YGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFK  643
            Y                GEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK
Sbjct  114  Y----------------GEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFK  157

Query  644  DENFKLVHAGP  676
            DENFKL HAGP
Sbjct  158  DENFKLSHAGP  168



>gb|KDP28363.1| hypothetical protein JCGZ_14134 [Jatropha curcas]
Length=256

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +A V +     E Q+KVT++ +FD+ IG   G+ AGRIV+GL+GD VP+T ENFRALC
Sbjct  71   RRMACVNSMTNDVELQAKVTTKCFFDVDIG---GEPAGRIVMGLFGDVVPKTVENFRALC  127

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHR+IKDFMIQGGDF  GNGTGG SIYG +F+DE+F L H GP
Sbjct  128  TGEKGYGYKGCSFHRIIKDFMIQGGDFTAGNGTGGVSIYGSSFEDESFALKHVGP  182



>ref|XP_006402419.1| hypothetical protein EUTSA_v10006185mg [Eutrema salsugineum]
 gb|ESQ43872.1| hypothetical protein EUTSA_v10006185mg [Eutrema salsugineum]
Length=259

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +2

Query  374  PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfH  553
            PQ+KVT++VYFD+ IG   G+ AGRIV+GL+G+ VP+T ENFR LCTGEK +G+KGSSFH
Sbjct  88   PQAKVTNKVYFDVEIG---GEVAGRIVMGLFGEVVPKTVENFRVLCTGEKKYGYKGSSFH  144

Query  554  RVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            R+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  145  RIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  185



>ref|XP_008466218.1| PREDICTED: peptidyl-prolyl cis-trans isomerase A1 [Cucumis melo]
Length=252

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R L  V +  +  E Q++V+++ +FD+ IG   G+  GRIVIGL+GD VP+T ENFRALC
Sbjct  66   RTLICVNSATKDVELQAEVSTKCFFDVEIG---GEPVGRIVIGLFGDVVPRTVENFRALC  122

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KG SFHRVIKDFMIQGGDF  G+GTGG SIYG +F+DENF L HAGP
Sbjct  123  TGEKGYGYKGCSFHRVIKDFMIQGGDFTNGDGTGGVSIYGPSFRDENFSLKHAGP  177



>ref|NP_001288530.1| uncharacterized protein LOC103634647 [Zea mays]
 gb|ACF84730.1| unknown [Zea mays]
Length=213

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +2

Query  323  KSGRPLAPVRATAQ--VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  496
            +  R    VRATA     E Q+KVTS+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +N
Sbjct  23   RDARGAVVVRATAAEGAVELQAKVTSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDN  79

Query  497  FRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FRALCTGEKG+G+KG SFHR+IKDFMIQGGDF + NGTGG+SIYG  F DENF L H GP
Sbjct  80   FRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFQQNNGTGGRSIYGECFDDENFTLKHVGP  139



>ref|XP_008655470.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Zea mays]
 gb|AFW79492.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=242

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +2

Query  323  KSGRPLAPVRATAQ--VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  496
            +  R    VRATA     E Q+KVTS+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +N
Sbjct  52   RDARGAVVVRATAAEGAVELQAKVTSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDN  108

Query  497  FRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FRALCTGEKG+G+KG SFHR+IKDFMIQGGDF + NGTGG+SIYG  F DENF L H GP
Sbjct  109  FRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFQQNNGTGGRSIYGECFDDENFTLKHVGP  168



>ref|XP_006444643.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 ref|XP_006444645.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|ESR57883.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|ESR57885.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|KDO86740.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=268

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  82   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  138

Query  512  T-GEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            T GEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GP
Sbjct  139  TAGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGP  194



>ref|NP_001150495.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|ACG39280.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
Length=242

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +2

Query  323  KSGRPLAPVRATAQ--VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  496
            +  R    VRATA     E Q+KVTS+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +N
Sbjct  52   RDARGAVVVRATAAEGAVELQAKVTSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTIDN  108

Query  497  FRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FRALCTGEKG+G+KG SFHR+IKDFMIQGGDF + NGTGG+SIYG  F DENF L H GP
Sbjct  109  FRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFQQNNGTGGRSIYGECFDDENFTLKHVGP  168



>ref|XP_002951189.1| hypothetical protein VOLCADRAFT_81413 [Volvox carteri f. nagariensis]
 gb|EFJ47718.1| hypothetical protein VOLCADRAFT_81413 [Volvox carteri f. nagariensis]
Length=200

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = +2

Query  386  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIK  565
            +T +VYFD+ IG   G  AGRIVIGLYG++VP+T ENFRALCTGEKGFG+KGS FHRVIK
Sbjct  37   ITKKVYFDVDIG---GNKAGRIVIGLYGNDVPKTVENFRALCTGEKGFGYKGSPFHRVIK  93

Query  566  DFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
             FMIQGGDF  GNGTGGKSIYGRTF DENFK  H GP
Sbjct  94   QFMIQGGDFTNGNGTGGKSIYGRTFADENFKYRHTGP  130



>ref|XP_002990069.1| hypothetical protein SELMODRAFT_229509 [Selaginella moellendorffii]
 gb|EFJ08892.1| hypothetical protein SELMODRAFT_229509 [Selaginella moellendorffii]
Length=229

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 8/118 (7%)
 Frame = +2

Query  332  RPLAPVRATAQVAEP---QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  502
            RP A   A +   EP   Q+KVT + YFD+ IGN   +  GRIVIGLYGD+VP+T ENFR
Sbjct  47   RPFATQAAVS--VEPSTLQAKVTRKCYFDMKIGN---EPVGRIVIGLYGDDVPRTVENFR  101

Query  503  ALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            ALC G+KG+G+KGS+FHRVIK+FMIQGGDFD+ +GTGG+SIYG  F+DENFKL H GP
Sbjct  102  ALCAGDKGYGYKGSAFHRVIKNFMIQGGDFDRCDGTGGRSIYGGKFEDENFKLTHTGP  159



>ref|XP_002986930.1| hypothetical protein SELMODRAFT_229229 [Selaginella moellendorffii]
 gb|EFJ12012.1| hypothetical protein SELMODRAFT_229229 [Selaginella moellendorffii]
Length=229

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q+KVT + YFD+ IGN   +  GRIVIGLYGD+VP+T ENFRALC G+KG+G+KGS+FHR
Sbjct  63   QAKVTRKCYFDMKIGN---EPVGRIVIGLYGDDVPRTVENFRALCAGDKGYGYKGSAFHR  119

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            VIK+FMIQGGDFD+ +GTGG+SIYG  F+DENFKL H GP
Sbjct  120  VIKNFMIQGGDFDRCDGTGGRSIYGGKFEDENFKLTHTGP  159



>ref|XP_004288662.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Fragaria vesca 
subsp. vesca]
Length=240

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 5/117 (4%)
 Frame = +2

Query  332  RPLAPVRATAQVAEP--QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRA  505
            + +  V +TA   E   Q+KVT++ +FDI IG   G+A GR+VIGL+G+ VP+T ENFRA
Sbjct  53   KTMVCVNSTANELEEKLQAKVTTRCFFDIDIG---GEAVGRVVIGLFGEVVPKTVENFRA  109

Query  506  LCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            LCTGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG  F+DENF L H GP
Sbjct  110  LCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSKFEDENFALKHVGP  166



>ref|XP_004149480.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP20-3, chloroplastic-like [Cucumis sativus]
Length=253

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = +2

Query  320  VKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  499
            VK+ R +     +    E Q++V+++ +FD+ IG   G++AGRIVIGL+GD VP+T ENF
Sbjct  63   VKNRRLICAKXMSYCNVELQAEVSTKCFFDVEIG---GESAGRIVIGLFGDVVPRTVENF  119

Query  500  RALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            RALCTGEKG+G+KG SFHRVIKDFMIQGGDF  G+GTGG SIYG +F+DENF L H GP
Sbjct  120  RALCTGEKGYGYKGCSFHRVIKDFMIQGGDFTNGDGTGGISIYGPSFRDENFSLKHVGP  178



>ref|XP_009138740.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
[Brassica rapa]
Length=258

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            +A PQ+KVT + YFD+ IG   G+ AGRI +GL GD VP+T ENFRALCTGEK +G+KGS
Sbjct  84   LAPPQAKVTHKAYFDVEIG---GEVAGRIGMGLLGDVVPRTVENFRALCTGEKKYGYKGS  140

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  141  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  184



>gb|KJB24499.1| hypothetical protein B456_004G147800 [Gossypium raimondii]
Length=255

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            + A   E Q+KVT++ +FD+ IG   GKA GRIV+GL+GD VP+T ENFRALCTGE G+G
Sbjct  77   SMANDVELQAKVTTKCFFDVEIG---GKAVGRIVMGLFGDVVPRTVENFRALCTGENGYG  133

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FKG SFHR+IKDFMIQGGDF  GNGTGG SIYG  F+DE+F L H GP
Sbjct  134  FKGCSFHRIIKDFMIQGGDFTNGNGTGGMSIYGSKFEDESFALKHVGP  181



>ref|XP_004494484.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
isoform X3 [Cicer arietinum]
Length=226

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R L    A   V E Q+KVT++ +FD+ +G   G++ GRIV+GL+G++VP+T ENFRALC
Sbjct  41   RKLTCKAAAENVQELQAKVTTKCFFDVEVG---GESVGRIVLGLFGEDVPKTVENFRALC  97

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KGSSFHR+IK+FMIQGGDF +GNGTGG SIYG +F+DE+F L H GP
Sbjct  98   TGEKGYGYKGSSFHRIIKEFMIQGGDFTEGNGTGGVSIYGSSFEDESFDLKHVGP  152



>ref|XP_004164092.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
[Cucumis sativus]
Length=252

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%), Gaps = 4/119 (3%)
 Frame = +2

Query  320  VKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  499
            VK+ R +    AT  V E Q++V+++ +FD+ IG   G++AGRIVIGL+GD VP+T ENF
Sbjct  63   VKNRRLICANSATKNV-ELQAEVSTKCFFDVEIG---GESAGRIVIGLFGDVVPRTVENF  118

Query  500  RALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            RALCTGEKG+G+KG SFHRVIKDFMIQGGDF  G+GTGG SIYG +F+DE F L H GP
Sbjct  119  RALCTGEKGYGYKGCSFHRVIKDFMIQGGDFTNGDGTGGISIYGPSFRDEKFSLKHVGP  177



>ref|XP_004494482.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004494483.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=259

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R L    A   V E Q+KVT++ +FD+ +G   G++ GRIV+GL+G++VP+T ENFRALC
Sbjct  74   RKLTCKAAAENVQELQAKVTTKCFFDVEVG---GESVGRIVLGLFGEDVPKTVENFRALC  130

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KGSSFHR+IK+FMIQGGDF +GNGTGG SIYG +F+DE+F L H GP
Sbjct  131  TGEKGYGYKGSSFHRIIKEFMIQGGDFTEGNGTGGVSIYGSSFEDESFDLKHVGP  185



>gb|KDB12004.1| peptidyl-prolyl cis-trans isomerase B precursor [Ustilaginoidea 
virens]
Length=269

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 86/105 (82%), Gaps = 5/105 (5%)
 Frame = +2

Query  359  AQVAEPQS--KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            +Q AE     ++TS+VYFDI IG   GK AGRIV+GLYG  VP+TAENFRAL TGEKG+G
Sbjct  23   SQTAEAAKGPRITSKVYFDIEIG---GKPAGRIVMGLYGKTVPETAENFRALATGEKGYG  79

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            ++GS FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  80   YEGSMFHRVIKDFMIQGGDFTKGDGTGGKSIYGEKFKDENFKLKH  124



>gb|ABC41018.1| chloroplast-localized cyclophilin, partial [Triticum aestivum]
Length=150

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  428  VGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgng  607
            VGK  GRIVIGLYGD+VPQT ENFRALC GEKGFG+KGSSFHRVIK FMIQGGDFDKGNG
Sbjct  1    VGKNVGRIVIGLYGDDVPQTVENFRALCAGEKGFGYKGSSFHRVIKGFMIQGGDFDKGNG  60

Query  608  tggkSIYGRTFKDENFKLVHAGP  676
            TGGKSIYGRTFKDENF+LVH GP
Sbjct  61   TGGKSIYGRTFKDENFQLVHTGP  83



>emb|CBQ70421.1| probable cyclophilin b [Sporisorium reilianum SRZ2]
Length=213

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 83/103 (81%), Gaps = 3/103 (3%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+PQ  VT +VYFDIS     GK  GRIV+GLYGD+VP+TAENFRAL TGEKGFG+KGS 
Sbjct  32   ADPQPNVTHRVYFDIS---HDGKDVGRIVLGLYGDDVPKTAENFRALATGEKGFGYKGSK  88

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVI +FMIQGGDF++G+G GG SIYG  F DENFKL H GP
Sbjct  89   FHRVISNFMIQGGDFERGDGRGGYSIYGGKFDDENFKLKHTGP  131



>ref|XP_010240836.1| PREDICTED: peptidyl-prolyl cis-trans isomerase isoform X2 [Nelumbo 
nucifera]
Length=234

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            + A+  E Q+KVT++ +FD+ IG   G+  GRIV+GL+G+ VP+T ENFRALCTGEKG+G
Sbjct  56   SAAKGLELQAKVTTKCFFDVEIG---GEPVGRIVMGLFGEVVPKTVENFRALCTGEKGYG  112

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +KG SFHR+IKDFMIQGGDF  GNGTGG SIYG  F+DENF L+H GP
Sbjct  113  YKGCSFHRIIKDFMIQGGDFTAGNGTGGMSIYGSNFEDENFTLIHIGP  160



>ref|NP_001240987.1| uncharacterized protein LOC100785805 [Glycine max]
 gb|ACU23099.1| unknown [Glycine max]
Length=260

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +  V A   V E Q+KVT++ +FD+ +G   G+  GRIV+GL+G+ VP+T ENFRALC
Sbjct  75   RRMTCVNAADNVVELQAKVTTKCFFDVEVG---GEPVGRIVLGLFGEVVPKTVENFRALC  131

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG +FKDE+F L H GP
Sbjct  132  TGEKGYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGPSFKDESFALKHVGP  186



>gb|KCW88624.1| hypothetical protein EUGRSUZ_A00992 [Eucalyptus grandis]
Length=217

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            +  ++A A     Q+KVT++ +FD+ IG   G+ AGRIVIGL+GD+VP+T ENFRALCTG
Sbjct  79   MVEIKAMATDLGLQAKVTNKCFFDVEIG---GEPAGRIVIGLFGDDVPKTVENFRALCTG  135

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLV  664
            EKGFG+KG SFHR+IKDFMIQGGDF +GNGTGGKSIYG TF+DENF  V
Sbjct  136  EKGFGYKGCSFHRIIKDFMIQGGDFTRGNGTGGKSIYGSTFEDENFACV  184



>gb|KCW88623.1| hypothetical protein EUGRSUZ_A00992 [Eucalyptus grandis]
Length=184

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 3/106 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            +  ++A A     Q+KVT++ +FD+ IG   G+ AGRIVIGL+GD+VP+T ENFRALCTG
Sbjct  79   MVEIKAMATDLGLQAKVTNKCFFDVEIG---GEPAGRIVIGLFGDDVPKTVENFRALCTG  135

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENF  655
            EKGFG+KG SFHR+IKDFMIQGGDF +GNGTGGKSIYG TF+DENF
Sbjct  136  EKGFGYKGCSFHRIIKDFMIQGGDFTRGNGTGGKSIYGSTFEDENF  181



>ref|XP_010240835.1| PREDICTED: peptidyl-prolyl cis-trans isomerase isoform X1 [Nelumbo 
nucifera]
Length=266

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            + A+  E Q+KVT++ +FD+ IG   G+  GRIV+GL+G+ VP+T ENFRALCTGEKG+G
Sbjct  88   SAAKGLELQAKVTTKCFFDVEIG---GEPVGRIVMGLFGEVVPKTVENFRALCTGEKGYG  144

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +KG SFHR+IKDFMIQGGDF  GNGTGG SIYG  F+DENF L+H GP
Sbjct  145  YKGCSFHRIIKDFMIQGGDFTAGNGTGGMSIYGSNFEDENFTLIHIGP  192



>ref|XP_008776537.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Phoenix dactylifera]
Length=264

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 76/109 (70%), Gaps = 16/109 (15%)
 Frame = +2

Query  350  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  529
            RA  + AE Q KVT++V+FDISIGNPVGK  GRIVIGLY D+VPQTAENFRALCTGEKGF
Sbjct  99   RAELKEAELQPKVTNKVFFDISIGNPVGKLVGRIVIGLYEDDVPQTAENFRALCTGEKGF  158

Query  530  gfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            G++GS+FHR+IKDFMIQ                G   + E   L H GP
Sbjct  159  GYRGSTFHRIIKDFMIQ----------------GGDSRREILNLYHVGP  191



>ref|XP_007510149.1| peptidyl-prolyl cis-trans isomerase B [Bathycoccus prasinos]
 emb|CCO18494.1| peptidyl-prolyl cis-trans isomerase B [Bathycoccus prasinos]
Length=212

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 3/103 (3%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+   K+T+ VYFD+SIG   GK AGRI +GLYG  VP+T ENFRAL TGEKG+G++GS+
Sbjct  36   AKKGPKITNTVYFDVSIG---GKDAGRITMGLYGATVPKTVENFRALATGEKGYGYEGST  92

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVIKDFMIQGGDF KG+GTGGKSIYG  F DENFKL H GP
Sbjct  93   FHRVIKDFMIQGGDFTKGDGTGGKSIYGEKFADENFKLKHTGP  135



>ref|XP_008227761.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic 
isoform X3 [Prunus mume]
Length=206

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V + Q+KVT++ +FD  IG   G+A GR+V+GL+GD VP+T ENFRALCTGEKG+G+KG 
Sbjct  79   VEQLQAKVTTKCFFDTEIG---GEAVGRLVLGLFGDVVPKTVENFRALCTGEKGYGYKGC  135

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +G+GTGG SIYG TF DE+F L H GP
Sbjct  136  SFHRIIKDFMIQGGDFTEGDGTGGISIYGSTFADESFALKHVGP  179



>gb|ABI14285.1| cyclophilin-like protein [Pfiesteria piscicida]
Length=208

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 3/94 (3%)
 Frame = +2

Query  386  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIK  565
            +T +VYFD+SIG   G+ AGRIV+GLYG +VP+TAENFRALCTGEKGFG+KGS FHRVIK
Sbjct  29   ITHKVYFDVSIG---GEKAGRIVMGLYGKKVPKTAENFRALCTGEKGFGYKGSKFHRVIK  85

Query  566  DFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
             FMIQGGDF  G+GTGGKSIYG  FKDENFKL H
Sbjct  86   GFMIQGGDFTNGDGTGGKSIYGEKFKDENFKLRH  119



>ref|XP_002508058.1| peptidylprolyl isomerase, precursor [Micromonas sp. RCC299]
 gb|ACO69316.1| peptidylprolyl isomerase, precursor [Micromonas sp. RCC299]
Length=208

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 7/117 (6%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSK----VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRA  505
            LA +   A VAE + K    +T +VYFDI+I    G+ AGRI +GLYG  VP+TAENFRA
Sbjct  15   LAVLFLAAGVAEAKKKKGPKITHKVYFDITI---AGEPAGRIEMGLYGKTVPKTAENFRA  71

Query  506  LCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            L TGEKGFG+KGS FHRVIKDFMIQGGDF  G+GTGGKSIYG  F DENFKL H+GP
Sbjct  72   LATGEKGFGYKGSKFHRVIKDFMIQGGDFTNGDGTGGKSIYGEKFADENFKLKHSGP  128



>ref|XP_010672482.1| PREDICTED: peptidyl-prolyl cis-trans isomerase A1 [Beta vulgaris 
subsp. vulgaris]
Length=257

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            ++A V +  ++VT++V+FD+ IG   G+  GRIV+GL+GD VP+TAENFR LCTGEKG+G
Sbjct  79   SSADVQDLGAEVTTKVFFDVDIG---GEPVGRIVMGLFGDVVPKTAENFRVLCTGEKGYG  135

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +KG  FHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  136  YKGCHFHRIIKDFMIQGGDFTEGNGTGGISIYGSKFEDENFTLKHVGP  183



>gb|EEC70431.1| hypothetical protein OsI_01440 [Oryza sativa Indica Group]
Length=238

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  347  VRATAQ--VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGE  520
            VRA A     E Q+KVTS+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFRALCTG+
Sbjct  56   VRAAAAEGAVELQAKVTSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFRALCTGD  112

Query  521  kgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            KG+G+KG SFHR+IKDFMIQGGDF   NGTGG+SIYG  F DENF L H GP
Sbjct  113  KGYGYKGCSFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHTGP  164



>gb|ACU15989.1| unknown [Glycine max]
Length=243

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +    A   V + Q+KVT++ +FD+ IG   G+ AGR+V GL+G++VP+T ENFRALC
Sbjct  78   RRMTCTNAKENVLQLQAKVTNKCFFDVEIG---GEPAGRVVFGLFGEDVPKTVENFRALC  134

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KGS FHR+I++FM+QGGDF +GNGTGG SIYG +F DENF L H GP
Sbjct  135  TGEKGYGYKGSYFHRIIQNFMVQGGDFTEGNGTGGISIYGDSFDDENFNLKHVGP  189



>ref|XP_008227760.1| PREDICTED: peptidyl-prolyl cis-trans isomerase isoform X2 [Prunus 
mume]
Length=250

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V + Q+KVT++ +FD  IG   G+A GR+V+GL+GD VP+T ENFRALCTGEKG+G+KG 
Sbjct  77   VEQLQAKVTTKCFFDTEIG---GEAVGRLVLGLFGDVVPKTVENFRALCTGEKGYGYKGC  133

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +G+GTGG SIYG TF DE+F L H GP
Sbjct  134  SFHRIIKDFMIQGGDFTEGDGTGGISIYGSTFADESFALKHVGP  177



>ref|XP_008227759.1| PREDICTED: peptidyl-prolyl cis-trans isomerase isoform X1 [Prunus 
mume]
Length=252

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V + Q+KVT++ +FD  IG   G+A GR+V+GL+GD VP+T ENFRALCTGEKG+G+KG 
Sbjct  79   VEQLQAKVTTKCFFDTEIG---GEAVGRLVLGLFGDVVPKTVENFRALCTGEKGYGYKGC  135

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +G+GTGG SIYG TF DE+F L H GP
Sbjct  136  SFHRIIKDFMIQGGDFTEGDGTGGISIYGSTFADESFALKHVGP  179



>ref|XP_004495847.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
[Cicer arietinum]
Length=253

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 89/120 (74%), Gaps = 5/120 (4%)
 Frame = +2

Query  320  VKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGN-PVGKAAGRIVIGLYGDEVPQTAEN  496
            + S R      A   V E Q+KVT++ +FD+ IG+ PVG    RIV GL+G+ VP+T EN
Sbjct  63   ITSRRITCTSSAKENVVELQAKVTNKCFFDVEIGDEPVG----RIVFGLFGEVVPKTVEN  118

Query  497  FRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FRALCTGEKG+G+KGS FHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  119  FRALCTGEKGYGYKGSYFHRIIKDFMIQGGDFTEGNGTGGVSIYGAKFEDENFALKHVGP  178



>ref|XP_003567459.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Brachypodium 
distachyon]
Length=239

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%), Gaps = 7/129 (5%)
 Frame = +2

Query  302  SSCSVQVKSGR-PLAPVRATAQV---AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYG  469
            S+C++++ + R P   VRA A      E Q+KVT++ +FD+ IG   G+  G++VIGL+G
Sbjct  40   STCALRLAARRAPALVVRAAASSEGDVELQAKVTNKCFFDVEIG---GELVGKVVIGLFG  96

Query  470  DEVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDE  649
            + VP+T +NFRALCTG+KG+G+KGSSFHR+IKDFMIQGGDF   NGTGG+SIYG  F DE
Sbjct  97   EVVPKTVDNFRALCTGDKGYGYKGSSFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDE  156

Query  650  NFKLVHAGP  676
            NF L H GP
Sbjct  157  NFTLKHVGP  165



>ref|XP_007221498.1| hypothetical protein PRUPE_ppa010357mg [Prunus persica]
 gb|EMJ22697.1| hypothetical protein PRUPE_ppa010357mg [Prunus persica]
Length=252

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 3/104 (3%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  544
            V + Q+KVT++ +FD  IG   G+A GR+V+GL+GD VP+T ENFRALCTGEKG+G+KG 
Sbjct  79   VEQLQAKVTTKCFFDTEIG---GEAVGRLVLGLFGDVVPKTVENFRALCTGEKGYGYKGC  135

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            SFHR+IKDFMIQGGDF +G+GTGG SIYG TF DE+F L H GP
Sbjct  136  SFHRIIKDFMIQGGDFTEGDGTGGVSIYGSTFADESFALKHVGP  179



>ref|XP_009829338.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces astaci]
 gb|ETV81480.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces astaci]
Length=202

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = +2

Query  365  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg-  541
            VA    K+T QVYFDISIG   G  AGRIV+GLYG  VP+T ENFRALCTGEKG G  G 
Sbjct  17   VAAAGPKITHQVYFDISIG---GHNAGRIVMGLYGKSVPKTVENFRALCTGEKGLGKTGK  73

Query  542  ------ssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
                  S+FHR+I DFMIQGGDF  G GTGG+SIYG  F+DENFKL H GP
Sbjct  74   ALWYKDSTFHRIIPDFMIQGGDFTHGTGTGGESIYGEKFEDENFKLKHEGP  124



>ref|XP_003536011.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic 
isoform 1 [Glycine max]
Length=263

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R +    A   V + Q+KVT++ +FD+ IG   G+ AGR+V GL+G++VP+T ENFRALC
Sbjct  78   RRMTCTNAKENVLQLQAKVTNKCFFDVEIG---GEPAGRVVFGLFGEDVPKTVENFRALC  134

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKG+G+KGS FHR+I++FM+QGGDF +GNGTGG SIYG +F DENF L H GP
Sbjct  135  TGEKGYGYKGSYFHRIIQNFMVQGGDFTEGNGTGGISIYGDSFDDENFNLKHVGP  189



>ref|XP_002301464.2| cyclophilin family protein [Populus trichocarpa]
 gb|EEE80737.2| cyclophilin family protein [Populus trichocarpa]
Length=266

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            +A   + A   + Q+KVT++ +FD+ +G   G+  GRIV+GL+GD VP+TAENFRALCTG
Sbjct  83   MACANSMANDVDLQAKVTTKCFFDVEVG---GELVGRIVMGLFGDVVPKTAENFRALCTG  139

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +KG+G+KG SFHR+IKDFMIQGGDF +G+GTGGKSIYG +F+DE+F L H GP
Sbjct  140  DKGYGYKGCSFHRIIKDFMIQGGDFTRGDGTGGKSIYGSSFEDESFSLKHVGP  192



>ref|XP_001766197.1| predicted protein [Physcomitrella patens]
 gb|EDQ69046.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 86/117 (74%), Gaps = 7/117 (6%)
 Frame = +2

Query  332  RPLAPVRATAQV---AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  502
            R    VRA AQV      Q KVT + +FDI I +   K  GRI+ GL+GD VP T ENFR
Sbjct  3    RNQVNVRA-AQVPSEVTTQDKVTKKCFFDIEIDD---KPCGRIIFGLFGDTVPDTVENFR  58

Query  503  ALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
             LCTGE+ FG+KGS+FHRVIKDFMIQGGDFD+GNGTGG SIYG TFKDENFKL H G
Sbjct  59   CLCTGERRFGYKGSAFHRVIKDFMIQGGDFDQGNGTGGYSIYGNTFKDENFKLRHTG  115



>ref|XP_007051330.1| Peptidyl-prolyl cis-trans isomerase [Theobroma cacao]
 gb|EOX95487.1| Peptidyl-prolyl cis-trans isomerase [Theobroma cacao]
Length=258

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            QSKVT++ +FD+ +G   G+  GRIV+GL+GD VP+T ENFRALCTGEKG+G+KG SFHR
Sbjct  88   QSKVTTKCFFDVEVG---GEPVGRIVMGLFGDVVPRTVENFRALCTGEKGYGYKGCSFHR  144

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +IKDFMIQGGDF  GNGTGG+SIYG  F+DENF L H GP
Sbjct  145  IIKDFMIQGGDFTNGNGTGGRSIYGSRFEDENFDLKHVGP  184



>ref|XP_504296.1| YALI0E23155p [Yarrowia lipolytica]
 sp|Q6C4W6.1|PPIB_YARLI RecName: Full=Peptidyl-prolyl cis-trans isomerase B; Short=PPIase 
B; AltName: Full=Rotamase B; Flags: Precursor [Yarrowia 
lipolytica CLIB122]
 emb|CAG79895.1| YALI0E23155p [Yarrowia lipolytica CLIB122]
Length=228

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 83/103 (81%), Gaps = 3/103 (3%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            AEP +++T +VYFDI  G    ++ G+IV+GLYGD VP+T ENFRALCTGE G G+KGS 
Sbjct  24   AEPDAEITHKVYFDIKQGE---ESLGKIVMGLYGDVVPKTVENFRALCTGETGKGYKGSK  80

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVIK+FMIQGGDF +G+GTGG+SIYGR F DENF+L H  P
Sbjct  81   FHRVIKNFMIQGGDFTRGDGTGGESIYGRKFPDENFQLKHTKP  123



>gb|KFK35389.1| hypothetical protein AALP_AA5G278800 [Arabis alpina]
Length=621

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 3/102 (3%)
 Frame = +2

Query  371  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssf  550
            EP +KVT++VYFD+ IG   G+ AGRIV+GL+G+ VP+T ENFR LCTGEK +G+KGSSF
Sbjct  449  EPIAKVTNKVYFDVEIG---GEVAGRIVMGLFGEVVPKTVENFRVLCTGEKKYGYKGSSF  505

Query  551  HRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            HR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  506  HRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGP  547



>ref|XP_002455482.1| hypothetical protein SORBIDRAFT_03g011610 [Sorghum bicolor]
 gb|EES00602.1| hypothetical protein SORBIDRAFT_03g011610 [Sorghum bicolor]
Length=242

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q+KVT++ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFRALCTGEKG+G+KG SFHR
Sbjct  72   QAKVTTKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFRALCTGEKGYGYKGCSFHR  128

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +IKDFMIQGGDF + NGTGG+SIYG +F DENF L H GP
Sbjct  129  IIKDFMIQGGDFQENNGTGGRSIYGESFDDENFTLKHVGP  168



>gb|ABA01141.1| peptidylprolyl isomerase/cyclophilin-like protein [Chlamydomonas 
incerta]
Length=201

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 3/97 (3%)
 Frame = +2

Query  386  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIK  565
            +T +VYFDI+IG     +AGR+VIGLYG++VPQT ENFRALCTGEKGFG+KGS FHRVIK
Sbjct  38   ITKKVYFDINIG---ANSAGRVVIGLYGNDVPQTVENFRALCTGEKGFGYKGSPFHRVIK  94

Query  566  DFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
             FMIQGGDF  GNGTGGKSIYG  F DENFK  H GP
Sbjct  95   QFMIQGGDFTAGNGTGGKSIYGARFNDENFKYKHTGP  131



>gb|EMF10215.1| peptidyl-prolyl cis-trans isomerase B precursor [Sphaerulina 
musiva SO2202]
Length=208

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 5/106 (5%)
 Frame = +2

Query  359  AQVAEPQS--KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            AQ AE Q   K+T +VYFDI  G+   +  GRIV+GLYG   P+TAENFRALCTGEKGFG
Sbjct  23   AQTAEAQKGPKITHKVYFDIKQGD---EELGRIVMGLYGKTTPKTAENFRALCTGEKGFG  79

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHA  670
            ++ SSFHRVIKDFMIQGGDF KG+GTGGKSIYG  F DENFKL H+
Sbjct  80   YQDSSFHRVIKDFMIQGGDFTKGDGTGGKSIYGAKFDDENFKLKHS  125



>ref|XP_005829570.1| cyclophilin B [Guillardia theta CCMP2712]
 emb|CAI77920.1| cyclophilin B [Guillardia theta]
 gb|EKX42590.1| cyclophilin B [Guillardia theta CCMP2712]
Length=195

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 87/110 (79%), Gaps = 5/110 (5%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            LA V A A+   P  KVT++V+FDI+I    GK AGRIV+GLYG  VPQTAENFRAL TG
Sbjct  16   LATVGAEAKKKGP--KVTTKVFFDITID---GKDAGRIVMGLYGKSVPQTAENFRALSTG  70

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            EKGFG++GS FHRVIK+FMIQGGDF +G+GTGGKSIYG  F DENFK  H
Sbjct  71   EKGFGYEGSIFHRVIKNFMIQGGDFTRGDGTGGKSIYGERFADENFKFKH  120



>gb|AIG55642.1| secreted protein [Thraustotheca clavata]
Length=205

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 80/115 (70%), Gaps = 10/115 (9%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            A   +A    KVTSQVYFDI IGN   + AGRIV+GLYG   P+T ENFRALCTGEKG G
Sbjct  16   AGVAMATKGPKVTSQVYFDIKIGN---REAGRIVMGLYGKTTPKTVENFRALCTGEKGTG  72

Query  533  fkg-------ssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
             KG       S FHR+I DFMIQGGDF  G GTGG+SIYG  F DENFKL H GP
Sbjct  73   TKGKPLWYKDSKFHRIIPDFMIQGGDFTHGTGTGGESIYGDRFDDENFKLKHEGP  127



>sp|Q01490.1|PPIB_ORPSP RecName: Full=Peptidyl-prolyl cis-trans isomerase B; Short=PPIase 
B; AltName: Full=Cyclophilin B; AltName: Full=Rotamase 
B; Flags: Precursor [Orpinomyces sp. PC-2]
 gb|AAD04195.1| cyclophilin B precursor [Orpinomyces sp. PC-2]
Length=203

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            AT   A    KVT++VYFDI  G+   K  GRIV+GLYG+ VP+T ENFRAL TGEKG+G
Sbjct  17   ATLVSASTNPKVTNKVYFDIKQGD---KDLGRIVLGLYGEVVPKTVENFRALATGEKGYG  73

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GP
Sbjct  74   YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFADENFKLRHTGP  121



>gb|EEE54351.1| hypothetical protein OsJ_01342 [Oryza sativa Japonica Group]
Length=232

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 6/118 (5%)
 Frame = +2

Query  332  RPLAPVRATAQV---AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  502
            +P AP    A+     E Q+KV S+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFR
Sbjct  44   KPRAPGAKGAETRGAVELQAKVNSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFR  100

Query  503  ALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            ALCTG+KG+G+KG SFHR+IKDFMIQGGDF   NGTGG+SIYG  F DENF L H GP
Sbjct  101  ALCTGDKGYGYKGCSFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHTGP  158



>gb|ABC47329.1| cyclophilin B precursor [Orpinomyces sp. PC-2]
Length=203

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            AT   A    KVT++VYFDI  G+   K  GRIV+GLYG+ VP+T ENFRAL TGEKG+G
Sbjct  17   ATLVSASTNPKVTNKVYFDIRQGD---KDLGRIVLGLYGEVVPKTVENFRALATGEKGYG  73

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GP
Sbjct  74   YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFADENFKLRHTGP  121



>ref|XP_004967648.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
[Setaria italica]
Length=242

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +2

Query  371  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssf  550
            E Q+KVT++ +FD+ +G   G+  GRIVIGL+G+ VP T ENFRALCTGEKG+G+KG SF
Sbjct  70   ELQAKVTNKCFFDVEVG---GEPLGRIVIGLFGEVVPMTVENFRALCTGEKGYGYKGCSF  126

Query  551  HRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            HR+IKDFMIQGGDF + NGTGG+SIYG +F DENF L H GP
Sbjct  127  HRIIKDFMIQGGDFQENNGTGGRSIYGESFDDENFTLKHVGP  168



>gb|EJW80238.1| cyclophilin-type peptidyl-prolyl cis-trans isomerase-15 [Wuchereria 
bancrofti]
Length=203

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = +2

Query  356  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  535
            T+  A+  + VT +VYFD++IG+   K  GRI IGL+G++VP+TAENFRAL TGEKGFG+
Sbjct  16   TSNNAKEMATVTKKVYFDVAIGD---KKIGRIEIGLFGNDVPKTAENFRALATGEKGFGY  72

Query  536  kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
            KGS FHRVIKDFMIQGGDF KG+GTGGKSIYG  F+DENFKL H G
Sbjct  73   KGSKFHRVIKDFMIQGGDFTKGDGTGGKSIYGDRFEDENFKLKHYG  118



>gb|KEI40562.1| hypothetical protein L969DRAFT_338716 [Mixia osmundae IAM 14324]
Length=218

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 84/109 (77%), Gaps = 4/109 (4%)
 Frame = +2

Query  353  ATAQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  529
            AT+Q A  +  K+TS+V+FDI  G+   K  GRIVIGLYG  VP+TAENFRAL TGEKG+
Sbjct  18   ATSQTAAQKGPKITSKVFFDIKQGD---KDLGRIVIGLYGKTVPKTAENFRALATGEKGY  74

Query  530  gfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            G++GS FHRVIK FMIQGGDF   +GTGGKSIYG  F DENFKL H GP
Sbjct  75   GYEGSIFHRVIKQFMIQGGDFTNFDGTGGKSIYGNKFPDENFKLRHTGP  123



>gb|KDO32415.1| hypothetical protein SPRG_02892 [Saprolegnia parasitica CBS 223.65]
Length=176

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 78/105 (74%), Gaps = 10/105 (10%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg-------  541
            K+T+QVYFDI IGN   + AGRIV+GLYG   P+T ENFRALCTGEKG G KG       
Sbjct  24   KITNQVYFDIKIGN---RDAGRIVMGLYGKTTPKTVENFRALCTGEKGTGTKGKPLWYKD  80

Query  542  ssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            S+FHR+I DFMIQGGDF  G GTGG+SIYG  F DENFKL H GP
Sbjct  81   SAFHRIIPDFMIQGGDFTHGTGTGGESIYGDRFDDENFKLKHEGP  125



>ref|XP_011116201.1| hypothetical protein H072_10767 [Dactylellina haptotyla CBS 200.50]
 gb|EPS35784.1| hypothetical protein H072_10767 [Dactylellina haptotyla CBS 200.50]
Length=289

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = +2

Query  356  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  535
            TA  A    K+T++VYFDI  G+   +  GRIVIGLYG  VP+TAENFRALCTGEKGFG+
Sbjct  16   TAVQANKGPKITNKVYFDIKHGD---EELGRIVIGLYGASVPKTAENFRALCTGEKGFGY  72

Query  536  kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            +GS+FHRVIKDFMIQGGDF   +GTGGKSIYG  FKDENFK  H
Sbjct  73   EGSTFHRVIKDFMIQGGDFTNHDGTGGKSIYGEKFKDENFKFKH  116



>ref|XP_001700546.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
 gb|EDO97990.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
Length=200

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +2

Query  386  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIK  565
            VT +VYFD++IG     +AGR+VIGLYG++VP T ENFRALCTGEKGFG+KGS FHRVIK
Sbjct  37   VTKKVYFDVNIG---ANSAGRVVIGLYGNDVPDTVENFRALCTGEKGFGYKGSVFHRVIK  93

Query  566  DFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
             FMIQGGDF  GNGTGGKSIYG  F DENFK  H GP
Sbjct  94   QFMIQGGDFTAGNGTGGKSIYGARFNDENFKYKHTGP  130



>emb|CDJ26558.1| unnamed protein product [Triticum aestivum]
Length=203

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q+KVTS+ +FD+ IG   G  AG++VIGL+G+ VP+T +NFRALCTG+KG+G+KG SFHR
Sbjct  70   QAKVTSKCFFDVEIG---GDRAGKVVIGLFGEVVPKTVDNFRALCTGDKGYGYKGCSFHR  126

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +IKDFMIQGGDF   NGTGG+SIYG  F DENF L H GP
Sbjct  127  IIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHVGP  166



>gb|KHN95402.1| peptidyl-prolyl cis-trans isomerase B precursor [Metarhizium 
album ARSEF 1941]
Length=266

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 85/105 (81%), Gaps = 5/105 (5%)
 Frame = +2

Query  359  AQVAEPQS--KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            +Q AE     K+TS+VYFDI  G+   KA GRIVIGLYG  VP+TAENFRAL TGEKGFG
Sbjct  22   SQTAEAAKGPKITSKVYFDIEHGD---KALGRIVIGLYGKTVPETAENFRALATGEKGFG  78

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            ++GS+FHRVIK FMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  79   YEGSTFHRVIKQFMIQGGDFTKGDGTGGKSIYGAKFKDENFKLKH  123



>dbj|BAB39968.1| putative peptidyl-prolyl cis-trans isomerase, chloroplast precursor 
[Oryza sativa Japonica Group]
 dbj|BAB39983.1| putative peptidyl-prolyl cis-trans isomerase, chloroplast precursor 
[Oryza sativa Japonica Group]
 dbj|BAB64228.1| putative peptidyl-prolyl cis-trans isomerase, chloroplast precursor 
[Oryza sativa Japonica Group]
Length=231

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 82/102 (80%), Gaps = 3/102 (3%)
 Frame = +2

Query  371  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssf  550
            E Q+KV S+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFRALCTG+KG+G+KG SF
Sbjct  59   ELQAKVNSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFRALCTGDKGYGYKGCSF  115

Query  551  HRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            HR+IKDFMIQGGDF   NGTGG+SIYG  F DENF L H GP
Sbjct  116  HRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHTGP  157



>ref|XP_006840420.1| hypothetical protein AMTR_s00045p00158000 [Amborella trichopoda]
 gb|ERN02095.1| hypothetical protein AMTR_s00045p00158000 [Amborella trichopoda]
Length=255

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = +2

Query  332  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  511
            R L    A     E Q+ VT++ +FD+ +G   G+  GRIV+GL+GD VP T ENFRALC
Sbjct  70   RGLVCNNAMTHDQELQADVTTKCFFDVEVG---GEPVGRIVLGLFGDVVPATVENFRALC  126

Query  512  TGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            TGEKGFG+KG SFHR+IKDFM+Q GDFDKGNGTGG+SIYG  F+DENF L H GP
Sbjct  127  TGEKGFGYKGCSFHRIIKDFMVQSGDFDKGNGTGGRSIYGSKFEDENFILKHIGP  181



>ref|XP_011025284.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Populus euphratica]
Length=266

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 90/113 (80%), Gaps = 3/113 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            +A   +     + Q+KVT++ +FD+ +G   G+  GRIV+GL+GD VP+TAENFRALCTG
Sbjct  83   MACANSMENDVDLQAKVTTKCFFDVEVG---GEPVGRIVMGLFGDVVPKTAENFRALCTG  139

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +KG+G+KG SFHR+IKDFMIQGGDF +G+GTGGKSIYG +F+DE+F L H GP
Sbjct  140  DKGYGYKGCSFHRIIKDFMIQGGDFTRGDGTGGKSIYGSSFEDESFSLKHVGP  192



>gb|EME39331.1| hypothetical protein DOTSEDRAFT_75145 [Dothistroma septosporum 
NZE10]
Length=208

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 5/106 (5%)
 Frame = +2

Query  359  AQVAEPQS--KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            AQ AE Q   K+T +V+FDI IG+   + AGRIV+GLYG  VP+TAENFRAL TGEKGFG
Sbjct  23   AQNAEAQKGPKITQKVFFDIKIGD---EDAGRIVMGLYGKTVPKTAENFRALATGEKGFG  79

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHA  670
            ++GS+FHRVIKDFM QGGDF KG+GTGGKSIYG  F DENFKL H+
Sbjct  80   YEGSAFHRVIKDFMCQGGDFTKGDGTGGKSIYGEKFADENFKLKHS  125



>sp|Q41651.1|CYPB_VICFA RecName: Full=Peptidyl-prolyl cis-trans isomerase, chloroplastic; 
Short=PPIase; AltName: Full=Cyclophilin; AltName: Full=Cyclosporin 
A-binding protein; Short=CYP B; AltName: Full=Rotamase; 
Flags: Precursor [Vicia faba]
 gb|AAA64430.1| cyclophilin [Vicia faba]
Length=248

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            A  +VAE Q+KVTS+++FDI IG   G++AGRIVIGL+GD VP+T ENF+ L TG KG+G
Sbjct  69   AQGEVAELQAKVTSKIFFDIEIG---GESAGRIVIGLFGDAVPKTVENFKTLSTGAKGYG  125

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            ++GS FHR+I +FMIQGGDF +GNGTGG SIYG  F+DE+F L H GP
Sbjct  126  YQGSFFHRIIPNFMIQGGDFTEGNGTGGVSIYGSKFEDESFDLKHVGP  173



>emb|CDP90818.1| Protein Bm13780, partial [Brugia malayi]
Length=204

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = +2

Query  356  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  535
            T+  A+  + VT +VYFDI+IG+   K  GRI IGL+G++VP+T ENFRAL TGEKGFG+
Sbjct  17   TSNNAKEMATVTKKVYFDIAIGD---KKIGRIEIGLFGNDVPKTVENFRALATGEKGFGY  73

Query  536  kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
            KGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F+DENFKL H G
Sbjct  74   KGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFEDENFKLKHYG  119



>ref|XP_001896264.1| cyclophilin-type peptidyl-prolyl cis-trans isomerase-15, Bmcyp-5 
[Brugia malayi]
 gb|AAK91501.1| R2 [Brugia malayi]
Length=203

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = +2

Query  356  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  535
            T+  A+  + VT +VYFDI+IG+   K  GRI IGL+G++VP+T ENFRAL TGEKGFG+
Sbjct  16   TSNNAKEMATVTKKVYFDIAIGD---KKIGRIEIGLFGNDVPKTVENFRALATGEKGFGY  72

Query  536  kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
            KGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F+DENFKL H G
Sbjct  73   KGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFEDENFKLKHYG  118



>ref|XP_662071.1| hypothetical protein AN4467.2 [Aspergillus nidulans FGSC A4]
 sp|Q5B4R3.1|PPIB_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase B; Short=PPIase 
B; AltName: Full=Rotamase B; Flags: Precursor [Aspergillus 
nidulans FGSC A4]
 gb|AAD17998.1| cyclophilin B [Aspergillus nidulans]
 gb|EAA60232.1| hypothetical protein AN4467.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF77459.1| TPA: Peptidyl-prolyl cis-trans isomerase B Precursor (PPIase 
B)(Rotamase B)(EC 5.2.1.8) [Source:UniProtKB/Swiss-Prot;Acc:Q5B4R3] 
[Aspergillus nidulans FGSC A4]
Length=214

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 4/106 (4%)
 Frame = +2

Query  353  ATAQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  529
            A    +EP+  K+T++VYFDI  G+   ++ GRIV+GLYG  VP+TAENFRAL TGEKGF
Sbjct  20   ALVNASEPRGPKITNKVYFDIQHGD---ESLGRIVLGLYGKTVPETAENFRALATGEKGF  76

Query  530  gfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            G++GS+FHRVIKDFMIQGGDF +G+GTGGKSIYG  FKDENFKL H
Sbjct  77   GYEGSNFHRVIKDFMIQGGDFTRGDGTGGKSIYGAKFKDENFKLRH  122



>gb|ERG83631.1| peptidyl-prolyl cis-trans isomerase b [Ascaris suum]
Length=203

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 80/96 (83%), Gaps = 3/96 (3%)
 Frame = +2

Query  386  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIK  565
            VT +V+ DI IG   GK  GRIVIGL+G+EVP+TAENFRAL TGEKG+GFKGS FHRVIK
Sbjct  26   VTKKVFLDIEIG---GKKTGRIVIGLFGNEVPKTAENFRALATGEKGYGFKGSKFHRVIK  82

Query  566  DFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
            DFMIQGGDF +G+GTGGKSIYG  F DENFKL H G
Sbjct  83   DFMIQGGDFTRGDGTGGKSIYGERFPDENFKLQHYG  118



>ref|XP_001748242.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ87003.1| predicted protein [Monosiga brevicollis MX1]
Length=176

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +2

Query  359  AQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfk  538
            A+    Q +VT++VYFDI IG   GKAAGRI I LYG +VP+T ENFRAL TGEKGFG++
Sbjct  3    AETCSSQPEVTNRVYFDIEIG---GKAAGRIEIDLYGKDVPKTVENFRALATGEKGFGYR  59

Query  539  gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
             S FHR+I +FMIQGGDF   +GTGGKSIYG  F+DENF L H GP
Sbjct  60   DSIFHRIIPNFMIQGGDFTNFDGTGGKSIYGNKFEDENFSLKHTGP  105



>gb|AIG55930.1| secreted protein [Achlya hypogyna]
Length=205

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 78/105 (74%), Gaps = 10/105 (10%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg-------  541
            K+T+QVYFDI IGN   + AGRIV+GLYG   P+T ENFRALCTGEKG G KG       
Sbjct  26   KITNQVYFDIKIGN---RDAGRIVMGLYGKTTPKTVENFRALCTGEKGTGTKGKPLWYKD  82

Query  542  ssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            S+FHR+I DFMIQGGDF  G GTGG+SIYG  F DENFKL H GP
Sbjct  83   SAFHRIIPDFMIQGGDFTHGTGTGGESIYGDRFDDENFKLKHEGP  127



>ref|XP_010907913.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
A1-like [Elaeis guineensis]
Length=267

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 3/102 (3%)
 Frame = +2

Query  371  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssf  550
            E Q+KVT + +FD+ IG   G+  GRIVIGLYG+ VP+T ENFRALCTGEKG G+KG SF
Sbjct  95   ELQAKVTKKCFFDVEIG---GEPVGRIVIGLYGEVVPRTVENFRALCTGEKGIGYKGCSF  151

Query  551  HRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            HR+IKDFMIQGGDFD GNGTGG+SIYG  F DE+F L H GP
Sbjct  152  HRIIKDFMIQGGDFDHGNGTGGRSIYGPQFDDESFTLRHIGP  193



>ref|XP_008878745.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces invadans]
 gb|ETV92709.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces invadans]
Length=202

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 81/119 (68%), Gaps = 12/119 (10%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            L  V A    A P  K+T QV+FDI+IG   G+ AGRIV+GLYG  VP+T ENFRALCTG
Sbjct  10   LLAVLAVVSAAGP--KITHQVFFDITIG---GRDAGRIVMGLYGKTVPKTVENFRALCTG  64

Query  518  Ekgfgfkgssf-------HRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
            EKG G  G +        HR+I DFMIQGGDF  G GTGG+SIYG  F+DENFKL H G
Sbjct  65   EKGLGKTGKALWYKDSTFHRIIPDFMIQGGDFTHGTGTGGESIYGEKFEDENFKLKHEG  123



>emb|CDJ93250.1| Peptidyl-prolyl cis-trans isomerase domain containing protein 
[Haemonchus contortus]
Length=202

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +2

Query  386  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIK  565
            VT QVYFDISIG   GK AGRIVIGL+G+ VP+TAENF  L TG KG+G+KGS FHRVIK
Sbjct  24   VTKQVYFDISIG---GKPAGRIVIGLFGNAVPKTAENFLQLATGSKGYGYKGSKFHRVIK  80

Query  566  DFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            DFMIQGGDF +G+GTGGKSIYG  F DENF L H GP
Sbjct  81   DFMIQGGDFTRGDGTGGKSIYGERFADENFDLHHYGP  117



>ref|XP_008604422.1| peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [Saprolegnia 
diclina VS20]
 gb|EQC41853.1| peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [Saprolegnia 
diclina VS20]
Length=203

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 78/105 (74%), Gaps = 10/105 (10%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg-------  541
            K+T+QVYFDI IGN   + AGR+V+GLYG   P+T ENFRALCTGEKG G KG       
Sbjct  24   KITNQVYFDIKIGN---RDAGRVVMGLYGKTTPKTVENFRALCTGEKGTGTKGKPLWYKD  80

Query  542  ssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            S+FHR+I DFMIQGGDF  G GTGG+SIYG  F DENFKL H GP
Sbjct  81   SAFHRIIPDFMIQGGDFTHGTGTGGESIYGDRFDDENFKLKHEGP  125



>ref|XP_002110986.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV26990.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=202

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 82/103 (80%), Gaps = 3/103 (3%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+   KVT +V+FDI+IG   G+ AGRI IGL+G  VP+T  NF AL TGEKGFG+KGS 
Sbjct  22   AKKGPKVTKKVFFDITIG---GEKAGRIEIGLFGSTVPKTVTNFVALATGEKGFGYKGSV  78

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVIKDFMIQGGDF  G+GTGGKSIYGR F DENFKL HAGP
Sbjct  79   FHRVIKDFMIQGGDFTNGDGTGGKSIYGRKFDDENFKLKHAGP  121



>gb|EKV19754.1| Peptidyl-prolyl cis-trans isomerase B [Penicillium digitatum 
PHI26]
 gb|EKV20855.1| Peptidyl-prolyl cis-trans isomerase B [Penicillium digitatum 
Pd1]
Length=268

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  338  LAPVRATAQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT  514
             A VRA  +  EP+  K+TS++YFDI  G+   +  GRIV+GLYG  VP+TAENFRAL T
Sbjct  18   FALVRA-EEAKEPRGPKITSKIYFDIQHGD---EPLGRIVMGLYGKTVPETAENFRALAT  73

Query  515  GEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            GEKGFG++ S+FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  74   GEKGFGYQDSTFHRVIKDFMIQGGDFTKGDGTGGKSIYGNKFKDENFKLRH  124



>ref|XP_004990131.1| peptidyl-prolyl cis-trans isomerase [Salpingoeca rosetta]
 gb|EGD77655.1| peptidyl-prolyl cis-trans isomerase [Salpingoeca rosetta]
Length=192

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+   KVT +VYFD+ I    G+ AGRIV+ LYG  VP+T ENFRALCTGEKGFG+KGSS
Sbjct  21   AKKTPKVTHRVYFDVDID---GEDAGRIVMELYGKTVPKTVENFRALCTGEKGFGYKGSS  77

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            FHRVI DFMIQGGDF   +GTGGKSIYG  F DENFKL H GP
Sbjct  78   FHRVIPDFMIQGGDFTNHDGTGGKSIYGNRFDDENFKLKHTGP  120



>ref|XP_001774447.1| predicted protein [Physcomitrella patens]
 gb|EDQ60810.1| predicted protein, partial [Physcomitrella patens]
Length=117

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 3/97 (3%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVI  562
            KVT + +FDI I +   K  GRI+IGL+GD VP T ENFR LCTGE+ FG+KGS+FHRVI
Sbjct  1    KVTKKCFFDIEIDD---KPCGRIIIGLFGDTVPDTVENFRCLCTGERRFGYKGSAFHRVI  57

Query  563  KDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
             DFMIQGGDFD+ NGTGG SIYG TFKDENF L H G
Sbjct  58   NDFMIQGGDFDQRNGTGGYSIYGNTFKDENFNLRHTG  94



>gb|KGO76066.1| hypothetical protein PITC_006090 [Penicillium italicum]
Length=337

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = +2

Query  362  QVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfk  538
            +  EP+  K+TS+VYFDI  G+   ++ GRIV+GLYG  VP+TAENFRAL TGEKGFG++
Sbjct  93   EAKEPRGPKITSKVYFDIQHGD---ESLGRIVMGLYGKTVPETAENFRALATGEKGFGYQ  149

Query  539  gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
             S+FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  150  DSTFHRVIKDFMIQGGDFTKGDGTGGKSIYGNKFKDENFKLRH  192



>dbj|GAC97260.1| peptidyl-prolyl cis-trans isomerase [Pseudozyma hubeiensis SY62]
Length=186

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 84/107 (79%), Gaps = 5/107 (5%)
 Frame = +2

Query  356  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  535
            +A   EP   VT++VYFDIS  N   K  GRIV+GLYG++VP+TAENFRAL TGEKGFG+
Sbjct  5    SASTTEPV--VTTKVYFDISHDN---KDVGRIVLGLYGNDVPKTAENFRALATGEKGFGY  59

Query  536  kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            KGS FHRVI +FMIQGGDF++G+G GG SIYG  F DENFKL H GP
Sbjct  60   KGSKFHRVISNFMIQGGDFERGDGRGGYSIYGGKFDDENFKLKHTGP  106



>ref|XP_002796880.1| peptidyl-prolyl cis-trans isomerase B [Paracoccidioides sp. 'lutzii' 
Pb01]
 gb|EEH37818.1| peptidyl-prolyl cis-trans isomerase B [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=210

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 4/104 (4%)
 Frame = +2

Query  359  AQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  535
             Q AE +  K+T++VYFDI+ G+   K  GRIV+GLYG  VP+TAENFRAL TGEKGFG+
Sbjct  23   GQSAEAKGPKITNKVYFDITHGD---KPLGRIVMGLYGKSVPKTAENFRALATGEKGFGY  79

Query  536  kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            +GS+FHRVIKDFMIQGGDF  G+GTGG+SIYG  F DENFKL H
Sbjct  80   EGSTFHRVIKDFMIQGGDFTNGDGTGGRSIYGEKFADENFKLRH  123



>gb|AFK44786.1| unknown [Lotus japonicus]
Length=204

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 86/120 (72%), Gaps = 11/120 (9%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            LAP++A  +  E   +VT +V+FD+ I    GKAAGRIV+GLYG  VP+TAENFRALCTG
Sbjct  18   LAPIQA-KKSKEDLKEVTHKVFFDVEID---GKAAGRIVMGLYGKTVPKTAENFRALCTG  73

Query  518  Ekgfgfk-------gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKG G         GSSFHR+I  FMIQGGDF +GNG GG+SIYG  F DENFKL H GP
Sbjct  74   EKGIGKSGKPLHFKGSSFHRIIPSFMIQGGDFTQGNGMGGESIYGEKFPDENFKLKHTGP  133



>gb|EIT78368.1| peptidyl-prolyl cis-trans isomerase [Aspergillus oryzae 3.042]
 gb|KDE82694.1| peptidyl-prolyl cis-trans isomerase [Aspergillus oryzae 100-8]
Length=208

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  338  LAPVRATAQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT  514
            LA V A  +  +P+  K+TS+VYFDI  GN   K  GR+V+GLYG  VP+TAENFRAL T
Sbjct  18   LALVHA-EEANQPRGPKITSKVYFDIEHGN---KPLGRVVLGLYGKTVPKTAENFRALAT  73

Query  515  GEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            GEKGFG++GS+FHRVIK+FMIQGGDF +G+GTGGKSIYG  FKDENFK+ H
Sbjct  74   GEKGFGYEGSTFHRVIKEFMIQGGDFTRGDGTGGKSIYGEKFKDENFKIRH  124



>ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cicer 
arietinum]
Length=204

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 85/120 (71%), Gaps = 11/120 (9%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            LA ++A  +  E   +VT +VYFD+ I    GKAAGR+VIGLYG  VP+TAENFRALCTG
Sbjct  18   LALIQA-KKSKEDLKEVTHKVYFDVEID---GKAAGRVVIGLYGKTVPKTAENFRALCTG  73

Query  518  Ekgfgf-------kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKG G        KGSSFHR+I  FMIQGGDF  GNG GG+SIYG  F DENFKL H GP
Sbjct  74   EKGTGKNGKPLHYKGSSFHRIIPSFMIQGGDFTHGNGMGGESIYGEKFADENFKLKHTGP  133



>emb|CCO27209.1| peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [Rhizoctonia 
solani AG-1 IB]
Length=149

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 9/104 (9%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG------Ekgfgfkgs  544
            K+T +VYFDI  G+   K  GR+V+GL+G  VP+TAENFRALCTG      E GF +KGS
Sbjct  28   KITHKVYFDIKHGD---KELGRVVMGLFGGTVPKTAENFRALCTGVDKHGKELGFSYKGS  84

Query  545  sfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GP
Sbjct  85   TFHRVIKDFMIQGGDFTRGDGTGGKSIYGEKFADENFKLKHTGP  128



>ref|XP_002565809.1| Pc22g19060 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP99194.1| Pc22g19060 [Penicillium rubens Wisconsin 54-1255]
Length=265

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVI  562
            K+TS+VYFDI  G+   ++ GRIV+GLYG  VP+TAENFRAL TGEKGFG++ S+FHRVI
Sbjct  33   KITSKVYFDIQHGD---ESLGRIVMGLYGKTVPETAENFRALATGEKGFGYQDSTFHRVI  89

Query  563  KDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            KDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  90   KDFMIQGGDFTKGDGTGGKSIYGNKFKDENFKLRH  124



>ref|XP_003058664.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57119.1| predicted protein [Micromonas pusilla CCMP1545]
Length=217

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 3/98 (3%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVI  562
            K+T  V+FD++I    G+ AGRI +GLYG   P+TAENFRAL TGEKGFGFKGSSFHRVI
Sbjct  44   KITHTVFFDVAI---AGEPAGRIEMGLYGKTTPKTAENFRALATGEKGFGFKGSSFHRVI  100

Query  563  KDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            KDFMIQGGDF  G+GTGGKSIYG TF DENFKL H GP
Sbjct  101  KDFMIQGGDFTNGDGTGGKSIYGETFPDENFKLKHTGP  138



>ref|XP_007235156.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Astyanax mexicanus]
Length=216

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            L P  + A   +   KVT++VYFDI IG+   +  GRIVIGL+G  VP+TAENF AL TG
Sbjct  26   LFPNGSDADEKKKGPKVTAKVYFDIRIGD---EDVGRIVIGLFGKTVPKTAENFLALATG  82

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKGFG+KGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GP
Sbjct  83   EKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGP  135



>ref|XP_003626095.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=256

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 5/128 (4%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGD  472
            Q+F + S+     R +    A   V E Q+KVT++ +FD+  G   G++ GRIV+GL+G+
Sbjct  60   QQFGARSISYS--RRITCAAAAENVQELQAKVTTKCFFDVEAG---GESLGRIVLGLFGE  114

Query  473  EVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDEN  652
              P+T ENFRALCTG+KG+G+KG SFHR+IK+FMIQGGDF +GNGTGG SIYG +F+DE+
Sbjct  115  VAPKTVENFRALCTGDKGYGYKGCSFHRIIKEFMIQGGDFTEGNGTGGVSIYGSSFEDES  174

Query  653  FKLVHAGP  676
            F L H GP
Sbjct  175  FALKHVGP  182



>gb|KFH46236.1| Peptidyl-prolyl cis-trans isomerase B-like protein [Acremonium 
chrysogenum ATCC 11550]
Length=208

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 84/105 (80%), Gaps = 5/105 (5%)
 Frame = +2

Query  359  AQVAEPQS--KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            AQ AE     K+T +VYFDI  G+   +  GR+V+GLYG  VP+TAENFRAL TGEKGFG
Sbjct  23   AQTAEASKGPKITHKVYFDIQHGD---EPLGRVVMGLYGKTVPETAENFRALATGEKGFG  79

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            ++GS+FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  80   YEGSTFHRVIKDFMIQGGDFTKGDGTGGKSIYGNKFKDENFKLKH  124



>gb|EPS28743.1| hypothetical protein PDE_03689 [Penicillium oxalicum 114-2]
Length=213

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  338  LAPVRATAQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT  514
            LA V+A     EP+  KVT +VYFDI  G+   ++ GRIV GLYG  VP TAENFRAL T
Sbjct  18   LALVQA-EDAKEPRGPKVTHKVYFDIQHGD---ESLGRIVFGLYGKTVPLTAENFRALAT  73

Query  515  GEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            GEKGFG++GS+FHRVIKDFMIQGGDF   +GTGGKSIYG  FKDENFKL H
Sbjct  74   GEKGFGYEGSTFHRVIKDFMIQGGDFTNHDGTGGKSIYGNKFKDENFKLRH  124



>gb|AFK43472.1| unknown [Medicago truncatula]
 gb|AES82313.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=261

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 5/128 (4%)
 Frame = +2

Query  293  QKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGD  472
            Q+F + S+     R +    A   V E Q+KVT++ +FD+  G   G++ GRIV+GL+G+
Sbjct  65   QQFGARSISYS--RRITCAAAAENVQELQAKVTTKCFFDVEAG---GESLGRIVLGLFGE  119

Query  473  EVPQTAENFRALCTGEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDEN  652
              P+T ENFRALCTG+KG+G+KG SFHR+IK+FMIQGGDF +GNGTGG SIYG +F+DE+
Sbjct  120  VAPKTVENFRALCTGDKGYGYKGCSFHRIIKEFMIQGGDFTEGNGTGGVSIYGSSFEDES  179

Query  653  FKLVHAGP  676
            F L H GP
Sbjct  180  FALKHVGP  187



>gb|ACO10021.1| Peptidyl-prolyl cis-trans isomerase B precursor [Osmerus mordax]
Length=204

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            L P  + A   +   KV+++VYFDI IG+   +  GRIVIGL+G  VP+TAENF AL TG
Sbjct  26   LFPSGSDADEKKKGPKVSAKVYFDIRIGD---EDVGRIVIGLFGKTVPKTAENFMALATG  82

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKGFGFKGS FHRVIKDFMIQGGDF +G+G GGKSIYG  F DENFKL H GP
Sbjct  83   EKGFGFKGSKFHRVIKDFMIQGGDFTRGDGAGGKSIYGDRFPDENFKLKHYGP  135



>ref|NP_180557.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana]
 sp|Q8LDP4.2|CP19D_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP19-4; Short=PPIase 
CYP19-4; AltName: Full=Cyclophilin of 19 kDa 4; AltName: 
Full=Cyclophilin-5; AltName: Full=Rotamase CYP19-4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC31856.1| cyclophilin [Arabidopsis thaliana]
 gb|AAK96784.1| cyclophilin [Arabidopsis thaliana]
 gb|AAN15387.1| cyclophilin [Arabidopsis thaliana]
 gb|AEC08327.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana]
Length=201

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 81/115 (70%), Gaps = 10/115 (9%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            A+ Q  E   +VT +VYFD+ I    GK+AGR+VIGL+G  VP+TAENFRALCTGEKG G
Sbjct  19   ASIQAKEDLKEVTHKVYFDVEID---GKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVG  75

Query  533  fk-------gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
                     GS FHR+I  FMIQGGDF  GNG GG+SIYG+ F DENFKL H GP
Sbjct  76   KSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGP  130



>gb|AAM63088.1| cyclophilin [Arabidopsis thaliana]
Length=201

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 81/115 (70%), Gaps = 10/115 (9%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            A+ Q  E   +VT +VYFD+ I    GK+AGR+VIGL+G  VP+TAENFRALCTGEKG G
Sbjct  19   ASIQAKEDLKEVTHKVYFDVEID---GKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVG  75

Query  533  fk-------gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
                     GS FHR+I  FMIQGGDF  GNG GG+SIYG+ F DENFKL H GP
Sbjct  76   KSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGP  130



>ref|XP_010685556.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Beta 
vulgaris subsp. vulgaris]
Length=208

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 85/120 (71%), Gaps = 10/120 (8%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            LA ++A  Q +E   +VT +V+FD+ I    GK AGR+V+GL+G  VP+TAENFRALCTG
Sbjct  21   LAQIQAKKQSSEDLKEVTHKVFFDVEID---GKPAGRVVMGLFGKAVPKTAENFRALCTG  77

Query  518  Ekgfgfk-------gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKG           GS+FHR+I  FMIQGGDF +G+GTGG+SIYG  F DENFKL H GP
Sbjct  78   EKGVSKSGKPLHYKGSTFHRIIPSFMIQGGDFTRGDGTGGESIYGEKFADENFKLKHTGP  137



>emb|CDM27801.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain [Penicillium 
roqueforti FM164]
Length=265

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = +2

Query  362  QVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfk  538
            +  EP+  K+TS+VYFDI  G+   +  GRIV+GLYG  VP+TAENFRAL TGEKGFG++
Sbjct  25   EAKEPRGPKITSKVYFDIQHGD---EPLGRIVMGLYGKTVPETAENFRALATGEKGFGYQ  81

Query  539  gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
             S+FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  82   DSTFHRVIKDFMIQGGDFTKGDGTGGKSIYGNKFKDENFKLRH  124



>ref|NP_001077978.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana]
 gb|AEC08328.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana]
Length=191

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 82/115 (71%), Gaps = 10/115 (9%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            A+ Q  E   +VT +VYFD+ I    GK+AGR+VIGL+G  VP+TAENFRALCTGEKG G
Sbjct  19   ASIQAKEDLKEVTHKVYFDVEID---GKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVG  75

Query  533  f-------kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
                    KGS FHR+I  FMIQGGDF  GNG GG+SIYG+ F DENFKL H GP
Sbjct  76   KSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGP  130



>ref|XP_008797942.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Phoenix dactylifera]
Length=210

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 84/120 (70%), Gaps = 11/120 (9%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            LA ++A A   E   +VT +VYFDI IG   GK AGRIV+GL+G  VP+TAENFRALCTG
Sbjct  24   LALIQAKAS-KENLKEVTHKVYFDIEIG---GKPAGRIVMGLFGKTVPKTAENFRALCTG  79

Query  518  Ekgfgfk-------gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKG G         GS+FHR+I  FMIQGGDF  G+G GG+SIYG  F DENFKL H GP
Sbjct  80   EKGSGKSGKPLHYKGSTFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFADENFKLKHTGP  139



>gb|KGO40196.1| hypothetical protein PEXP_035800 [Penicillium expansum]
 gb|KGO53041.1| hypothetical protein PEX2_056840 [Penicillium expansum]
 gb|KGO63470.1| hypothetical protein PEX1_089310 [Penicillium expansum]
Length=268

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = +2

Query  362  QVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfk  538
            +  EP+  K+TS+VYFDI  G+   ++ GRIV+GLYG  VP+T ENFRAL TGEKGFG++
Sbjct  25   EAKEPRGPKITSKVYFDIQHGD---ESLGRIVMGLYGKTVPETTENFRALATGEKGFGYQ  81

Query  539  gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
             S+FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  82   DSTFHRVIKDFMIQGGDFTKGDGTGGKSIYGNKFKDENFKLRH  124



>ref|XP_002881077.1| cyclophilin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57336.1| cyclophilin [Arabidopsis lyrata subsp. lyrata]
Length=201

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 81/115 (70%), Gaps = 10/115 (9%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            A  Q  E   ++T +VYFD+ I    GK+AGR+VIGL+G  VP+TAENFRALCTGEKG G
Sbjct  19   ALIQAKEDLKEITHKVYFDVEID---GKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVG  75

Query  533  fk-------gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
                     GS FHR+I  FMIQGGDF  GNG GG+SIYG+ F+DENFKL H GP
Sbjct  76   KSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFEDENFKLKHTGP  130



>ref|XP_001401570.2| peptidyl-prolyl cis-trans isomerase B [Aspergillus niger CBS 
513.88]
 sp|Q8X166.1|PPIB_ASPNG RecName: Full=Peptidyl-prolyl cis-trans isomerase B; Short=PPIase 
B; AltName: Full=Rotamase B; Flags: Precursor [Aspergillus 
niger]
 gb|AAF98447.1| cyclophilin-like peptidyl prolyl cis-trans isomerase [Aspergillus 
niger]
 gb|EHA20483.1| hypothetical protein ASPNIDRAFT_213198 [Aspergillus niger ATCC 
1015]
Length=212

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 4/104 (4%)
 Frame = +2

Query  359  AQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  535
            A+ A+P+  K+TS+V+FDI  G+   K  GR+V+GLYG  VP+TAENFRAL TGEKGFG+
Sbjct  23   AEDAQPRGPKITSKVFFDIEHGD---KPLGRVVLGLYGKTVPKTAENFRALATGEKGFGY  79

Query  536  kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            +GS+FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H
Sbjct  80   EGSTFHRVIKDFMIQGGDFTRGDGTGGKSIYGEKFADENFKLRH  123



>gb|AAB71401.1| cyclophilin [Arabidopsis thaliana]
Length=201

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 81/115 (70%), Gaps = 10/115 (9%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            A+ Q  E   ++T +VYFD+ I    GK+AGR+VIGL+G  VP+TAENFRALCTGEKG G
Sbjct  19   ASIQAKEDLKEITHKVYFDVEID---GKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVG  75

Query  533  fk-------gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
                     GS FHR+I  FMIQGGDF  GNG GG+SIYG+ F DENFKL H GP
Sbjct  76   KSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGP  130



>ref|XP_007876711.1| hypothetical protein PFL1_01020 [Pseudozyma flocculosa PF-1]
 gb|EPQ31687.1| hypothetical protein PFL1_01020 [Pseudozyma flocculosa PF-1]
Length=317

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 5/113 (4%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            L    + A   EP  KVT++VYFD+      GK  GRIV+GLYGD VP+T ENFRAL TG
Sbjct  18   LLSFSSNASTQEP--KVTNKVYFDME---HDGKHIGRIVMGLYGDVVPKTVENFRALATG  72

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKG+G+K S+FHRVIK+FMIQGGDF  GNGTGGKSIYG  F+DENF L H GP
Sbjct  73   EKGYGYKDSTFHRVIKNFMIQGGDFTNGNGTGGKSIYGNKFEDENFTLKHTGP  125



>ref|XP_008777294.1| PREDICTED: peptidyl-prolyl cis-trans isomerase A1-like isoform 
X2 [Phoenix dactylifera]
Length=272

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +2

Query  353  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            A  +  E Q+KVT + +FD+ IG   G+  GRI++GLYG+ VP+T ENFRALCTGEKGFG
Sbjct  92   AEKEGVELQAKVTKKCFFDVEIG---GEPVGRILMGLYGEVVPRTVENFRALCTGEKGFG  148

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +KG SFHR+IKDFMIQGGDFD GNGTGG+SIYG  F DE+F L H GP
Sbjct  149  YKGCSFHRIIKDFMIQGGDFDHGNGTGGRSIYGPRFDDESFTLKHIGP  196



>ref|NP_998184.1| peptidyl-prolyl cis-trans isomerase B [Danio rerio]
 gb|AAH59560.1| Ppib protein [Danio rerio]
 gb|AAH71458.1| Peptidylprolyl isomerase B (cyclophilin B) [Danio rerio]
 gb|AAI53470.1| Ppib protein [Danio rerio]
 gb|AAI54214.1| Peptidylprolyl isomerase B (cyclophilin B) [Danio rerio]
Length=216

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  517
            L P    A   +   KVT++VYFDI IG+   + AGRIVIGL+G  VP+T ENF  L TG
Sbjct  26   LFPSETEADEKKKGPKVTAKVYFDIKIGD---EDAGRIVIGLFGKTVPKTTENFLQLATG  82

Query  518  EkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            EKGFG+KGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GP
Sbjct  83   EKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGP  135



>emb|CDS10860.1| hypothetical protein LRAMOSA11346 [Absidia idahoensis var. thermophila]
Length=204

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +2

Query  386  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIK  565
            VT++VYFDI  G+   +  GRIVIGLYG  VP+TAENFRAL TGEKG+G+KGS FHRVIK
Sbjct  31   VTNKVYFDIKQGD---EDLGRIVIGLYGKTVPKTAENFRALATGEKGYGYKGSKFHRVIK  87

Query  566  DFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
             FMIQGGDF  G+GTGGKSIYG  F+DENFKL H GP
Sbjct  88   QFMIQGGDFTNGDGTGGKSIYGGKFEDENFKLQHTGP  124



>gb|KIN03862.1| hypothetical protein OIDMADRAFT_18066 [Oidiodendron maius Zn]
Length=208

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 5/106 (5%)
 Frame = +2

Query  359  AQVAEPQS--KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  532
            AQ AE     K+T++VYFDIS G+   ++ GRIVIGLYG  VP+TAENFRAL TGE GFG
Sbjct  23   AQTAEAVKGPKITNKVYFDISHGD---ESLGRIVIGLYGKTVPKTAENFRALATGENGFG  79

Query  533  fkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHA  670
            ++GS+FHRVIK+FMIQGGDF KG+GTGGKSIYG  F DENFKL H+
Sbjct  80   YEGSTFHRVIKNFMIQGGDFTKGDGTGGKSIYGDKFPDENFKLKHS  125



>ref|XP_003067447.1| cyclophilin B, putative [Coccidioides posadasii C735 delta SOWgp]
 gb|EER25302.1| cyclophilin B, putative [Coccidioides posadasii C735 delta SOWgp]
 gb|EAS28354.2| peptidyl-prolyl cis-trans isomerase B [Coccidioides immitis RS]
Length=206

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVI  562
            KVT++VYFDI  G+   K  GRIV+GLYG  VP+TAENFRAL TGEKGFG++GS+FHRVI
Sbjct  31   KVTNKVYFDIEHGD---KPMGRIVLGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRVI  87

Query  563  KDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            KDFMIQGGDF   +GTGGKSIYG+ F DENFKL H
Sbjct  88   KDFMIQGGDFTNHDGTGGKSIYGQKFPDENFKLRH  122



>gb|EFO27785.2| cyclophilin-type peptidyl-prolyl cis-trans isomerase-15 [Loa 
loa]
Length=203

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 3/102 (3%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+    VT +VYFDI+IG   G+  GRI IGL+G++VP+T ENFRAL TGEKGFG+KGS 
Sbjct  20   AKETVTVTKKVYFDIAIG---GEKVGRIEIGLFGNDVPKTTENFRALATGEKGFGYKGSK  76

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
            FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H G
Sbjct  77   FHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFDDENFKLKHYG  118



>gb|EFW19740.1| cyclophilin type peptidyl-prolyl cis-trans isomerase [Coccidioides 
posadasii str. Silveira]
Length=206

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVI  562
            KVT++VYFDI  G+   K  GRIV+GLYG  VP+TAENFRAL TGEKGFG++GS+FHRVI
Sbjct  31   KVTNKVYFDIEHGD---KPMGRIVLGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRVI  87

Query  563  KDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            KDFMIQGGDF   +GTGGKSIYG+ F DENFKL H
Sbjct  88   KDFMIQGGDFTNHDGTGGKSIYGQKFPDENFKLRH  122



>gb|EYB84042.1| hypothetical protein Y032_0323g2468 [Ancylostoma ceylanicum]
Length=202

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +2

Query  386  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVIK  565
            VT QVYFDI+IG   GK AGRIVIGL+G+ VP+T ENF  L TG KG+G+KGS FHRVIK
Sbjct  24   VTKQVYFDITIG---GKPAGRIVIGLFGNVVPKTTENFLQLATGAKGYGYKGSKFHRVIK  80

Query  566  DFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            DFMIQGGDF +G+GTGGKSIYG  FKDENF L H GP
Sbjct  81   DFMIQGGDFTRGDGTGGKSIYGDRFKDENFVLSHYGP  117



>ref|XP_001775768.1| predicted protein [Physcomitrella patens]
 gb|EDQ59451.1| predicted protein, partial [Physcomitrella patens]
Length=168

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 84/100 (84%), Gaps = 4/100 (4%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q+KVT + YFDI I    GK AGRIV+GL+GD VP+T ENF ALCTGEKGFG++GS+FHR
Sbjct  1    QAKVTKKCYFDIEID---GKPAGRIVLGLFGDVVPRTVENFAALCTGEKGFGYQGSAFHR  57

Query  557  VIKDFMIQggdfdkgngtggkSIYG-RTFKDENFKLVHAG  673
            VIK+FMIQGGDFDKGNGTGG S++G + FKDENFKL H G
Sbjct  58   VIKNFMIQGGDFDKGNGTGGYSVFGTKNFKDENFKLKHTG  97



>ref|XP_011398089.1| Peptidyl-prolyl cis-trans isomerase B [Auxenochlorella protothecoides]
 gb|KFM25198.1| Peptidyl-prolyl cis-trans isomerase B [Auxenochlorella protothecoides]
Length=223

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = +2

Query  359  AQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfk  538
            A  A  +  VT  VYFDI+IG   GK  GRI IGLYGD+VP+TAENFR L  G+    +K
Sbjct  51   AAGAGDRGPVTKTVYFDITIG---GKPEGRITIGLYGDDVPKTAENFRTLAVGKGELTYK  107

Query  539  gssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            GS FHRVI DFMIQGGDF   NGTGGKSIYGRTF DENFK  H
Sbjct  108  GSPFHRVIPDFMIQGGDFTNQNGTGGKSIYGRTFPDENFKFKH  150



>ref|XP_001271658.1| peptidyl-prolyl cis-trans isomerase (CypB), putative [Aspergillus 
clavatus NRRL 1]
 gb|EAW10232.1| peptidyl-prolyl cis-trans isomerase (CypB), putative [Aspergillus 
clavatus NRRL 1]
Length=213

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  338  LAPVRATAQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT  514
            LA V A A+  EP+  K+T++VYFDI  G+   K  GRIV+GLYG  VP+TAENFRAL T
Sbjct  18   LALVHA-AESKEPRGPKITTKVYFDIEHGD---KPLGRIVMGLYGKTVPKTAENFRALAT  73

Query  515  GEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            GEKGFG++GS+FHRVI DFMIQGGDF +G+GTGGKSIYG  F DENFK+ H
Sbjct  74   GEKGFGYEGSTFHRVINDFMIQGGDFTRGDGTGGKSIYGEKFADENFKIRH  124



>gb|KJB34586.1| hypothetical protein B456_006G106600 [Gossypium raimondii]
Length=162

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 79/109 (72%), Gaps = 10/109 (9%)
 Frame = +2

Query  371  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf-----  535
            E   +VT +VYFD+ I    GK AGRIVIGL+G  VP+TAENFRALCTGEKG G      
Sbjct  31   EDLKEVTHKVYFDVEI---AGKPAGRIVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPL  87

Query  536  --kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
              KGS+FHR+I +FMIQGGDF  G+G GG+SIYG  F DENFKL H GP
Sbjct  88   HFKGSAFHRIIPNFMIQGGDFTLGDGRGGESIYGEKFADENFKLKHTGP  136



>ref|XP_006260964.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Alligator mississippiensis]
Length=231

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 3/98 (3%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVI  562
            KVT++VYFD+SIG    +A GR+VIGL+G  VP+T ENF AL TGEKGFGFKGS FHRVI
Sbjct  56   KVTAKVYFDLSIGE---EAVGRVVIGLFGKTVPKTVENFVALATGEKGFGFKGSKFHRVI  112

Query  563  KDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            KDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GP
Sbjct  113  KDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGP  150



>ref|XP_008343225.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X1 
[Malus domestica]
Length=255

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q+ VT++ +FDI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG S HR
Sbjct  85   QATVTTKCFFDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKGCSXHR  141

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GP
Sbjct  142  IIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGP  181



>ref|XP_008343228.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X4 
[Malus domestica]
Length=249

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q+ VT++ +FDI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG S HR
Sbjct  79   QATVTTKCFFDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKGCSXHR  135

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GP
Sbjct  136  IIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGP  175



>ref|XP_003136287.1| cyclophilin-type peptidyl-prolyl cis-trans isomerase-15 [Loa 
loa]
Length=222

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 3/102 (3%)
 Frame = +2

Query  368  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  547
            A+    VT +VYFDI+IG   G+  GRI IGL+G++VP+T ENFRAL TGEKGFG+KGS 
Sbjct  20   AKETVTVTKKVYFDIAIG---GEKVGRIEIGLFGNDVPKTTENFRALATGEKGFGYKGSK  76

Query  548  fHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
            FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H G
Sbjct  77   FHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFDDENFKLKHYG  118



>ref|XP_008343227.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X3 
[Malus domestica]
Length=251

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q+ VT++ +FDI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG S HR
Sbjct  81   QATVTTKCFFDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKGCSXHR  137

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GP
Sbjct  138  IIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGP  177



>ref|XP_008343226.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X2 
[Malus domestica]
Length=253

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q+ VT++ +FDI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG S HR
Sbjct  83   QATVTTKCFFDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKGCSXHR  139

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GP
Sbjct  140  IIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGP  179



>ref|XP_780268.2| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like isoform 
1 [Strongylocentrotus purpuratus]
Length=217

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 4/113 (4%)
 Frame = +2

Query  338  LAPVRATAQVAEPQSK-VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT  514
            L P  A A+ A  ++  VT +V+FDI+IG+   +  GRIVIGL+G  VP+TA+NF  L T
Sbjct  24   LMPADAEAKEATKKNALVTDKVFFDITIGD---EKTGRIVIGLFGQTVPKTAKNFIGLAT  80

Query  515  GEkgfgfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAG  673
            GEKGFG+KGS FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H G
Sbjct  81   GEKGFGYKGSKFHRVIKDFMIQGGDFTKGDGTGGKSIYGDKFKDENFKLSHYG  133



>gb|EST06371.1| cyclophilin [Pseudozyma brasiliensis GHG001]
Length=206

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  374  PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfH  553
            P+  VT +VYFDIS  N   K  GRI +GLYG++VP+TAENFRAL TGEKGFG+KGS FH
Sbjct  32   PEPVVTHKVYFDISHDN---KDVGRITLGLYGNDVPRTAENFRALATGEKGFGYKGSKFH  88

Query  554  RVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            RVI +FMIQGGDF++G+G GG SIYG  F DENFKL H GP
Sbjct  89   RVINNFMIQGGDFERGDGRGGYSIYGGKFDDENFKLKHTGP  129



>gb|EYE94910.1| hypothetical protein EURHEDRAFT_412752 [Aspergillus ruber CBS 
135680]
Length=266

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = +2

Query  383  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHRVI  562
            KVTS+VYFDI  G+   K  GRIV+GLYG  VP+TAENFRAL TGEKGFG++GSSFHRVI
Sbjct  33   KVTSKVYFDIEHGD---KPLGRIVLGLYGKTVPKTAENFRALATGEKGFGYEGSSFHRVI  89

Query  563  KDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            KDFMIQGGDF +G+GTGGKSIYG  F+DENFK+ H
Sbjct  90   KDFMIQGGDFTRGDGTGGKSIYGNKFEDENFKIRH  124



>gb|AHK24889.1| peptidyl-prolyl cis-trans isomerase, partial [Lilium lancifolium]
Length=172

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = +2

Query  377  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssfHR  556
            Q++VT++ +FD+ IG   G+  GRIV+GL+G  VP+T ENFRALCTGE GFG+KG SFHR
Sbjct  2    QAEVTTKCFFDVEIG---GEPVGRIVLGLFGKVVPKTVENFRALCTGENGFGYKGCSFHR  58

Query  557  VIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVHAGP  676
            +IKDFMIQGGDF++GNGTGG+SIYG  F+DE F L H GP
Sbjct  59   IIKDFMIQGGDFERGNGTGGRSIYGSKFEDEGFTLNHVGP  98



>emb|CAL00689.1| unnamed protein product [Aspergillus niger]
Length=271

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 4/104 (4%)
 Frame = +2

Query  359  AQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  535
            A+ A+P+  K+TS+V+FDI  G+   K  GR+V+GLYG  VP+TAENFRAL TGEKGFG+
Sbjct  23   AEDAQPRGPKITSKVFFDIEHGD---KPLGRVVLGLYGKTVPKTAENFRALATGEKGFGY  79

Query  536  kgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            +GS+FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H
Sbjct  80   EGSTFHRVIKDFMIQGGDFTRGDGTGGKSIYGEKFADENFKLRH  123



>gb|KIW62098.1| peptidyl-prolyl cis-trans isomerase B, variant 1 [Exophiala xenobiotica]
 gb|KIW62099.1| peptidyl-prolyl cis-trans isomerase B, variant 2 [Exophiala xenobiotica]
Length=212

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = +2

Query  359  AQVAEPQS--KVTSQVYFDISIGN-PVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  529
             Q AE     K+T +VYFDI  G+ PVG    RIV+GLYG  VP+TAENFRAL TGEKGF
Sbjct  27   GQTAEAAKGPKITHKVYFDIEHGDEPVG----RIVLGLYGKTVPKTAENFRALATGEKGF  82

Query  530  gfkgssfHRVIKDFMIQggdfdkgngtggkSIYGRTFKDENFKLVH  667
            G++GSSFHRVIKDFMIQGGDF KG+GTGGKSIYG  F+DENFKL H
Sbjct  83   GYEGSSFHRVIKDFMIQGGDFTKGDGTGGKSIYGDKFEDENFKLKH  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240