BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038G08

Length=624
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622553.1|  PREDICTED: 60S ribosomal protein L13a-4-like       365   2e-125   Nicotiana tomentosiformis
ref|XP_009789164.1|  PREDICTED: 60S ribosomal protein L13a-1            365   2e-125   Nicotiana sylvestris
ref|XP_009795999.1|  PREDICTED: 60S ribosomal protein L13a-4-like       364   4e-125   Nicotiana sylvestris
ref|XP_006349931.1|  PREDICTED: 60S ribosomal protein L13a-4-like       364   4e-125   Solanum tuberosum [potatoes]
ref|NP_001275476.1|  60S ribosomal protein L13a-4-like                  363   6e-125   Solanum tuberosum [potatoes]
ref|XP_004252998.1|  PREDICTED: 60S ribosomal protein L13a-4            363   1e-124   Solanum lycopersicum
ref|XP_009596414.1|  PREDICTED: 60S ribosomal protein L13a-4            363   1e-124   Nicotiana tomentosiformis
ref|XP_011073788.1|  PREDICTED: 60S ribosomal protein L13a-4            363   1e-124   Sesamum indicum [beniseed]
ref|XP_004239861.1|  PREDICTED: 60S ribosomal protein L13a-4-like       363   1e-124   Solanum lycopersicum
ref|XP_009625303.1|  PREDICTED: 60S ribosomal protein L13a-4-like       362   3e-124   Nicotiana tomentosiformis
gb|AAR89618.1|  60S ribosomal protein L13a                              362   6e-124   Capsicum annuum
ref|XP_009765513.1|  PREDICTED: 60S ribosomal protein L13a-4            361   7e-124   Nicotiana sylvestris
gb|EYU32659.1|  hypothetical protein MIMGU_mgv1a013922mg                360   9e-124   Erythranthe guttata [common monkey flower]
gb|EYU31410.1|  hypothetical protein MIMGU_mgv1a013934mg                360   1e-123   Erythranthe guttata [common monkey flower]
gb|AHE13806.1|  ribosomal protein L13a                                  360   2e-123   Solanum torvum [berenjena cimarrona]
ref|XP_007223449.1|  hypothetical protein PRUPE_ppa011551mg             359   3e-123   Prunus persica
ref|XP_011091425.1|  PREDICTED: 60S ribosomal protein L13a-4-like       358   6e-123   Sesamum indicum [beniseed]
ref|XP_002267491.1|  PREDICTED: 60S ribosomal protein L13a-4            358   1e-122   Vitis vinifera
ref|XP_004247847.1|  PREDICTED: 60S ribosomal protein L13a-4            358   1e-122   Solanum lycopersicum
emb|CDP03876.1|  unnamed protein product                                358   1e-122   Coffea canephora [robusta coffee]
ref|XP_010277234.1|  PREDICTED: 60S ribosomal protein L13a-4            357   1e-122   Nelumbo nucifera [Indian lotus]
ref|XP_002518107.1|  60S ribosomal protein L13a, putative               357   2e-122   Ricinus communis
ref|XP_004133995.1|  PREDICTED: 60S ribosomal protein L13a-2-like       357   3e-122   Cucumis sativus [cucumbers]
gb|KHG08426.1|  60S ribosomal L13a-4 -like protein                      357   4e-122   Gossypium arboreum [tree cotton]
ref|XP_004154636.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    358   4e-122   
gb|KHG07795.1|  60S ribosomal L13a-4 -like protein                      356   4e-122   Gossypium arboreum [tree cotton]
ref|XP_002268901.1|  PREDICTED: 60S ribosomal protein L13a-4            356   6e-122   Vitis vinifera
ref|XP_009374600.1|  PREDICTED: 60S ribosomal protein L13a-4            356   6e-122   Pyrus x bretschneideri [bai li]
ref|XP_010937848.1|  PREDICTED: 60S ribosomal protein L13a-4            356   7e-122   Elaeis guineensis
ref|XP_010920859.1|  PREDICTED: 60S ribosomal protein L13a-4-like       356   7e-122   Elaeis guineensis
gb|ADR71263.1|  60S ribosomal protein L13aA                             355   8e-122   Hevea brasiliensis [jebe]
ref|XP_008348430.1|  PREDICTED: 60S ribosomal protein L13a-4            355   1e-121   Malus domestica [apple tree]
ref|XP_004154637.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    355   1e-121   
ref|XP_006298559.1|  hypothetical protein CARUB_v10014643mg             355   1e-121   Capsella rubella
gb|KHG26825.1|  60S ribosomal L13a-4 -like protein                      355   1e-121   Gossypium arboreum [tree cotton]
ref|XP_004138959.1|  PREDICTED: 60S ribosomal protein L13a-4-like       355   1e-121   
gb|ACJ02350.1|  60S ribosomal protein L13A                              355   1e-121   Vernicia fordii [tung oil tree]
ref|XP_008793237.1|  PREDICTED: 60S ribosomal protein L13a-4            355   1e-121   Phoenix dactylifera
ref|XP_008356990.1|  PREDICTED: 60S ribosomal protein L13a-4            355   2e-121   Malus domestica [apple tree]
ref|XP_010023711.1|  PREDICTED: 60S ribosomal protein L13a-4-like       355   2e-121   Eucalyptus grandis [rose gum]
ref|XP_010279449.1|  PREDICTED: 60S ribosomal protein L13a-4-like       355   2e-121   Nelumbo nucifera [Indian lotus]
ref|XP_009392721.1|  PREDICTED: 60S ribosomal protein L13a-4-like       355   2e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004297119.1|  PREDICTED: 60S ribosomal protein L13a-4-like       355   2e-121   Fragaria vesca subsp. vesca
ref|XP_004288082.1|  PREDICTED: 60S ribosomal protein L13a-4            355   2e-121   Fragaria vesca subsp. vesca
ref|XP_010245584.1|  PREDICTED: 60S ribosomal protein L13a-4-like       355   2e-121   Nelumbo nucifera [Indian lotus]
ref|XP_010466918.1|  PREDICTED: 60S ribosomal protein L13a-2-like       355   2e-121   Camelina sativa [gold-of-pleasure]
gb|KJB30129.1|  hypothetical protein B456_005G130900                    354   2e-121   Gossypium raimondii
ref|XP_010524687.1|  PREDICTED: 60S ribosomal protein L13a-1            354   3e-121   Tarenaya hassleriana [spider flower]
gb|KJB72096.1|  hypothetical protein B456_011G159000                    354   3e-121   Gossypium raimondii
ref|XP_009136093.1|  PREDICTED: 60S ribosomal protein L13a-2            354   3e-121   Brassica rapa
ref|XP_010439646.1|  PREDICTED: 60S ribosomal protein L13a-4            354   3e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010488596.1|  PREDICTED: 60S ribosomal protein L13a-2            354   3e-121   Camelina sativa [gold-of-pleasure]
ref|XP_009112682.1|  PREDICTED: 60S ribosomal protein L13a-2-like       354   3e-121   Brassica rapa
ref|XP_009102457.1|  PREDICTED: 60S ribosomal protein L13a-2-like       354   4e-121   Brassica rapa
emb|CDY52083.1|  BnaCnng21840D                                          354   5e-121   Brassica napus [oilseed rape]
ref|XP_007034382.1|  Ribosomal protein L13 family protein isoform 1     354   5e-121   
ref|XP_009404653.1|  PREDICTED: 60S ribosomal protein L13a-4-like       353   5e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403869.1|  PREDICTED: 60S ribosomal protein L13a-4-like       353   5e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010069656.1|  PREDICTED: 60S ribosomal protein L13a-2            353   6e-121   Eucalyptus grandis [rose gum]
gb|KDP39375.1|  hypothetical protein JCGZ_01132                         353   7e-121   Jatropha curcas
ref|NP_189127.1|  60S ribosomal protein L13a-2                          353   7e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532891.1|  PREDICTED: 60S ribosomal protein L13a-2-like       353   9e-121   Tarenaya hassleriana [spider flower]
ref|XP_006418685.1|  hypothetical protein EUTSA_v10002667mg             353   1e-120   Eutrema salsugineum [saltwater cress]
gb|AAL87341.1|  putative 60S ribosomal protein                          353   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006840139.1|  hypothetical protein AMTR_s00089p00040540          353   1e-120   Amborella trichopoda
ref|XP_010482144.1|  PREDICTED: 60S ribosomal protein L13a-4-like       352   1e-120   Camelina sativa [gold-of-pleasure]
ref|XP_006407868.1|  hypothetical protein EUTSA_v10021532mg             352   1e-120   Eutrema salsugineum [saltwater cress]
ref|XP_010440660.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    352   1e-120   Camelina sativa [gold-of-pleasure]
ref|XP_009111853.1|  PREDICTED: 60S ribosomal protein L13a-4            352   2e-120   Brassica rapa
ref|XP_009421391.1|  PREDICTED: 60S ribosomal protein L13a-4            352   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002865669.1|  60S ribosomal protein L13A                         352   2e-120   
ref|XP_010552053.1|  PREDICTED: 60S ribosomal protein L13a-2-like       352   3e-120   Tarenaya hassleriana [spider flower]
ref|XP_009129745.1|  PREDICTED: 60S ribosomal protein L13a-4-like       352   3e-120   Brassica rapa
emb|CDY33947.1|  BnaA02g30400D                                          352   3e-120   Brassica napus [oilseed rape]
ref|XP_006281111.1|  hypothetical protein CARUB_v10027141mg             352   4e-120   Capsella rubella
ref|XP_008789105.1|  PREDICTED: 60S ribosomal protein L13a-4-like       352   4e-120   Phoenix dactylifera
ref|NP_187367.1|  60S ribosomal protein L13a-1                          351   4e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923627.1|  PREDICTED: 60S ribosomal protein L13a-2-like       353   5e-120   Elaeis guineensis
ref|XP_006395114.1|  hypothetical protein EUTSA_v10004924mg             351   5e-120   Eutrema salsugineum [saltwater cress]
ref|XP_010069043.1|  PREDICTED: 60S ribosomal protein L13a-3            351   5e-120   Eucalyptus grandis [rose gum]
ref|XP_010527234.1|  PREDICTED: 60S ribosomal protein L13a-2-like       351   5e-120   Tarenaya hassleriana [spider flower]
ref|XP_006298567.1|  hypothetical protein CARUB_v10014649mg             351   6e-120   Capsella rubella
gb|KFK38165.1|  hypothetical protein AALP_AA3G077500                    350   8e-120   Arabis alpina [alpine rockcress]
ref|XP_006420899.1|  hypothetical protein CICLE_v10005900mg             350   9e-120   Citrus clementina [clementine]
ref|XP_011045655.1|  PREDICTED: 60S ribosomal protein L13a-2            350   1e-119   Populus euphratica
ref|NP_199687.1|  60S ribosomal protein L13a-4                          350   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448678.1|  PREDICTED: 60S ribosomal protein L13a-1            350   1e-119   Camelina sativa [gold-of-pleasure]
ref|XP_009405822.1|  PREDICTED: 60S ribosomal protein L13a-4-like       350   1e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786013.1|  PREDICTED: 60S ribosomal protein L13a-4-like       350   1e-119   Phoenix dactylifera
ref|XP_006369799.1|  60S ribosomal protein L13a-2                       350   1e-119   Populus trichocarpa [western balsam poplar]
ref|XP_002323772.1|  ribosomal protein L13a                             350   1e-119   Populus trichocarpa [western balsam poplar]
ref|XP_009151676.1|  PREDICTED: 60S ribosomal protein L13a-4            350   1e-119   Brassica rapa
ref|XP_002883564.1|  60S ribosomal protein L13A                         350   1e-119   Arabidopsis lyrata subsp. lyrata
ref|XP_010937601.1|  PREDICTED: 60S ribosomal protein L13a-2-like       350   2e-119   Elaeis guineensis
ref|XP_010464292.1|  PREDICTED: 60S ribosomal protein L13a-1-like       350   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_010513787.1|  PREDICTED: 60S ribosomal protein L13a-2-like       348   5e-119   Camelina sativa [gold-of-pleasure]
gb|KFK39804.1|  hypothetical protein AALP_AA3G290300                    348   8e-119   Arabis alpina [alpine rockcress]
gb|EPS58218.1|  hypothetical protein M569_16597                         348   8e-119   Genlisea aurea
gb|KHG16481.1|  60S ribosomal L13a-4 -like protein                      348   1e-118   Gossypium arboreum [tree cotton]
ref|XP_002882511.1|  structural constituent of ribosome                 347   1e-118   
ref|XP_010110069.1|  60S ribosomal protein L13a-3                       347   1e-118   Morus notabilis
gb|AFK44939.1|  unknown                                                 347   1e-118   Lotus japonicus
ref|XP_002863167.1|  predicted protein                                  347   2e-118   Arabidopsis lyrata subsp. lyrata
gb|KFK39801.1|  hypothetical protein AALP_AA3G289800                    347   2e-118   Arabis alpina [alpine rockcress]
ref|XP_002521095.1|  60S ribosomal protein L13a, putative               347   2e-118   Ricinus communis
ref|NP_001030654.1|  60S ribosomal protein L13a-1                       347   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193053.1|  60S ribosomal protein L13a-3                          347   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284504.1|  hypothetical protein CARUB_v10005705mg             347   3e-118   
ref|XP_004499225.1|  PREDICTED: 60S ribosomal protein L13a-4-like       347   3e-118   Cicer arietinum [garbanzo]
ref|XP_007049776.1|  Ribosomal protein L13 family protein               346   4e-118   Theobroma cacao [chocolate]
ref|XP_011041875.1|  PREDICTED: 60S ribosomal protein L13a-1-like       346   5e-118   Populus euphratica
ref|XP_006650608.1|  PREDICTED: 60S ribosomal protein L13a-4-like       346   6e-118   Oryza brachyantha
gb|KJB10146.1|  hypothetical protein B456_001G186700                    346   6e-118   Gossypium raimondii
gb|KDO61166.1|  hypothetical protein CISIN_1g028623mg                   345   1e-117   Citrus sinensis [apfelsine]
ref|XP_008805147.1|  PREDICTED: 60S ribosomal protein L13a-2-like       345   1e-117   Phoenix dactylifera
gb|KHF97469.1|  60S ribosomal L13a-4 -like protein                      345   2e-117   Gossypium arboreum [tree cotton]
gb|KJB42469.1|  hypothetical protein B456_007G154600                    344   2e-117   Gossypium raimondii
ref|XP_003559332.1|  PREDICTED: 60S ribosomal protein L13a-4            343   6e-117   Brachypodium distachyon [annual false brome]
ref|XP_003616742.1|  60S ribosomal protein L13A                         343   8e-117   Medicago truncatula
ref|XP_006479280.1|  PREDICTED: 60S ribosomal protein L13a-4-like       343   9e-117   Citrus sinensis [apfelsine]
ref|NP_001130808.1|  uncharacterized protein LOC100191912               342   2e-116   Zea mays [maize]
ref|XP_010435310.1|  PREDICTED: 60S ribosomal protein L13a-3-like       342   2e-116   Camelina sativa [gold-of-pleasure]
gb|KHG00254.1|  60S ribosomal L13a-4 -like protein                      342   2e-116   Gossypium arboreum [tree cotton]
gb|AFK34830.1|  unknown                                                 342   3e-116   Medicago truncatula
gb|KDP26388.1|  hypothetical protein JCGZ_17546                         341   6e-116   Jatropha curcas
ref|XP_006586250.1|  PREDICTED: 60S ribosomal protein L13a-4-like       341   6e-116   Glycine max [soybeans]
ref|XP_002466431.1|  hypothetical protein SORBIDRAFT_01g007690          340   8e-116   Sorghum bicolor [broomcorn]
ref|NP_001235102.1|  uncharacterized protein LOC100499978               340   1e-115   Glycine max [soybeans]
ref|NP_001051314.1|  Os03g0756000                                       340   1e-115   
gb|ACF79169.1|  unknown                                                 340   1e-115   Zea mays [maize]
ref|NP_001281205.1|  60S ribosomal protein L13a                         340   2e-115   Zea mays [maize]
ref|NP_001276138.1|  60S ribosomal protein L13a-4-like                  340   2e-115   
ref|XP_004981725.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    339   2e-115   Setaria italica
ref|XP_007140600.1|  hypothetical protein PHAVU_008G125900g             339   4e-115   Phaseolus vulgaris [French bean]
gb|KHN07182.1|  60S ribosomal protein L13a-1                            338   8e-115   Glycine soja [wild soybean]
ref|XP_011024678.1|  PREDICTED: 60S ribosomal protein L13a-4-like       338   8e-115   Populus euphratica
gb|ACG36118.1|  60S ribosomal protein L13a                              337   1e-114   Zea mays [maize]
ref|XP_007200528.1|  hypothetical protein PRUPE_ppa011553mg             337   2e-114   Prunus persica
ref|XP_002439183.1|  hypothetical protein SORBIDRAFT_09g001930          337   2e-114   Sorghum bicolor [broomcorn]
ref|XP_010547080.1|  PREDICTED: 60S ribosomal protein L13a-1            337   3e-114   Tarenaya hassleriana [spider flower]
ref|NP_001236202.1|  uncharacterized protein LOC100527190               337   3e-114   Glycine max [soybeans]
gb|ACG33474.1|  60S ribosomal protein L13a                              337   3e-114   Zea mays [maize]
pdb|3J61|O  Chain O, Localization Of The Large Subunit Ribosomal ...    336   6e-114   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002301785.2|  ribosomal protein L13a                             335   8e-114   
gb|ACG37566.1|  60S ribosomal protein L13a                              335   1e-113   Zea mays [maize]
ref|XP_006443602.1|  hypothetical protein CICLE_v10023466mg             341   1e-113   
ref|XP_007147486.1|  hypothetical protein PHAVU_006G128500g             334   2e-113   Phaseolus vulgaris [French bean]
gb|KCW58066.1|  hypothetical protein EUGRSUZ_H00799                     335   4e-113   Eucalyptus grandis [rose gum]
ref|XP_003546257.1|  PREDICTED: 60S ribosomal protein L13a-4-like       333   6e-113   Glycine max [soybeans]
gb|ACJ83838.1|  unknown                                                 333   8e-113   Medicago truncatula
ref|XP_010685006.1|  PREDICTED: 60S ribosomal protein L13a-2            333   1e-112   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN31417.1|  60S ribosomal protein L13a-4                            332   1e-112   Glycine soja [wild soybean]
gb|ACG48503.1|  60S ribosomal protein L13a                              332   2e-112   Zea mays [maize]
ref|XP_008235481.1|  PREDICTED: 60S ribosomal protein L13a-1-like       332   2e-112   Prunus mume [ume]
gb|ABQ57364.1|  ribosomal protein L13A                                  332   2e-112   Lupinus luteus
ref|NP_001058724.1|  Os07g0109500                                       331   5e-112   
sp|O65055.1|RL13A_PICMA  RecName: Full=60S ribosomal protein L13a       331   6e-112   Picea mariana [black spruce]
ref|XP_008365936.1|  PREDICTED: 60S ribosomal protein L13a-1            330   8e-112   
ref|XP_003589380.1|  60S ribosomal protein L13a                         330   1e-111   Medicago truncatula
ref|XP_010228462.1|  PREDICTED: 60S ribosomal protein L13a-4-like       330   2e-111   Brachypodium distachyon [annual false brome]
ref|XP_009334926.1|  PREDICTED: 60S ribosomal protein L13a-1-like       328   5e-111   Pyrus x bretschneideri [bai li]
gb|EAZ38446.1|  hypothetical protein OsJ_22825                          327   2e-110   Oryza sativa Japonica Group [Japonica rice]
sp|O49885.1|RL13A_LUPLU  RecName: Full=60S ribosomal protein L13a       324   2e-109   Lupinus luteus
ref|XP_001774253.1|  predicted protein                                  322   1e-108   
ref|XP_001763759.1|  predicted protein                                  322   2e-108   
ref|XP_001765352.1|  predicted protein                                  320   6e-108   
ref|XP_001773626.1|  predicted protein                                  319   2e-107   
ref|XP_001765905.1|  predicted protein                                  319   3e-107   
ref|XP_004981724.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    320   3e-107   
ref|XP_007223448.1|  hypothetical protein PRUPE_ppa011551mg             317   5e-107   
gb|ABK22228.1|  unknown                                                 317   1e-106   Picea sitchensis
ref|XP_006855707.1|  hypothetical protein AMTR_s00044p00144180          315   2e-106   Amborella trichopoda
ref|XP_006657401.1|  PREDICTED: 60S ribosomal protein L13a-3-like       316   3e-106   Oryza brachyantha
gb|KJB72097.1|  hypothetical protein B456_011G159000                    314   8e-106   Gossypium raimondii
gb|AIC33046.1|  60S ribosomal protein L13a                              313   9e-106   Panax ginseng [Asiatic ginseng]
dbj|BAK07924.1|  predicted protein                                      317   9e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW57253.1|  hypothetical protein EUGRSUZ_H00057                     312   5e-105   Eucalyptus grandis [rose gum]
gb|KCW58067.1|  hypothetical protein EUGRSUZ_H00799                     311   1e-104   Eucalyptus grandis [rose gum]
gb|KGN66498.1|  hypothetical protein Csa_1G615170                       310   6e-104   Cucumis sativus [cucumbers]
gb|EMT05694.1|  60S ribosomal protein L13a-4                            311   9e-104   
gb|KJB22645.1|  hypothetical protein B456_004G058600                    307   3e-103   Gossypium raimondii
gb|EMS52180.1|  60S ribosomal protein L13a-4                            308   5e-103   Triticum urartu
gb|KDO65929.1|  hypothetical protein CISIN_1g028649mg                   305   2e-102   Citrus sinensis [apfelsine]
ref|XP_002964465.1|  hypothetical protein SELMODRAFT_166650             305   5e-102   Selaginella moellendorffii
gb|ACN36734.1|  unknown                                                 302   4e-101   Zea mays [maize]
ref|XP_008382629.1|  PREDICTED: 60S ribosomal protein L13a-1            288   5e-96    
ref|XP_004955326.1|  PREDICTED: 60S ribosomal protein L13a-3-like       282   6e-93    Setaria italica
ref|XP_002953387.1|  component of cytosolic 80S ribosome and 60S ...    255   2e-82    Volvox carteri f. nagariensis
ref|XP_005849945.1|  hypothetical protein CHLNCDRAFT_17540              253   8e-82    Chlorella variabilis
ref|XP_001692909.1|  ribosomal protein L13a, component of cytosol...    253   1e-81    Chlamydomonas reinhardtii
gb|AAX92709.1|  60S ribosomal protein L13a                              252   2e-81    Picea abies
gb|KDO65930.1|  hypothetical protein CISIN_1g028649mg                   250   2e-81    Citrus sinensis [apfelsine]
ref|XP_005643971.1|  ribosomal protein L13a component of cytosoli...    251   4e-81    Coccomyxa subellipsoidea C-169
sp|P93099.1|RL13A_CYAPA  RecName: Full=60S ribosomal protein L13a       248   2e-79    Cyanophora paradoxa
ref|XP_010661466.1|  PREDICTED: 60S ribosomal protein L13a-2-like       248   1e-78    Vitis vinifera
ref|XP_001630812.1|  predicted protein                                  245   3e-78    Nematostella vectensis
ref|XP_004349662.1|  ribosomal protein L13, putative                    238   2e-75    Acanthamoeba castellanii str. Neff
emb|CDO99456.1|  unnamed protein product                                234   4e-75    Coffea canephora [robusta coffee]
emb|CBI37325.3|  unnamed protein product                                234   4e-75    Vitis vinifera
gb|AAX48846.1|  L13a                                                    236   5e-75    Suberites domuncula
gb|KHN23001.1|  60S ribosomal protein L13a-4                            234   1e-74    Glycine soja [wild soybean]
ref|NP_001051312.2|  Os03g0755700                                       233   5e-74    
gb|EUB62915.1|  60S ribosomal protein L13a                              233   2e-73    Echinococcus granulosus
ref|XP_002112893.1|  expressed hypothetical protein                     232   3e-73    Trichoplax adhaerens
gb|EPZ33870.1|  60S ribosomal protein L13a                              232   3e-73    Rozella allomycis CSF55
emb|CBI17324.3|  unnamed protein product                                229   4e-73    Vitis vinifera
emb|CDS32619.1|  ribosomal protein rpl13a                               231   5e-73    Hymenolepis microstoma
gb|ABW23219.1|  ribosomal protein rpl13a                                231   6e-73    Eurythoe complanata
gb|AAR01666.1|  putative ribosomal protein L13a                         230   9e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436282.1|  ribosomal protein L13A, putative                   230   1e-72    Ixodes scapularis [blacklegged tick]
gb|ESA01198.1|  hypothetical protein GLOINDRAFT_334214                  230   2e-72    
gb|EWM30220.1|  60s ribosomal protein l13a                              230   2e-72    Nannochloropsis gaditana
gb|ETE70282.1|  60S ribosomal protein L13a                              229   3e-72    Ophiophagus hannah
ref|XP_002507247.1|  predicted protein                                  229   4e-72    Micromonas commoda
ref|XP_003384047.1|  PREDICTED: 60S ribosomal protein L13a-like         229   6e-72    Amphimedon queenslandica
gb|KFM61542.1|  60S ribosomal protein L13a                              229   6e-72    Stegodyphus mimosarum
ref|XP_001491926.1|  PREDICTED: 60S ribosomal protein L13a              228   9e-72    Equus caballus [domestic horse]
ref|XP_003054822.1|  predicted protein                                  228   9e-72    Micromonas pusilla CCMP1545
ref|XP_008067417.1|  PREDICTED: 60S ribosomal protein L13a              228   1e-71    Carlito syrichta
ref|XP_007431701.1|  PREDICTED: 60S ribosomal protein L13a-like         228   1e-71    Python bivittatus
ref|XP_002741044.1|  PREDICTED: 60S ribosomal protein L13a-like i...    228   1e-71    Saccoglossus kowalevskii
gb|AHA44488.1|  60S ribosomal-like protein                              228   2e-71    Pectinaria gouldii
ref|XP_004011713.1|  PREDICTED: 60S ribosomal protein L13a-like         228   2e-71    Ovis aries [domestic sheep]
gb|KFH71578.1|  60S ribosomal protein L16-B                             228   2e-71    Mortierella verticillata NRRL 6337
ref|XP_004168353.1|  PREDICTED: 60S ribosomal protein L13a-3-like       225   2e-71    
ref|XP_004694340.1|  PREDICTED: 60S ribosomal protein L13a isofor...    227   2e-71    Condylura cristata
ref|XP_001507007.1|  PREDICTED: 60S ribosomal protein L13a              227   2e-71    Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001016486.1|  ribosomal protein L13a                             228   3e-71    Xenopus tropicalis [western clawed frog]
gb|ABX75375.1|  60S ribosomal protein L13A                              227   3e-71    Lycosa singoriensis
ref|XP_008843288.1|  PREDICTED: 60S ribosomal protein L13a              227   3e-71    Nannospalax galili
emb|CCQ18645.1|  60S ribosomal protein L13a                             227   3e-71    Sycon ciliatum
ref|XP_003038672.1|  60S ribosomal protein L16                          227   3e-71    Schizophyllum commune H4-8
ref|XP_011287982.1|  PREDICTED: 60S ribosomal protein L13a              227   4e-71    Felis catus [cat]
ref|XP_004597042.1|  PREDICTED: 60S ribosomal protein L13a isofor...    227   4e-71    Ochotona princeps [southern American pika]
ref|XP_005833834.1|  large subunit ribosomal protein L13Ae_2, cyt...    226   4e-71    Guillardia theta CCMP2712
gb|ELR49590.1|  60S ribosomal protein L13a                              226   4e-71    Bos mutus
ref|XP_005336734.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   4e-71    Ictidomys tridecemlineatus
ref|NP_001125810.1|  60S ribosomal protein L13a                         226   4e-71    Pongo abelii [orang utan]
ref|XP_005879589.1|  PREDICTED: 60S ribosomal protein L13a              226   4e-71    
ref|XP_004672300.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   4e-71    Jaculus jaculus
ref|XP_003453268.1|  PREDICTED: 60S ribosomal protein L13a-like         226   4e-71    Oreochromis niloticus
ref|NP_001070466.1|  60S ribosomal protein L13a                         226   5e-71    Bos taurus [bovine]
ref|XP_005336733.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   5e-71    Ictidomys tridecemlineatus
gb|ABY28364.1|  ribosomal protein L13A                                  226   5e-71    Oncorhynchus masou formosanus [Taiwan salmon]
ref|XP_005589974.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   5e-71    Macaca fascicularis [crab eating macaque]
ref|XP_005088148.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   5e-71    Mesocricetus auratus [Syrian golden hamster]
ref|XP_004710493.1|  PREDICTED: 60S ribosomal protein L13a              226   5e-71    Echinops telfairi [lesser hedgehog tenrec]
gb|EHH59787.1|  hypothetical protein EGM_09978                          226   5e-71    Macaca fascicularis [crab eating macaque]
sp|Q4R8Z2.3|RL13A_MACFA  RecName: Full=60S ribosomal protein L13a       226   5e-71    Macaca fascicularis [crab eating macaque]
ref|XP_004409938.1|  PREDICTED: 60S ribosomal protein L13a              226   5e-71    Odobenus rosmarus divergens
gb|EPQ15989.1|  60S ribosomal protein L13a                              227   5e-71    Myotis brandtii
ref|XP_006160205.1|  PREDICTED: 60S ribosomal protein L13a              226   5e-71    Tupaia chinensis
ref|XP_004767370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   5e-71    Mustela putorius furo [black ferret]
ref|XP_006173860.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   5e-71    
gb|AAH04900.2|  RPL13A protein                                          226   6e-71    Homo sapiens [man]
ref|XP_004472671.1|  PREDICTED: 60S ribosomal protein L13a isoform 2    226   6e-71    Dasypus novemcinctus
ref|XP_008152577.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   6e-71    Eptesicus fuscus
ref|XP_004271087.1|  PREDICTED: 60S ribosomal protein L13a              226   6e-71    Orcinus orca [Orca]
ref|XP_006905092.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   6e-71    Pteropus alecto
ref|XP_002723961.2|  PREDICTED: 60S ribosomal protein L13a              226   6e-71    Oryctolagus cuniculus [domestic rabbit]
gb|EFB23940.1|  hypothetical protein PANDA_006273                       226   6e-71    Ailuropoda melanoleuca
ref|XP_008152578.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   6e-71    Eptesicus fuscus
ref|XP_007941028.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   6e-71    Orycteropus afer afer
ref|NP_001230997.1|  ribosomal protein L13a isoform 1                   226   6e-71    Sus scrofa [pigs]
ref|XP_006905093.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   6e-71    Pteropus alecto
ref|XP_006173859.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   6e-71    Camelus ferus
ref|NP_001182348.1|  ribosomal protein L13a                             226   6e-71    Macaca mulatta [rhesus macaque]
ref|XP_002762391.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   6e-71    Callithrix jacchus [common marmoset]
ref|XP_004381707.1|  PREDICTED: 60S ribosomal protein L13a              226   6e-71    Trichechus manatus latirostris
ref|NP_036555.1|  60S ribosomal protein L13a isoform 1                  226   6e-71    Homo sapiens [man]
ref|NP_001230998.1|  ribosomal protein L13a isoform 2                   226   6e-71    Sus scrofa [pigs]
ref|XP_010584802.1|  PREDICTED: 60S ribosomal protein L13a              226   7e-71    Loxodonta africana [African bush elephant]
ref|XP_005412929.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   7e-71    Chinchilla lanigera
ref|XP_004440337.1|  PREDICTED: 60S ribosomal protein L13a isoform 1    226   7e-71    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006868260.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   7e-71    Chrysochloris asiatica
ref|NP_001291802.1|  ribosomal protein L13a                             226   7e-71    Ailuropoda melanoleuca
gb|ACH85355.1|  ribosomal protein L13a                                  226   8e-71    Salmo salar
ref|XP_007172851.1|  PREDICTED: 60S ribosomal protein L13a-like         226   9e-71    
gb|ACN10380.1|  60S ribosomal protein L13a                              226   9e-71    Salmo salar
gb|KEZ46607.1|  hypothetical protein SAPIO_CDS0424                      226   1e-70    
gb|EHB05652.1|  60S ribosomal protein L13a                              225   1e-70    
ref|XP_004646507.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   1e-70    
emb|CDQ71669.1|  unnamed protein product                                226   1e-70    
ref|XP_011112396.1|  hypothetical protein H072_6613                     225   1e-70    
gb|AFK39539.1|  unknown                                                 223   1e-70    
gb|AAW27674.1|  SJCHGC04249 protein                                     225   1e-70    
ref|XP_006824379.1|  PREDICTED: 60S ribosomal protein L13a-like i...    225   1e-70    
ref|XP_003226237.1|  PREDICTED: 60S ribosomal protein L13a              225   1e-70    
ref|XP_006898790.1|  PREDICTED: 60S ribosomal protein L13a              228   1e-70    
ref|NP_001080130.1|  ribosomal protein L13a                             226   1e-70    
ref|XP_011394488.1|  60S ribosomal protein L16                          226   1e-70    
ref|XP_004619892.1|  PREDICTED: 60S ribosomal protein L13a isofor...    225   1e-70    
emb|CCD82603.1|  putative 60s ribosomal protein L13a                    225   2e-70    
ref|XP_004540518.1|  PREDICTED: 60S ribosomal protein L13a-like         225   2e-70    
ref|XP_007531370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    225   2e-70    
ref|XP_003801534.1|  PREDICTED: 60S ribosomal protein L13a              225   2e-70    
ref|XP_011394487.1|  60S ribosomal protein L16, variant                 225   2e-70    
ref|XP_010639023.1|  PREDICTED: 60S ribosomal protein L13a              225   2e-70    
ref|XP_007463424.1|  PREDICTED: 60S ribosomal protein L13a isofor...    225   2e-70    
gb|EHH30267.1|  hypothetical protein EGK_10889                          224   2e-70    
ref|XP_003465562.1|  PREDICTED: 60S ribosomal protein L13a isofor...    225   2e-70    
ref|XP_006986315.1|  PREDICTED: 60S ribosomal protein L13a              224   2e-70    
gb|AGH70161.1|  60S ribosomal protein L13a                              224   2e-70    
sp|P35427.2|RL13A_RAT  RecName: Full=60S ribosomal protein L13a         224   3e-70    
ref|XP_003348078.1|  60S ribosomal protein L16                          224   3e-70    
gb|EIE79164.1|  60S ribosomal protein L16                               224   3e-70    
gb|EIE90993.1|  60S ribosomal protein L16                               224   3e-70    
ref|XP_009848042.1|  hypothetical protein NEUTE1DRAFT_115903            224   3e-70    
gb|EQL04215.1|  Ribosomal protein L13, eukaryotic/archaeal              224   3e-70    
ref|XP_005366879.1|  PREDICTED: 60S ribosomal protein L13a              224   4e-70    
gb|ACN09948.1|  60S ribosomal protein L13a                              226   4e-70    
ref|XP_008573628.1|  PREDICTED: 60S ribosomal protein L13a isofor...    225   4e-70    
ref|XP_004625632.1|  PREDICTED: 60S ribosomal protein L13a-like         224   4e-70    
gb|EHK49489.1|  hypothetical protein TRIATDRAFT_297491                  224   5e-70    
ref|NP_775462.2|  60S ribosomal protein L13a                            224   5e-70    
ref|XP_002144062.1|  60S ribosomal protein L16                          224   5e-70    
ref|XP_007279305.1|  60s ribosomal protein l16                          224   5e-70    
ref|XP_003940403.1|  PREDICTED: 60S ribosomal protein L13a isofor...    224   5e-70    
ref|XP_002480444.1|  60S ribosomal protein L16                          224   5e-70    
gb|AAQ13495.1|AF109186_1  FWP004                                        224   5e-70    
gb|EIE78513.1|  60S ribosomal protein L16                               224   5e-70    
ref|XP_005589973.1|  PREDICTED: 60S ribosomal protein L13a isofor...    226   5e-70    
gb|ACH48187.1|  60S ribosomal protein L13a                              224   5e-70    
ref|XP_002558631.1|  Pc13g01870                                         224   6e-70    
ref|XP_003962761.1|  PREDICTED: 60S ribosomal protein L13a-like         224   6e-70    
dbj|BAD96467.1|  ribosomal protein L13a variant                         223   6e-70    
emb|CAA35908.1|  tum- transplantation antigen P198                      223   7e-70    
ref|XP_005001821.1|  PREDICTED: 60S ribosomal protein L13a isofor...    224   7e-70    
ref|XP_001749344.1|  hypothetical protein                               223   7e-70    
ref|XP_008861430.1|  ribosomal protein L13                              223   7e-70    
ref|NP_001187674.1|  60S ribosomal protein l13a                         223   7e-70    
gb|ERT00595.1|  60S ribosomal protein L16                               223   8e-70    
ref|XP_003508699.2|  PREDICTED: 60S ribosomal protein L13a isofor...    225   8e-70    
emb|CDM33337.1|  60S ribosomal protein L16                              223   8e-70    
ref|XP_004226142.1|  PREDICTED: 60S ribosomal protein L13a-like         223   9e-70    
ref|NP_033464.2|  60S ribosomal protein L13a                            223   9e-70    
gb|EPE08609.1|  60s ribosomal protein l16                               224   9e-70    
ref|XP_004579204.1|  PREDICTED: 60S ribosomal protein L13a-like         223   9e-70    
ref|XP_011125712.1|  hypothetical protein AOL_s00169g53                 223   1e-69    
gb|EHK19473.1|  hypothetical protein TRIVIDRAFT_111666                  223   1e-69    
ref|XP_011397206.1|  60S ribosomal protein L13a-1                       222   1e-69    
emb|CEG78600.1|  Putative 60S ribosomal protein L16                     223   1e-69    
ref|XP_007836334.1|  60S ribosomal protein L16                          223   1e-69    
ref|XP_008602497.1|  60S ribosomal protein L16                          223   1e-69    
ref|XP_002590758.1|  hypothetical protein BRAFLDRAFT_280074             223   1e-69    
ref|XP_007574193.1|  PREDICTED: 60S ribosomal protein L13a              223   1e-69    
gb|EKV08153.1|  Ribosomal protein L16a                                  223   1e-69    
ref|XP_001911222.1|  hypothetical protein                               223   1e-69    
emb|CEG67074.1|  Putative 60S ribosomal protein L16                     223   1e-69    
ref|XP_007298090.1|  60S ribosomal protein L13a                         223   1e-69    
ref|XP_002472416.1|  60S ribosomal protein L13a                         223   1e-69    
gb|ACO11694.1|  60S ribosomal protein L13A                              223   2e-69    
ref|XP_005801332.1|  PREDICTED: 60S ribosomal protein L13a-like         223   2e-69    
gb|ACO14619.1|  60S ribosomal protein L13A                              223   2e-69    
gb|KFH65594.1|  large subunit ribosomal protein L13Ae                   226   2e-69    
gb|ESZ92305.1|  60S ribosomal protein L16                               222   2e-69    
ref|XP_009035047.1|  hypothetical protein AURANDRAFT_58864              222   2e-69    
ref|XP_009822374.1|  ribosomal protein L13                              222   2e-69    
gb|KGB33955.1|  60S ribosomal protein L13a                              222   2e-69    
emb|CAK04157.1|  ribosomal protein L13a                                 222   2e-69    
emb|CCE29838.1|  probable ribosomal protein l13a                        222   2e-69    
gb|ACI67868.1|  60S ribosomal protein L13a                              222   2e-69    
ref|XP_001555732.1|  60S ribosomal protein L16                          222   2e-69    
gb|EPT03925.1|  hypothetical protein FOMPIDRAFT_1022092                 222   3e-69    
gb|ACH85339.1|  ribosomal protein L13a                                  222   3e-69    
pdb|2ZKR|JJ  Chain j, Structure Of A Mammalian Ribosomal 60s Subu...    222   3e-69    
ref|XP_004624823.1|  PREDICTED: 60S ribosomal protein L13a-like         222   3e-69    
sp|Q9XSU0.2|RL13A_CANFA  RecName: Full=60S ribosomal protein L13a       222   3e-69    
ref|XP_007531368.1|  PREDICTED: 60S ribosomal protein L13a isofor...    222   3e-69    
ref|XP_007623352.1|  PREDICTED: 60S ribosomal protein L13a isofor...    225   3e-69    
ref|XP_004082291.2|  PREDICTED: 60S ribosomal protein L13a              223   4e-69    
ref|XP_007916510.1|  putative 60s ribosomal protein l16 protein         221   4e-69    
ref|XP_001225089.1|  60S ribosomal protein L16                          221   4e-69    
ref|XP_007531369.1|  PREDICTED: 60S ribosomal protein L13a isofor...    221   4e-69    
gb|EMD42236.1|  hypothetical protein CERSUDRAFT_79830                   221   4e-69    
ref|XP_008398128.1|  PREDICTED: 60S ribosomal protein L13a              221   4e-69    
emb|CCF47368.1|  60S ribosomal protein L16                              221   4e-69    
ref|XP_003649454.1|  60S ribosomal protein L16                          221   4e-69    
emb|CCM05160.1|  predicted protein                                      221   4e-69    
ref|XP_568413.1|  structural constituent of ribosome                    221   5e-69    
ref|XP_003661900.1|  hypothetical protein MYCTH_2314728                 221   5e-69    
emb|CCI10404.1|  unnamed protein product                                221   5e-69    
ref|XP_004640903.1|  PREDICTED: 60S ribosomal protein L13a-like         221   6e-69    
ref|XP_010733236.1|  PREDICTED: 60S ribosomal protein L13a              222   6e-69    
gb|KIW01173.1|  60S ribosomal protein L16                               221   6e-69    
emb|CEG62724.1|  Putative 60S ribosomal protein L16                     221   6e-69    
gb|EPS27763.1|  hypothetical protein PDE_02707                          221   6e-69    
ref|XP_008031827.1|  60S ribosomal protein L13a                         221   6e-69    
gb|EFX00180.1|  60S ribosomal protein l16                               221   6e-69    
ref|XP_006969355.1|  ribosomal protein L16, L13 family                  221   7e-69    
gb|KGB79094.1|  60S ribosomal protein L13/L16                           221   8e-69    
emb|CEJ03799.1|  Putative 60S ribosomal protein L16                     221   8e-69    
ref|XP_007336962.1|  60S ribosomal protein L13a                         220   9e-69    
emb|CEJ00501.1|  Putative 60S ribosomal protein L16                     221   9e-69    
gb|AFR98459.1|  large subunit ribosomal protein L13                     220   1e-68    
emb|CEP16619.1|  hypothetical protein                                   220   1e-68    
gb|KIR59162.1|  ribosomal protein L13                                   220   1e-68    
ref|XP_007244661.1|  PREDICTED: 60S ribosomal protein L13a-like         221   1e-68    
ref|XP_007359836.1|  60S ribosomal protein L13a                         220   1e-68    
gb|ABW90393.1|  putative ribosomal protein L13a                         220   1e-68    
ref|XP_007372042.1|  60S large subunit ribosomal protein                220   1e-68    
ref|XP_009222620.1|  60S ribosomal protein L16                          220   1e-68    
ref|XP_005884578.1|  PREDICTED: 60S ribosomal protein L13a-like         220   1e-68    
ref|XP_007594433.1|  ribosomal protein L13                              220   1e-68    
emb|CBN08625.1|  small nucleolar RNA, C/D box 32A                       220   1e-68    
ref|XP_006454409.1|  ribosomal protein L13                              220   1e-68    
ref|XP_004881622.1|  PREDICTED: 60S ribosomal protein L13a-like         220   1e-68    
ref|XP_007265503.1|  ribosomal protein L16a                             220   1e-68    
gb|KEY64902.1|  hypothetical protein S7711_03894                        220   1e-68    
gb|KID91699.1|  60S ribosomal protein L16                               220   1e-68    
ref|XP_007820698.1|  hypothetical protein MAA_04996                     220   2e-68    
ref|XP_006697168.1|  60S ribosomal protein L16-like protein             220   2e-68    
gb|EFQ25839.1|  ribosomal protein L13                                   220   2e-68    
gb|KDN60858.1|  putative ribosomal protein L13                          219   2e-68    
ref|XP_750349.2|  ribosomal protein L16a                                220   2e-68    
gb|ADC97464.1|  putative 60S ribosomal protein L13a                     220   2e-68    
gb|AFX72999.1|  60S ribosomal protein L13a                              219   2e-68    
gb|KIM85315.1|  hypothetical protein PILCRDRAFT_817318                  219   2e-68    
ref|XP_001816941.1|  60S ribosomal protein L16                          219   2e-68    
ref|XP_001265069.1|  60S ribosomal protein L16                          219   2e-68    
gb|EDP55936.1|  ribosomal protein L16a                                  219   2e-68    
ref|XP_007873114.1|  hypothetical protein PNEG_01198                    219   2e-68    
gb|KGG52418.1|  60S ribosomal protein L16                               219   2e-68    
ref|XP_003047678.1|  60S ribosomal protein L16                          219   2e-68    
ref|XP_007390595.1|  hypothetical protein PHACADRAFT_247592             219   2e-68    
gb|KDO33301.1|  50S ribosomal protein L13                               219   2e-68    
ref|XP_008615115.1|  50S ribosomal protein L13                          219   2e-68    
ref|XP_004054617.1|  PREDICTED: 60S ribosomal protein L13a-like         219   2e-68    
ref|XP_007379121.1|  ribosomal protein L16a                             219   2e-68    
gb|KIM67235.1|  hypothetical protein SCLCIDRAFT_1210745                 219   3e-68    
gb|KIO08197.1|  hypothetical protein M404DRAFT_133675                   219   3e-68    
ref|NP_997949.1|  60S ribosomal protein L13a                            219   3e-68    
gb|KDQ12852.1|  hypothetical protein BOTBODRAFT_34000                   219   3e-68    
ref|XP_003197368.1|  structural constituent of ribosome                 219   3e-68    
dbj|GAN10069.1|  60S ribosomal protein L16                              219   3e-68    
gb|KID75750.1|  Ribosomal protein L13, eukaryotic/archaeal              219   3e-68    
gb|EPB90589.1|  60S ribosomal protein L16                               219   3e-68    
emb|CCX05052.1|  Similar to 60S ribosomal protein L16; acc. no. Q...    219   3e-68    
ref|XP_001828792.1|  60S ribosomal protein L16                          219   3e-68    
gb|KIY47036.1|  60S ribosomal protein L13a                              219   3e-68    
gb|KIL70745.1|  hypothetical protein M378DRAFT_183340                   219   3e-68    
ref|XP_003000559.1|  60S ribosomal protein L16                          219   3e-68    
ref|XP_001609803.1|  ribosomal protein L13                              219   4e-68    
gb|KIP12424.1|  hypothetical protein PHLGIDRAFT_17577                   219   4e-68    
ref|XP_011344385.1|  PREDICTED: 60S ribosomal protein L13a              219   4e-68    
ref|XP_001591799.1|  60S ribosomal protein L16                          219   4e-68    
gb|EYE99359.1|  ribosomal protein L13                                   219   4e-68    
ref|XP_002542528.1|  60S ribosomal protein L16                          219   4e-68    
ref|XP_004990512.1|  ribosomal protein L13Ae                            219   4e-68    
ref|XP_001269562.1|  60S ribosomal protein L16                          219   5e-68    
gb|KID97163.1|  60S ribosomal protein L16                               219   5e-68    
gb|EER45034.1|  60S ribosomal protein L13a                              219   5e-68    
ref|XP_004830849.1|  60S ribosomal protein L13, putative                218   5e-68    
gb|KIK28465.1|  hypothetical protein PISMIDRAFT_673469                  218   6e-68    
ref|XP_002836976.1|  60S ribosomal protein L16                          218   6e-68    
gb|KHN97292.1|  60S ribosomal protein L16                               219   6e-68    
ref|XP_006096329.1|  PREDICTED: 60S ribosomal protein L13a-like         219   6e-68    
ref|XP_007842224.1|  ribosomal protein l13a                             218   6e-68    
gb|KIK91012.1|  hypothetical protein PAXRUDRAFT_831191                  218   6e-68    
gb|EPY89115.1|  60S ribosomal protein L13a                              222   6e-68    
gb|KFH42461.1|  60S ribosomal protein-like protein                      218   7e-68    
emb|CCA69106.1|  probable ribosomal protein L13a                        218   7e-68    
ref|XP_007763383.1|  ribosomal protein L16a                             218   7e-68    
gb|ERE70104.1|  fms-related tyrosine kinase 3 ligand-like isoform 1     226   7e-68    
ref|XP_007791101.1|  putative 60s ribosomal protein l16 protein         218   7e-68    
sp|Q91487.1|RL13A_SALTR  RecName: Full=60S ribosomal protein L13a...    218   7e-68    
gb|KGQ02845.1|  60S ribosomal protein L16                               222   7e-68    
gb|ENH85897.1|  60s ribosomal protein l16                               219   7e-68    
ref|XP_002625192.1|  60S ribosomal protein L16                          218   7e-68    
gb|KIJ21668.1|  hypothetical protein PAXINDRAFT_64692                   218   7e-68    
ref|XP_002396666.1|  hypothetical protein MPER_03052                    218   8e-68    
gb|KJA29151.1|  hypothetical protein HYPSUDRAFT_175798                  218   8e-68    
emb|CEP09155.1|  hypothetical protein                                   218   9e-68    
ref|XP_006292546.1|  hypothetical protein CARUB_v10018781mg             215   9e-68    
ref|XP_001093017.1|  PREDICTED: 60S ribosomal protein L13a-like         218   9e-68    
gb|EPB90135.1|  60S ribosomal protein L16                               218   9e-68    
gb|KDQ30707.1|  hypothetical protein PLEOSDRAFT_1053876                 218   9e-68    
ref|XP_001398840.1|  60S ribosomal protein L16                          218   9e-68    
ref|XP_009541219.1|  hypothetical protein HETIRDRAFT_308123             218   9e-68    
emb|CBJ25662.1|  60S ribosomal protein L13a                             218   1e-67    
dbj|GAA83388.1|  serine palmitoyltransferase 2                          218   1e-67    
ref|XP_005986102.1|  PREDICTED: 60S ribosomal protein L13a-like         218   1e-67    
gb|EGU79132.1|  hypothetical protein FOXB_10370                         218   1e-67    
gb|KDR85080.1|  hypothetical protein GALMADRAFT_317297                  218   1e-67    
gb|KIK06911.1|  hypothetical protein K443DRAFT_673805                   218   1e-67    
ref|XP_001873232.1|  60S ribosomal protein L16                          218   1e-67    
ref|XP_010877924.1|  PREDICTED: 60S ribosomal protein L13a              218   1e-67    
ref|XP_001244411.1|  60S ribosomal protein L16                          218   1e-67    
gb|ADC97465.1|  putative 60S ribosomal protein L13a                     218   1e-67    
ref|XP_007861056.1|  60S ribosomal protein L13a                         218   1e-67    
gb|ABZ04228.1|  ribosomal protein rpl13a                                218   1e-67    
ref|XP_002908436.1|  60S ribosomal protein L13, putative                218   1e-67    
emb|CDO73224.1|  hypothetical protein BN946_scf185007.g279              217   2e-67    
gb|KIY62452.1|  60S ribosomal protein L13a                              217   2e-67    
gb|EMS25385.1|  60S ribosomal protein l16                               217   2e-67    
ref|XP_009156217.1|  60S ribosomal protein L16                          217   2e-67    
gb|KIM48122.1|  hypothetical protein M413DRAFT_439838                   217   2e-67    
ref|XP_007727070.1|  60S ribosomal protein L16                          217   2e-67    
gb|KDQ63637.1|  hypothetical protein JAAARDRAFT_29663                   217   2e-67    
gb|KIW82386.1|  60S ribosomal protein L16                               217   2e-67    



>ref|XP_009622553.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   365 bits (937),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/187 (96%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARRVV+DARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVIDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009789164.1| PREDICTED: 60S ribosomal protein L13a-1 [Nicotiana sylvestris]
Length=206

 Score =   365 bits (936),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+R VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRTVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LENKRKERAQA YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRDLENKRKERAQATYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009795999.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana sylvestris]
Length=206

 Score =   364 bits (935),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/187 (96%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARRVVVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_006349931.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   364 bits (934),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|NP_001275476.1| 60S ribosomal protein L13a-4-like [Solanum tuberosum]
 gb|ABA46790.1| 60S ribosomal protein L13a-like protein [Solanum tuberosum]
Length=206

 Score =   363 bits (933),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004252998.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
Length=206

 Score =   363 bits (932),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ+GHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009596414.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana tomentosiformis]
Length=206

 Score =   363 bits (931),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_011073788.1| PREDICTED: 60S ribosomal protein L13a-4 [Sesamum indicum]
Length=206

 Score =   363 bits (931),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQATYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004239861.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum lycopersicum]
Length=206

 Score =   363 bits (931),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ+GHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009625303.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   362 bits (929),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+R VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRTVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LENKRKERAQ  YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRDLENKRKERAQVTYERRKQLA  180

Query  603  KLXVKAE  623
            KL V+AE
Sbjct  181  KLRVRAE  187



>gb|AAR89618.1| 60S ribosomal protein L13a [Capsicum annuum]
Length=220

 Score =   362 bits (928),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LE+KRKERAQ  YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELEDKRKERAQVTYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009765513.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana sylvestris]
Length=206

 Score =   361 bits (926),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWN+YDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNYYDTIKELENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|EYU32659.1| hypothetical protein MIMGU_mgv1a013922mg [Erythranthe guttata]
Length=206

 Score =   360 bits (925),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPP+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPFDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  Y RRKQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQTTYLRRKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>gb|EYU31410.1| hypothetical protein MIMGU_mgv1a013934mg [Erythranthe guttata]
Length=206

 Score =   360 bits (925),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRK+RAQA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEQKRKDRAQATYERKKQLI  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|AHE13806.1| ribosomal protein L13a [Solanum torvum]
Length=206

 Score =   360 bits (924),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI A+R+VVDARHHMLGRL+SI+AKELLNGQRVV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISAKRIVVDARHHMLGRLSSIIAKELLNGQRVVIVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVFEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LENKRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKDLENKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_007223449.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 ref|XP_008224495.1| PREDICTED: 60S ribosomal protein L13a-4 [Prunus mume]
 gb|EMJ24648.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=206

 Score =   359 bits (922),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIK LENKRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKELENKRKERAQLAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_011091425.1| PREDICTED: 60S ribosomal protein L13a-4-like [Sesamum indicum]
Length=206

 Score =   358 bits (920),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRK+RAQA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKDRAQATYERKKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_002267491.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
Length=206

 Score =   358 bits (919),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAGRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQLAYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004247847.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
 ref|XP_006360354.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   358 bits (918),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI A+R+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISAKRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRL+AGHKYCLLGKLSSEVGWNHYDTI+ LENKRKERAQ  YERRKQL 
Sbjct  121  KRMVIPDALKVLRLRAGHKYCLLGKLSSEVGWNHYDTIRDLENKRKERAQVTYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>emb|CDP03876.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   358 bits (918),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNH DTI+ LE KRKERAQA YERRKQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHADTIRELEAKRKERAQATYERRKQLT  180

Query  603  KLXVKAE  623
            +L +KAE
Sbjct  181  RLRIKAE  187



>ref|XP_010277234.1| PREDICTED: 60S ribosomal protein L13a-4 [Nelumbo nucifera]
Length=206

 Score =   357 bits (917),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIKVLE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTIKVLEKKRKERAQVAYERRKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_002518107.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF44240.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   357 bits (916),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELERKRKERAQVAYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004133995.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_004169511.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_008438365.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis melo]
 gb|KGN56740.1| hypothetical protein Csa_3G131930 [Cucumis sativus]
Length=206

 Score =   357 bits (915),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYE++KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYEKKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|KHG08426.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB37827.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
 gb|KJB37828.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
Length=206

 Score =   357 bits (915),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004154636.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 1 [Cucumis 
sativus]
Length=241

 Score =   358 bits (918),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +3

Query  60   KMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY  239
            KMVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY
Sbjct  33   KMVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKY  92

Query  240  HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK  419
             RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK
Sbjct  93   MRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDK  152

Query  420  VKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQL  599
            +KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL
Sbjct  153  MKRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQL  212

Query  600  TKLXVKAE  623
             KL +KAE
Sbjct  213  NKLRIKAE  220



>gb|KHG07795.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   356 bits (914),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAA+LARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAASLARLKAYEGIPAPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_002268901.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
 emb|CAN63603.1| hypothetical protein VITISV_006449 [Vitis vinifera]
Length=206

 Score =   356 bits (914),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERA+ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELEKKRKERAELAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009374600.1| PREDICTED: 60S ribosomal protein L13a-4 [Pyrus x bretschneideri]
Length=206

 Score =   356 bits (914),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIK LENKRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKELENKRKERAQVAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010937848.1| PREDICTED: 60S ribosomal protein L13a-4 [Elaeis guineensis]
Length=206

 Score =   356 bits (913),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGW+HYDTIK LE KRK+RAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWSHYDTIKELEAKRKQRAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_010920859.1| PREDICTED: 60S ribosomal protein L13a-4-like [Elaeis guineensis]
Length=206

 Score =   356 bits (913),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGW+HYDTIK LE KRK+RAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWSHYDTIKELEAKRKQRAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>gb|ADR71263.1| 60S ribosomal protein L13aA [Hevea brasiliensis]
Length=206

 Score =   355 bits (912),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELERKRKERAQVAYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_008348430.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
Length=206

 Score =   355 bits (912),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIK LENKRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKELENKRKERAQVAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004154637.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 2 [Cucumis 
sativus]
 ref|XP_004154638.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 3 [Cucumis 
sativus]
Length=208

 Score =   355 bits (912),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLN  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRIKAE  187



>ref|XP_006298559.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
 gb|EOA31457.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
Length=206

 Score =   355 bits (911),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLT  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>gb|KHG26825.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   355 bits (911),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLV  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004138959.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_004139040.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_008450411.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008457247.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008458460.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 gb|KGN61467.1| hypothetical protein Csa_2G138710 [Cucumis sativus]
Length=206

 Score =   355 bits (911),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLN  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRIKAE  187



>gb|ACJ02350.1| 60S ribosomal protein L13A [Vernicia fordii]
Length=206

 Score =   355 bits (911),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKIVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKER+Q  YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKALEKKRKERSQLNYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_008793237.1| PREDICTED: 60S ribosomal protein L13a-4 [Phoenix dactylifera]
Length=206

 Score =   355 bits (911),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYD++
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDRM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWN+YDTIK LE KRK+R+Q AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNYYDTIKELEAKRKQRSQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_008356990.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
 ref|XP_009348407.1| PREDICTED: 60S ribosomal protein L13a-4-like [Pyrus x bretschneideri]
Length=206

 Score =   355 bits (911),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIK LENKRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKELENKRKERAQVAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010023711.1| PREDICTED: 60S ribosomal protein L13a-4-like [Eucalyptus grandis]
 gb|KCW60057.1| hypothetical protein EUGRSUZ_H02787 [Eucalyptus grandis]
Length=206

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQRVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERAQLVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010279449.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAAL RLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALGRLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGW+HYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWSHYDTIKELEKKRKERAQVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009392721.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+KVLE KRKERA+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKVLEEKRKERAKVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLKLKAE  187



>ref|XP_004297119.1| PREDICTED: 60S ribosomal protein L13a-4-like [Fragaria vesca 
subsp. vesca]
Length=206

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRKER+Q AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRELEKKRKERSQIAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004288082.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
 ref|XP_004288083.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
Length=206

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRKER+Q AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRELEKKRKERSQIAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010245584.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGW+HYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWSHYDTIKELERKRKERAQVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010466918.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   355 bits (910),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLT  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>gb|KJB30129.1| hypothetical protein B456_005G130900 [Gossypium raimondii]
Length=206

 Score =   354 bits (909),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEISMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010524687.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   354 bits (909),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGHLSSEVGWNHYDTIKELEKKRKERSQAVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>gb|KJB72096.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=206

 Score =   354 bits (909),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLI  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009136093.1| PREDICTED: 60S ribosomal protein L13a-2 [Brassica rapa]
 emb|CDY15113.1| BnaC03g44740D [Brassica napus]
 emb|CDX93039.1| BnaA03g37610D [Brassica napus]
Length=206

 Score =   354 bits (909),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+C++RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCSKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RF+RKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFMRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL+
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLS  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>ref|XP_010439646.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
 ref|XP_010442327.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
Length=206

 Score =   354 bits (909),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010488596.1| PREDICTED: 60S ribosomal protein L13a-2 [Camelina sativa]
Length=206

 Score =   354 bits (909),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLT  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_009112682.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
 emb|CDY39786.1| BnaA09g10380D [Brassica napus]
 emb|CDY03292.1| BnaC09g10560D [Brassica napus]
Length=206

 Score =   354 bits (909),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKE++QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKEKSQAVYERKKQLI  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>ref|XP_009102457.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
Length=206

 Score =   354 bits (908),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLI  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>emb|CDY52083.1| BnaCnng21840D [Brassica napus]
 emb|CDX77383.1| BnaA07g05210D [Brassica napus]
Length=206

 Score =   354 bits (908),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLI  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>ref|XP_007034382.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 ref|XP_007034383.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05308.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05309.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
Length=206

 Score =   354 bits (908),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA++VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIK LE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKELERKRKERAQVAYERRKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009404653.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   353 bits (907),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+KVLE KRKERA+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKVLEAKRKERAKVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_009403869.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   353 bits (907),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVIVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+KVLE KRKERA  AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKVLEAKRKERAAVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_010069656.1| PREDICTED: 60S ribosomal protein L13a-2 [Eucalyptus grandis]
 gb|KCW58065.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=206

 Score =   353 bits (907),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQAVYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|KDP39375.1| hypothetical protein JCGZ_01132 [Jatropha curcas]
Length=206

 Score =   353 bits (906),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLAS +AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASTIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERAQ  YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELERKRKERAQLTYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|NP_189127.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 sp|Q9LRX8.1|R13A2_ARATH RecName: Full=60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 dbj|BAB02893.1| 60S ribosomal protein L13A-like [Arabidopsis thaliana]
 gb|AAN12937.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AEE76951.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
Length=206

 Score =   353 bits (906),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQALYERKKQLT  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_010532891.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   353 bits (906),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIKELEKKRKERSQALYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_006418685.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
 gb|ESQ37121.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
Length=206

 Score =   353 bits (905),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLI  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>gb|AAL87341.1| putative 60S ribosomal protein [Arabidopsis thaliana]
Length=206

 Score =   353 bits (905),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQALYERKKQLT  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_006840139.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
 gb|ERN01814.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
Length=206

 Score =   353 bits (905),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+ VVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKVVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRK RAQ AYERRK+L 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTIKELEEKRKARAQVAYERRKELA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010482144.1| PREDICTED: 60S ribosomal protein L13a-4-like [Camelina sativa]
Length=206

 Score =   352 bits (904),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGH YCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHNYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_006407868.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
 gb|ESQ49321.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
Length=206

 Score =   352 bits (904),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPY+K+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYNKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_010440660.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L13a-3-like 
[Camelina sativa]
Length=206

 Score =   352 bits (904),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHM GRLAS LAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMSGRLASSLAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQATYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLKTKAE  187



>ref|XP_009111853.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
 emb|CDY00046.1| BnaC09g02550D [Brassica napus]
 emb|CDX86281.1| BnaA06g29980D [Brassica napus]
Length=206

 Score =   352 bits (904),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_009421391.1| PREDICTED: 60S ribosomal protein L13a-4 [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   352 bits (904),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+K LE KRKERA+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKELEAKRKERAKVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41928.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   352 bits (903),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERAQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010552053.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   352 bits (902),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERSQAVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KA+
Sbjct  181  KLRAKAQ  187



>ref|XP_009129745.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brassica rapa]
Length=206

 Score =   352 bits (902),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKERSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>emb|CDY33947.1| BnaA02g30400D [Brassica napus]
 emb|CDY05663.1| BnaC02g38740D [Brassica napus]
 emb|CDX85362.1| BnaC07g26730D [Brassica napus]
Length=206

 Score =   352 bits (902),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKERSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_006281111.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
 gb|EOA14009.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
Length=206

 Score =   352 bits (902),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQ+ 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKERAQVVYERKKQIN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_008789105.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   352 bits (902),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVLVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK Y+GVPPPYD++
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYDGVPPPYDRM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRK+R+Q AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKQRSQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|NP_187367.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 sp|Q9SFU1.1|R13A1_ARATH RecName: Full=60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AAF20235.1|AC012395_22 putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAG40393.1|AF325041_1 AT3g07110 [Arabidopsis thaliana]
 gb|AAL09790.1| AT3g07110/T1B9_24 [Arabidopsis thaliana]
 gb|AAL32871.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAM47908.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AEE74499.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=206

 Score =   351 bits (901),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQA YER+KQL+
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQAVYERKKQLS  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_010923627.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=246

 Score =   353 bits (905),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +3

Query  54   AAKMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM  233
            AA+MVSGSGIC RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM
Sbjct  38   AAEMVSGSGICTRRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM  97

Query  234  KYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY  413
            K+ RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPY
Sbjct  98   KFLRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPY  157

Query  414  DKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRK  593
            DK KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW+HYD I+ LE+KRK+R+Q AYERRK
Sbjct  158  DKTKRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSHYDIIRELEDKRKQRSQVAYERRK  217

Query  594  QLTKLXVKAE  623
            QL +L +KAE
Sbjct  218  QLARLRMKAE  227



>ref|XP_006395114.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
 gb|ESQ32400.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
Length=206

 Score =   351 bits (901),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEAKRKERSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010069043.1| PREDICTED: 60S ribosomal protein L13a-3 [Eucalyptus grandis]
 gb|KCW57252.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=206

 Score =   351 bits (901),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+C +RVVVD RHHMLGRLAS+LAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCVKRVVVDGRHHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK +EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKER+Q  YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELERKRKERSQLLYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010527234.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   351 bits (901),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEIKRKERSQALYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_006298567.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
 gb|EOA31465.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
Length=206

 Score =   351 bits (900),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  YER+KQL 
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>gb|KFK38165.1| hypothetical protein AALP_AA3G077500 [Arabis alpina]
Length=206

 Score =   350 bits (899),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+C++RVVVD RHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCSKRVVVDGRHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_006420899.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 ref|XP_006493807.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|ESR34139.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 gb|KDO61167.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=206

 Score =   350 bits (899),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVP PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPAPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNYYDTIKELEKKRKERAQVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_011045655.1| PREDICTED: 60S ribosomal protein L13a-2 [Populus euphratica]
Length=206

 Score =   350 bits (899),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELEMKRKERAQLIYERKKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 ref|NP_001078737.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 sp|Q9FKC0.1|R13A4_ARATH RecName: Full=60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 dbj|BAB09429.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAL91263.1| AT5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AAM65734.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAM67435.1| At5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AED95720.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 gb|AED95721.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
Length=206

 Score =   350 bits (899),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERA   YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERAHVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010448678.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
 ref|XP_010486252.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
Length=206

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLGSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  YER+KQL 
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_009405822.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CAR VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARCVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+K LE KRKERA+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTVKELEAKRKERAKVAYERRKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_008786013.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW++YDTI+ LE KRK+R+Q AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSYYDTIRELEEKRKQRSQVAYERRKQLA  180

Query  603  KLXVKAE  623
            +L VKAE
Sbjct  181  RLRVKAE  187



>ref|XP_006369799.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
 gb|ABK93590.1| unknown [Populus trichocarpa]
 gb|ERP66368.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
Length=206

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+R+VVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRIVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELEMKRKERAQLIYERKKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_002323772.1| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK95932.1| unknown [Populus trichocarpa]
 gb|EEF03905.1| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELETKRKERAQLVYERKKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_009151676.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
Length=206

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPPKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_002883564.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59823.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQAVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_010937601.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=206

 Score =   350 bits (898),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMK+ 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKFL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW+HYDTI+ LE KRK+R+Q AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSHYDTIRELEEKRKQRSQVAYERRKQLA  180

Query  603  KLXVKAE  623
            +L  KAE
Sbjct  181  RLRQKAE  187



>ref|XP_010464292.1| PREDICTED: 60S ribosomal protein L13a-1-like [Camelina sativa]
Length=206

 Score =   350 bits (897),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RV VDARHHMLGRLASI AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVAVDARHHMLGRLASITAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  YER+KQL 
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_010513787.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   348 bits (894),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQAVYERKKQLT  180

Query  603  KL  608
            KL
Sbjct  181  KL  182



>gb|KFK39804.1| hypothetical protein AALP_AA3G290300 [Arabis alpina]
Length=206

 Score =   348 bits (893),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+RVVVD RHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDGRHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLK++EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKMFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKE++Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKEKSQVVYERKKQLI  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>gb|EPS58218.1| hypothetical protein M569_16597 [Genlisea aurea]
Length=206

 Score =   348 bits (893),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+R VVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRFVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRK+R+Q+ YE++KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRDLEKKRKDRSQSVYEKKKQLK  180

Query  603  KLXVKAE  623
            KL  +AE
Sbjct  181  KLRARAE  187



>gb|KHG16481.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB22644.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=206

 Score =   348 bits (892),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQVAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_002882511.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58770.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score =   347 bits (891),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 177/188 (94%), Gaps = 1/188 (1%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV-LENKRKERAQAAYERRKQL  599
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK  LENKRKERAQ  YER+KQL
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKQELENKRKERAQVVYERKKQL  180

Query  600  TKLXVKAE  623
             KL  KAE
Sbjct  181  NKLRAKAE  188



>ref|XP_010110069.1| 60S ribosomal protein L13a-3 [Morus notabilis]
 gb|EXC25125.1| 60S ribosomal protein L13a-3 [Morus notabilis]
Length=206

 Score =   347 bits (891),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEELCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQLAYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>gb|AFK44939.1| unknown [Lotus japonicus]
Length=206

 Score =   347 bits (891),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKVYEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTLRGMIPHKTKRGAAALERLKVYEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLGKLSSEVGWN+YDTI+ LE KRK++AQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGKLSSEVGWNYYDTIRELEKKRKDKAQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_002863167.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39426.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   347 bits (891),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVD RHHMLGRLAS  AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASTTAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKE++Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKEKSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>gb|KFK39801.1| hypothetical protein AALP_AA3G289800 [Arabis alpina]
Length=206

 Score =   347 bits (891),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+RVVVD RHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDGRHHMLGRLSSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ+GHKYCLL +LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLNRLSSEVGWNHYDTIKELEAKRKERSQVMYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>ref|XP_002521095.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF41246.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   347 bits (891),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTI+ LE K+KERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIRELEKKKKERAQVMYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKA+
Sbjct  181  KLRVKAQ  187



>ref|NP_001030654.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AEE74500.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=207

 Score =   347 bits (890),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 178/188 (95%), Gaps = 1/188 (1%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV-LENKRKERAQAAYERRKQL  599
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK  LENKRKERAQA YER+KQL
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKQELENKRKERAQAVYERKKQL  180

Query  600  TKLXVKAE  623
            +KL  KAE
Sbjct  181  SKLRAKAE  188



>ref|NP_193053.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 sp|Q9SVR0.1|R13A3_ARATH RecName: Full=60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 emb|CAB41927.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 emb|CAB78359.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 gb|AAK97733.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AAL31131.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AEE83240.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
Length=206

 Score =   347 bits (889),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVD RHHMLGRLAS  AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASNTAKELLNGQEVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQVMYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>ref|XP_006284504.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
 gb|EOA17402.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
Length=217

 Score =   347 bits (890),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHM GRLAS +AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  12   MVSGSGICAKRVVVDARHHMGGRLASSIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  71

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  72   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  131

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct  132  KRMVIPDALKVLRLQSGHKYCLLGQLSSEVGWNHYDTIKELETKRKERSQVMYERKKQLN  191

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  192  KLRNKAE  198



>ref|XP_004499225.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
 ref|XP_004499231.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
Length=206

 Score =   347 bits (889),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKER+Q AYER+KQL+
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQLAYERKKQLS  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_007049776.1| Ribosomal protein L13 family protein [Theobroma cacao]
 gb|EOX93933.1| Ribosomal protein L13 family protein [Theobroma cacao]
Length=206

 Score =   346 bits (888),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MV GSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVCGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQVAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_011041875.1| PREDICTED: 60S ribosomal protein L13a-1-like [Populus euphratica]
Length=206

 Score =   346 bits (888),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKR NTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYD+ 
Sbjct  61   RFLRKRTNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELEKKRKERAQLVYERKKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_006650608.1| PREDICTED: 60S ribosomal protein L13a-4-like [Oryza brachyantha]
Length=206

 Score =   346 bits (887),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CARRVVVDARHHMLGRL+S++AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCARRVVVDARHHMLGRLSSVIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRT+RGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI+ LE KRKE+A+ AYERRKQLT
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKAKLAYERRKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|KJB10146.1| hypothetical protein B456_001G186700 [Gossypium raimondii]
Length=206

 Score =   346 bits (887),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P P+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPAPFDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ +YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQVSYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|KDO61166.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=205

 Score =   345 bits (885),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 176/187 (94%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVP PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPAPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIKV   KRKERAQ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNYYDTIKV-SKKRKERAQVAYERRKQLA  179

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  180  KLRVKAE  186



>ref|XP_008805147.1| PREDICTED: 60S ribosomal protein L13a-2-like [Phoenix dactylifera]
Length=206

 Score =   345 bits (885),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRNPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+HYDTIK LE KRK+R+Q AYE RKQL 
Sbjct  121  KRMVIPDALKVLRLQTGHKYCLLGRLSKEVGWSHYDTIKELEEKRKQRSQVAYEGRKQLA  180

Query  603  KLXVKAE  623
            +L  KAE
Sbjct  181  RLRQKAE  187



>gb|KHF97469.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   345 bits (884),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P P+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPAPFDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHK+CLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKHCLLGRLSSEVGWNHYDTIRELEKKRKERAQVAYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|KJB42469.1| hypothetical protein B456_007G154600 [Gossypium raimondii]
Length=206

 Score =   344 bits (883),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKLVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRL  GHKYCLLG+LSSEVGWNHYDTIK LE KRKERAQ AYER+K+L 
Sbjct  121  KRMVIPDALKVLRLLKGHKYCLLGRLSSEVGWNHYDTIKELEKKRKERAQVAYERKKELN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_003559332.1| PREDICTED: 60S ribosomal protein L13a-4 [Brachypodium distachyon]
Length=206

 Score =   343 bits (880),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGWN+ DTI+ LE KRKE+A+ AY+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGQLSKEVGWNYADTIRELEEKRKEKAKVAYDRRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_003616742.1| 60S ribosomal protein L13A [Medicago truncatula]
 gb|AES99700.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   343 bits (880),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG CA+RVV+DARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGACAKRVVIDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTLRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHK+CLLG+LS+EVGWN+YD IK LENKRKER+Q AYE++KQ+ 
Sbjct  121  KRMVVPDALKVLRLQKGHKFCLLGQLSAEVGWNYYDIIKELENKRKERSQLAYEKKKQIN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_006479280.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|KDO65928.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=206

 Score =   343 bits (879),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI+ LE KRKER+Q AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTIRELEKKRKERSQVAYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|NP_001130808.1| uncharacterized protein LOC100191912 [Zea mays]
 gb|ACG24933.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   342 bits (878),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYER+KQLT
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERKKQLT  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010435310.1| PREDICTED: 60S ribosomal protein L13a-3-like [Camelina sativa]
Length=206

 Score =   342 bits (877),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHM G LAS LAKELLNGQ+VVVVRCEEICLSGGLVR +MKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMSGLLASSLAKELLNGQKVVVVRCEEICLSGGLVRLRMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+R MIPHKTKRGAAALARLKV+EG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRSMIPHKTKRGAAALARLKVFEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDA KVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQL 
Sbjct  121  KRMVIPDAFKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQATYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRTKAE  187



>gb|KHG00254.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   342 bits (877),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKLVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKSYEGVPSPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRL  GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ  YER+K+L 
Sbjct  121  KRMVIPDALKVLRLLKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQVTYERKKELN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|AFK34830.1| unknown [Medicago truncatula]
Length=206

 Score =   342 bits (876),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG CA+RVV+DARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGACAKRVVIDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKP+HGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPNHGPIHFRAPSKIFWRTLRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHK+CLLG+LS+EVGWN+YD IK LENKRKER+Q AYE++KQ+ 
Sbjct  121  KRMVVPDALKVLRLQKGHKFCLLGQLSAEVGWNYYDIIKELENKRKERSQLAYEKKKQIN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|KDP26388.1| hypothetical protein JCGZ_17546 [Jatropha curcas]
Length=206

 Score =   341 bits (874),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA++VVVDARHHMLGRLAS++AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASVVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR P+KI WRT+RGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRNPAKIFWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERSQILYERKKQLN  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_006586250.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
 gb|KHN07181.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=206

 Score =   341 bits (874),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI+ LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTIRELEKKRKERAQLCYERKKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_002466431.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
 gb|AAM47582.1| putative 60S ribosomal protein [Sorghum bicolor]
 gb|EER93429.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
Length=206

 Score =   340 bits (873),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRVVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|NP_001235102.1| uncharacterized protein LOC100499978 [Glycine max]
 gb|ACU14471.1| unknown [Glycine max]
Length=206

 Score =   340 bits (872),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+A   YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIRELEKKRKEKAAVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|NP_001051314.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|AAR01683.1| putative ribosomal protein L13a [Oryza sativa Japonica Group]
 gb|ABF98951.1| 60S ribosomal protein L13a-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13228.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|EAY91906.1| hypothetical protein OsI_13588 [Oryza sativa Indica Group]
 gb|EAZ28629.1| hypothetical protein OsJ_12636 [Oryza sativa Japonica Group]
 dbj|BAG96308.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97551.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01442.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   340 bits (872),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAPRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI+ LE KRKE+A+ AY+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKAKVAYDRRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|ACF79169.1| unknown [Zea mays]
 tpg|DAA51453.1| TPA: ribosomal protein L13A-like protein [Zea mays]
Length=206

 Score =   340 bits (871),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERKKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|NP_001281205.1| 60S ribosomal protein L13a [Zea mays]
 gb|ACN25827.1| unknown [Zea mays]
 gb|AFW67581.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   340 bits (871),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|NP_001276138.1| 60S ribosomal protein L13a-4-like [Glycine max]
 gb|ACU20583.1| unknown [Glycine max]
Length=206

 Score =   340 bits (871),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPY K+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYGKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+AQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCILGRLSSEVGWSYYDTIRELEKKRKEKAQLVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_004981725.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X2 [Setaria 
italica]
Length=206

 Score =   339 bits (870),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_007140600.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
 gb|AGV54439.1| 60S ribosomal protein L13a [Phaseolus vulgaris]
 gb|ESW12594.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
Length=206

 Score =   339 bits (869),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AAL RLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALDRLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLGKLSSEVGWN+YDTI+ LE KRK+RA   YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGKLSSEVGWNYYDTIRELEKKRKDRALLCYERKKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|KHN07182.1| 60S ribosomal protein L13a-1 [Glycine soja]
Length=206

 Score =   338 bits (867),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI+ LE KRKERAQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTIRELEKKRKERAQLCYERKKQLA  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLREKAE  187



>ref|XP_011024678.1| PREDICTED: 60S ribosomal protein L13a-4-like [Populus euphratica]
Length=206

 Score =   338 bits (866),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+ VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKVVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTK+G AALARL+ YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKKGEAALARLRAYEGIPPPYDKK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI+ LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIRELEEKRKERSQVRYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>gb|ACG36118.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   337 bits (865),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+VIPDALKVLRLQ GHKYCLLG+L  EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELXKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_007200528.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
 gb|EMJ01727.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
Length=206

 Score =   337 bits (864),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVD RHHMLGRLAS++AK+LLNGQR+ VVRC+EI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASVVAKDLLNGQRIAVVRCDEIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RF RKRMNT+PSHGPIHFR+P+KI WRT+RGMIPHKTKRGA ALARLK YEG+PPPYDK 
Sbjct  61   RFRRKRMNTQPSHGPIHFRSPAKIFWRTVRGMIPHKTKRGAEALARLKAYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNH+DTIK LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHFDTIKALEEKRKERAQLAYERKKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_002439183.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
 gb|EES17613.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
Length=206

 Score =   337 bits (864),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+ A+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGLSAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRVVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_010547080.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   337 bits (863),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKL  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYCLLG LSSEVGWNHYDTIK LE KRKE++QA YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGHLSSEVGWNHYDTIKELEKKRKEKSQAVYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|NP_001236202.1| uncharacterized protein LOC100527190 [Glycine max]
 gb|ACU16241.1| unknown [Glycine max]
Length=206

 Score =   337 bits (863),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI+ LE KRK+RAQ  YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTIRELEKKRKDRAQLCYERKKQLA  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLREKAE  187



>gb|ACG33474.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   337 bits (863),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSH PIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHRPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>pdb|3J61|O Chain O, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50984.1| ribosomal protein L13a [Triticum aestivum]
 dbj|BAJ92402.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50837.1| 60S ribosomal protein L13a-4 [Triticum urartu]
 gb|EMT20078.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=206

 Score =   336 bits (861),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKT RG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTARGEAALARLKAYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GH+YCLLG+LS EVGWN+ DTI+ LE KRKE+A+ +Y+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGQLSKEVGWNYADTIRELEEKRKEKAKVSYDRRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_002301785.2| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK92693.1| unknown [Populus trichocarpa]
 gb|ABK94779.1| unknown [Populus trichocarpa]
 gb|EEE81058.2| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   335 bits (860),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+ V+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKVVLVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTK+G AALARLK YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKKGEAALARLKAYEGIPPPYDKK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYD I+ LE KRKER+Q  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDIIRELEEKRKERSQVRYERKKQLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>gb|ACG37566.1| 60S ribosomal protein L13a [Zea mays]
Length=222

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R  VDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRXXVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_006443602.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
 gb|ESR56842.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
Length=382

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  177  MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  236

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  237  RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  296

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI+ LE KRKER+Q AYER+KQL 
Sbjct  297  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTIRELEKKRKERSQVAYERKKQLN  356

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  357  KLRAKAE  363



>ref|XP_007147486.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
 gb|ESW19480.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
Length=206

 Score =   334 bits (857),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AAL RLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALDRLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRK++A   YER+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIRELEKKRKDKAGLVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|KCW58066.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=240

 Score =   335 bits (858),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 177/221 (80%), Gaps = 34/221 (15%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALK----------------------------------VLRLQAGHKYCLLGKL  500
            KRMVIPDALK                                  VLRLQ GHKYCLLG+L
Sbjct  121  KRMVIPDALKYVSCFHLCCVHFGTVFSVVAYVNLMCNLHCDLYRVLRLQKGHKYCLLGRL  180

Query  501  SSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            SSEVGWNHYDTI+ LE KRKERAQA YER+KQLTKL VKAE
Sbjct  181  SSEVGWNHYDTIRELEKKRKERAQAVYERKKQLTKLRVKAE  221



>ref|XP_003546257.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
Length=206

 Score =   333 bits (854),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+V VVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVAVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC+LG+LS EVGW++YDTI+ LE KRKE+A+  Y R+KQL 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSPEVGWSYYDTIRELEKKRKEKAELVYARKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>gb|ACJ83838.1| unknown [Medicago truncatula]
 gb|AFK37771.1| unknown [Medicago truncatula]
 gb|KEH22805.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   333 bits (853),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICASGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALAR+KVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARMKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC LG+LS+EVGWN+  TIK LE KRKERA AAYE++KQ+ 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCSLGQLSAEVGWNYAGTIKELETKRKERAFAAYEKKKQIN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_010685006.1| PREDICTED: 60S ribosomal protein L13a-2 [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   333 bits (853),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+ A+RVVVDARHHM GRLASI+AKELL GQRVVV RCE I LSGGLVRQKMKY 
Sbjct  1    MVSGSGVMAKRVVVDARHHMCGRLASIVAKELLTGQRVVVTRCEAIALSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+V+PDALKVLRLQ GHKYCLLG+LS EVGWNHYDTI+ LE KRKER++A YER+KQL 
Sbjct  121  KRVVVPDALKVLRLQKGHKYCLLGRLSKEVGWNHYDTIRELEEKRKERSKAVYERKKQLN  180

Query  603  KLXVKAE  623
            +L VKAE
Sbjct  181  RLRVKAE  187



>gb|KHN31417.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=204

 Score =   332 bits (852),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLAS   KELLNGQ+V VVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLAS--EKELLNGQKVAVVRCEEICISGGLVRQKMKYL  58

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  59   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  118

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+AQ  YER+KQL 
Sbjct  119  KRMVVPDALKVLRLQKGHKYCILGRLSSEVGWSYYDTIRELEKKRKEKAQLVYERKKQLN  178

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  179  KLRVKAE  185



>gb|ACG48503.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   332 bits (851),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            K MVIPDALKVLRLQ GHKYCLLG+L  EVGWN +D I+ LE KRKE+A+ AYER+KQL 
Sbjct  121  KXMVIPDALKVLRLQPGHKYCLLGELXKEVGWNXHDXIRELEEKRKEKAKVAYERKKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_008235481.1| PREDICTED: 60S ribosomal protein L13a-1-like [Prunus mume]
Length=206

 Score =   332 bits (851),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGIC +RVVVD RHHMLGRLAS++AK+LLNGQR+ VVR +EI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICLKRVVVDGRHHMLGRLASVVAKDLLNGQRIAVVRSDEIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RF RKRMNT+PSHGPIHFR+P+KI WRT+RGMIPHKTKRGA ALARLK YEG+PPPYDK 
Sbjct  61   RFRRKRMNTQPSHGPIHFRSPAKIFWRTVRGMIPHKTKRGAEALARLKAYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNH+DTIK LE KRKERAQ AYER+KQLT
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHFDTIKALEEKRKERAQLAYERKKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>gb|ABQ57364.1| ribosomal protein L13A [Lupinus luteus]
Length=206

 Score =   332 bits (851),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG  ALARLKVYEG+PPP+DK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEHALARLKVYEGIPPPFDKQ  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+V+PDALK LRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKER+Q  YER+KQL 
Sbjct  121  KRLVVPDALKGLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQVVYERKKQLN  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|NP_001058724.1| Os07g0109500 [Oryza sativa Japonica Group]
 dbj|BAC79560.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAD30642.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAF20638.1| Os07g0109500 [Oryza sativa Japonica Group]
 gb|EAZ02520.1| hypothetical protein OsI_24624 [Oryza sativa Indica Group]
 dbj|BAG88872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95855.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   331 bits (848),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK ++GVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQLT
Sbjct  121  KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLT  180

Query  603  KLXVKAE  623
            +L VKAE
Sbjct  181  RLRVKAE  187



>sp|O65055.1|RL13A_PICMA RecName: Full=60S ribosomal protein L13a [Picea mariana]
 gb|AAC32117.1| probable 60s ribosomal protein L13a [Picea mariana]
Length=206

 Score =   331 bits (848),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHKTKRGAAALA L+ +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHKTKRGAAALATLRAFEGVPPPYDRK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE KRK +AQ +YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEEKRKAKAQVSYERRKQLA  180

Query  603  KLXVKA  620
            KL  KA
Sbjct  181  KLRSKA  186



>ref|XP_008365936.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=206

 Score =   330 bits (847),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVD RHHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+P PYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPXPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ  YER+KQLT
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTIKELENKRKERAQLXYERKKQLT  180

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  181  KLRLKAE  187



>ref|XP_003589380.1| 60S ribosomal protein L13a [Medicago truncatula]
 gb|ACJ85949.1| unknown [Medicago truncatula]
 gb|AES59631.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
 gb|AFK44083.1| unknown [Medicago truncatula]
Length=206

 Score =   330 bits (846),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICASGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWN+   IK LE+KRKERA  AYE++K L 
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYGGIIKELEDKRKERAGLAYEKKKLLN  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRAKAE  187



>ref|XP_010228462.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brachypodium distachyon]
Length=206

 Score =   330 bits (845),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEI +SGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEISVSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK YEGVPPP+D+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAYEGVPPPFDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQAGHKYC LG+LS EVGWN+ DTI+ LE KRKE+A+ +Y+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQAGHKYCQLGELSKEVGWNYQDTIRELEEKRKEKAKVSYDRRKQLA  180

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  181  KLRVKAE  187



>ref|XP_009334926.1| PREDICTED: 60S ribosomal protein L13a-1-like [Pyrus x bretschneideri]
Length=206

 Score =   328 bits (842),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVD  HHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGHHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRM +PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQ AYER+K+LT
Sbjct  121  KRMAVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTIKELENKRKERAQLAYERKKRLT  180

Query  603  KLXVKAE  623
            KL +K+E
Sbjct  181  KLRLKSE  187



>gb|EAZ38446.1| hypothetical protein OsJ_22825 [Oryza sativa Japonica Group]
Length=206

 Score =   327 bits (837),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK ++GVP PYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPLPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMV+PDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQLT
Sbjct  121  KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLT  180

Query  603  KLXVKAE  623
            +L VKAE
Sbjct  181  RLRVKAE  187



>sp|O49885.1|RL13A_LUPLU RecName: Full=60S ribosomal protein L13a [Lupinus luteus]
 emb|CAA11283.1| ribosomal protein L13a [Lupinus luteus]
Length=205

 Score =   324 bits (830),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 171/187 (91%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGI A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIH  APSKI WRT+RGMIPHKTKRG  ALARLKVYEG+PPP+DK 
Sbjct  61   RFLRKRMNTKPSHGPIHC-APSKIFWRTVRGMIPHKTKRGEHALARLKVYEGIPPPFDKQ  119

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KR+V+PDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKER+Q  YER+KQL 
Sbjct  120  KRLVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQVVYERKKQLN  179

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  180  KLRVKAE  186



>ref|XP_001774253.1| predicted protein [Physcomitrella patens]
 gb|EDQ60889.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   322 bits (826),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTIK LE KRK ++   YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSNVFYERKKQLI  180

Query  603  KLXVKA  620
            +L +KA
Sbjct  181  QLRLKA  186



>ref|XP_001763759.1| predicted protein [Physcomitrella patens]
 gb|EDQ71401.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   322 bits (825),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ++VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKIVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTIK LE KRK +++  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSKVFYERKKQLI  180

Query  603  KLXVKA  620
            +L +KA
Sbjct  181  QLRLKA  186



>ref|XP_001765352.1| predicted protein [Physcomitrella patens]
 gb|EDQ69815.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   320 bits (821),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRL+ GHK+CLLG+LS EVGW+HYDTIK LE KRK +++  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLKPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSKVFYERKKQLI  180

Query  603  KLXVKA  620
            +L +KA
Sbjct  181  QLRLKA  186



>ref|XP_001773626.1| predicted protein [Physcomitrella patens]
 gb|EDQ61514.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   319 bits (818),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+ VVVDARHHMLGRLASIL+KELLNGQ+VVVVR EEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILSKELLNGQKVVVVRSEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTIK LE KRK +++  YER+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSKVFYERKKQLI  180

Query  603  KLXVKA  620
            +L +KA
Sbjct  181  QLRLKA  186



>ref|XP_001765905.1| predicted protein [Physcomitrella patens]
 gb|EDQ69226.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   319 bits (817),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVR EEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRSEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTIK LE KRK +++  Y+R+KQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTIKELEEKRKAKSKVFYQRKKQLL  180

Query  603  KLXVKA  620
            +L +KA
Sbjct  181  QLRLKA  186



>ref|XP_004981724.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X1 [Setaria 
italica]
Length=241

 Score =   320 bits (820),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 176/222 (79%), Gaps = 35/222 (16%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG-----------------------------  335
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRG                             
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGYVSSFLDPSPVRRRCFDVPIFQFVGEIFC  120

Query  336  ------MIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGK  497
                  MIPHKTKRG AALARLK YEGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+
Sbjct  121  LLWFCRMIPHKTKRGEAALARLKTYEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGE  180

Query  498  LSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL KL VKAE
Sbjct  181  LSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRVKAE  222



>ref|XP_007223448.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 gb|EMJ24647.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=187

 Score =   317 bits (813),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TIKV
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETIKV  160



>gb|ABK22228.1| unknown [Picea sitchensis]
 gb|ABK22389.1| unknown [Picea sitchensis]
 gb|ABK22608.1| unknown [Picea sitchensis]
 gb|ABK23686.1| unknown [Picea sitchensis]
 gb|ABK23694.1| unknown [Picea sitchensis]
 gb|ABK26243.1| unknown [Picea sitchensis]
 gb|ABK26404.1| unknown [Picea sitchensis]
 gb|ABR17228.1| unknown [Picea sitchensis]
 gb|ACN40291.1| unknown [Picea sitchensis]
 gb|ACN40454.1| unknown [Picea sitchensis]
 gb|ACN40588.1| unknown [Picea sitchensis]
 gb|ACN40688.1| unknown [Picea sitchensis]
 gb|ADE77397.1| unknown [Picea sitchensis]
Length=206

 Score =   317 bits (813),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHKTKRGAAALARL+ +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHKTKRGAAALARLRAFEGVPPPYDRK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE KRK +AQ +YERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEEKRKAKAQVSYERRKQLA  180

Query  603  KLXVKA  620
            KL  KA
Sbjct  181  KLRSKA  186



>ref|XP_006855707.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
 gb|ERN17174.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
Length=171

 Score =   315 bits (808),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/161 (95%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICAR VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAAL+RLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALSRLKVYEGVPPPYDKK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVL  545
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIKV+
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTIKVI  161



>ref|XP_006657401.1| PREDICTED: 60S ribosomal protein L13a-3-like [Oryza brachyantha]
Length=206

 Score =   316 bits (810),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+C RRVVVDAR+HM+GRLAS +AKELLNGQRVVVVRCEE+C+SGG VRQKMKY 
Sbjct  1    MVSGSGVCRRRVVVDARNHMMGRLASAVAKELLNGQRVVVVRCEEMCVSGGPVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK + GVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALAALKAFGGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG LS EVGWN++DTI+ LE KRKE+ + AYERRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGHLSKEVGWNYHDTIRELEEKRKEKGKVAYERRKQLA  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRFKAE  187



>gb|KJB72097.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=169

 Score =   314 bits (804),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTIKV
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTIKV  160



>gb|AIC33046.1| 60S ribosomal protein L13a, partial [Panax ginseng]
Length=157

 Score =   313 bits (802),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 150/157 (96%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDT  533
            KRMVIPDALKVLRLQAGHKYCLLG+LS+EVGWN+YDT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSAEVGWNYYDT  157



>dbj|BAK07924.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   317 bits (811),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +3

Query  39   E*REDAAKMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGL  218
            E R     MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGL
Sbjct  37   EGRSQQVTMVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGL  96

Query  219  VRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG  398
            VRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKT RG AALARLK +EG
Sbjct  97   VRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTPRGEAALARLKAFEG  156

Query  399  VPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAA  578
            VPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+++TIK LE KRKE+A+ +
Sbjct  157  VPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHETIKELEEKRKEKAKVS  216

Query  579  YERRKQLTKLXVKAE  623
            Y+RRKQL KL VKAE
Sbjct  217  YDRRKQLAKLRVKAE  231



>gb|KCW57253.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=181

 Score =   312 bits (799),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+C +RVVVD RHHMLGRLAS+LAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCVKRVVVDGRHHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK +EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIKV
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKV  160



>gb|KCW58067.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=174

 Score =   311 bits (796),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+V
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRV  160



>gb|KGN66498.1| hypothetical protein Csa_1G615170 [Cucumis sativus]
Length=202

 Score =   310 bits (794),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 170/187 (91%), Gaps = 4/187 (2%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+   Y+ V
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGL-CIYELV  119

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
               ++    +VLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL 
Sbjct  120  ---MLVWKFRVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLN  176

Query  603  KLXVKAE  623
            KL +KAE
Sbjct  177  KLRIKAE  183



>gb|EMT05694.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=238

 Score =   311 bits (797),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 174/219 (79%), Gaps = 32/219 (15%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAFEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV--------------------  542
            KRMVIPDALKVLRLQ GH++CLLG+LS EVGWN+++TIK+                    
Sbjct  121  KRMVIPDALKVLRLQPGHRFCLLGELSKEVGWNYHETIKLMAIDHQDLQRDVRFLIGGLF  180

Query  543  ------------LENKRKERAQAAYERRKQLTKLXVKAE  623
                        LE KRKE+A+ +Y+R+KQL KL +KAE
Sbjct  181  LILDLSACLENELEEKRKEKAKLSYDRKKQLAKLRIKAE  219



>gb|KJB22645.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=173

 Score =   307 bits (787),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI+V
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTIRV  160



>gb|EMS52180.1| 60S ribosomal protein L13a-4 [Triticum urartu]
Length=206

 Score =   308 bits (789),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAFEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GH++CLLG+LS EVGWN+++TIK LE KRKE+A+ +Y+RRKQL 
Sbjct  121  KRMVIPDALKVLRLQPGHRFCLLGELSKEVGWNYHETIKELEEKRKEKAKVSYDRRKQLA  180

Query  603  KLXVKAE  623
            KL  KAE
Sbjct  181  KLRFKAE  187



>gb|KDO65929.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=179

 Score =   305 bits (782),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI+V
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTIRV  160



>ref|XP_002964465.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
 ref|XP_002975331.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ23532.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ34798.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
Length=206

 Score =   305 bits (782),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG CAR VV+DARHHMLGRLASI AKELLNGQR+V+ RCEEI LSGGLVRQKMKY 
Sbjct  1    MVSGSGACARVVVIDARHHMLGRLASIAAKELLNGQRLVITRCEEIALSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFRAP++ILWRTIRGMIPHKTKRGAAAL RLKV+EG PPPYDK 
Sbjct  61   RFLRKRMNTKPSKGPIHFRAPARILWRTIRGMIPHKTKRGAAALERLKVFEGCPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            K+MV+PDALKVLRL+ GHK+CLLG+LS EVGW+H++TIK LE KRK +A   Y+++K+L 
Sbjct  121  KKMVVPDALKVLRLKPGHKFCLLGQLSKEVGWHHHETIKELEEKRKAKALVFYQKKKELL  180

Query  603  KLXVKA  620
            KL  KA
Sbjct  181  KLRQKA  186



>gb|ACN36734.1| unknown [Zea mays]
 gb|AFW67580.1| hypothetical protein ZEAMMB73_211853 [Zea mays]
Length=179

 Score =   302 bits (773),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+V
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRV  160



>ref|XP_008382629.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=161

 Score =   288 bits (738),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVD RHHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+P PYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPXPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTIKV
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTIKV  160



>ref|XP_004955326.1| PREDICTED: 60S ribosomal protein L13a-3-like [Setaria italica]
Length=200

 Score =   282 bits (722),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 157/187 (84%), Gaps = 6/187 (3%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSG       VVVDAR HM+GRLAS +AKELL GQRV V+RCEE+ LSGGLVRQK ++ 
Sbjct  1    MVSGC------VVVDARGHMMGRLASAVAKELLKGQRVAVLRCEEMTLSGGLVRQKSRFL  54

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGP+H R+P++I WR +RGM+PHKT RG AALARL+ ++GVPPPYD+ 
Sbjct  55   RFLRKRMNTKPSHGPVHHRSPARIFWRAVRGMVPHKTARGEAALARLQAFDGVPPPYDRT  114

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT  602
            KRMVIPDALKVLRLQ GHKYCLLG LS EVGWN+ DTI+ LE KRKE+A+ AY+R+KQL 
Sbjct  115  KRMVIPDALKVLRLQKGHKYCLLGDLSKEVGWNYQDTIRELEEKRKEKAKVAYDRKKQLA  174

Query  603  KLXVKAE  623
            KL VKAE
Sbjct  175  KLRVKAE  181



>ref|XP_002953387.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45697.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=185

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D R HMLGRLAS++AK++L+GQ++VVVR E+I +SGGLVRQKMKY RFLRKRMNT P
Sbjct  5    VVIDGRAHMLGRLASVVAKQILSGQQIVVVRAEDITISGGLVRQKMKYDRFLRKRMNTNP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPS+I WRT+RGMIPHKT RGAAAL RLK +EGVP PYDKVKRMV+PDALKV
Sbjct  65   TRGPFHFRAPSRIFWRTVRGMIPHKTARGAAALERLKAFEGVPHPYDKVKRMVVPDALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            LRLQ GH+ C LG LS+ VGW H   +  LE KRK +A+A Y  +K+L  L VKA
Sbjct  125  LRLQHGHRCCKLGDLSAAVGWKHQAAVAELEEKRKAKAKAFYVAKKKLIALRVKA  179



>ref|XP_005849945.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
 gb|EFN57843.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
Length=180

 Score =   253 bits (646),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   CARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRM  263
            C + VVVD R HMLGRLAS+LAK+LL+GQ VV VRCEEI +SGG+VRQK KY RFLRKR 
Sbjct  1    CVQTVVVDCRGHMLGRLASVLAKQLLSGQHVVCVRCEEINISGGMVRQKAKYERFLRKRS  60

Query  264  NTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPD  443
             T P  G + FRAPS+ILWRT+RGM PHKT RGAAAL RLK +EG+P PYDKVKRMVIPD
Sbjct  61   VTNPRRGAVKFRAPSRILWRTVRGMTPHKTARGAAALERLKAFEGIPAPYDKVKRMVIPD  120

Query  444  ALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            ALKVLRLQ GH+YC LG L+S VGW H + +K LE KRK ++ A YE +K+L  L  KAE
Sbjct  121  ALKVLRLQHGHRYCQLGNLASSVGWKHEEAVKELEAKRKVKSAAYYEAKKKLRSLRAKAE  180



>ref|XP_001692909.1| ribosomal protein L13a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP03478.1| ribosomal protein L13a [Chlamydomonas reinhardtii]
Length=185

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D R HMLGRLAS++AK++L GQ++VVVR EEI +SGGLVRQKMKY RFLRKRMNT P
Sbjct  5    VVIDGRAHMLGRLASVVAKQILAGQQIVVVRAEEITISGGLVRQKMKYDRFLRKRMNTNP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPS+I WRT+RGMIPHKT RGAAAL RLK +EG+P PYDKVKR+V+PDALKV
Sbjct  65   TRGPFHFRAPSRIFWRTVRGMIPHKTARGAAALERLKAFEGIPHPYDKVKRLVVPDALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            LRLQ GH+ C LG LS+ VGW H   +  LE KRK +A+A Y  +K+L  L  KA
Sbjct  125  LRLQHGHRNCKLGDLSASVGWKHQAAVAELEEKRKAKAKAFYVAKKKLVALRSKA  179



>gb|AAX92709.1| 60S ribosomal protein L13a [Picea abies]
Length=170

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  171  RVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHK  350
            RVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHK
Sbjct  1    RVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHK  60

Query  351  TKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYD  530
            TKRGAAALARL+ +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+D
Sbjct  61   TKRGAAALARLRAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFD  120

Query  531  TIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            TI  LE KRK +AQ +YERRKQL KL  KA
Sbjct  121  TITELEEKRKAKAQVSYERRKQLAKLRSKA  150



>gb|KDO65930.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=130

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  423  KRMVIPDALK  452
            KRMVIPDALK
Sbjct  121  KRMVIPDALK  130



>ref|XP_005643971.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19427.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=185

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+DAR HMLGRLASI+AK+ LNGQ +VV R EEI +SGGLVRQKMKY RFLRKRMN+ P
Sbjct  5    VVIDARGHMLGRLASIVAKQALNGQHIVVTRAEEINVSGGLVRQKMKYERFLRKRMNSNP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GPIHFRAPS+I WRT+RGM+PHKTKRGAAAL RLK +EGVPPPYDKVKRMV+PDALKV
Sbjct  65   KKGPIHFRAPSRIFWRTVRGMVPHKTKRGAAALERLKTFEGVPPPYDKVKRMVVPDALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAY  581
            LRLQ GHK+C LG L++ VGW H  ++  LE +R E+A+  Y
Sbjct  125  LRLQHGHKFCKLGDLAASVGWKHKASVAELEARRLEKAKGFY  166



>sp|P93099.1|RL13A_CYAPA RecName: Full=60S ribosomal protein L13a [Cyanophora paradoxa]
 emb|CAA71090.1| ribosomal protein L13a [Cyanophora paradoxa]
Length=200

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD R H+LGRLA+ LAKELLNGQRVV VR EEI +SG L R K+K+H FL+KRMNT P
Sbjct  6    VVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNTNP  65

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GP HFR+P++ILWRTIRGMIPHKT RGAAAL RLK +EGVPPPYDK+KRMVIP AL+V
Sbjct  66   RRGPFHFRSPARILWRTIRGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIPQALRV  125

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKL  608
            LRL+ G K+C+LG+L++EVGW H D +  LE KRK ++ A Y R+K L  L
Sbjct  126  LRLKPGRKFCVLGRLATEVGWRHSDLVTRLEEKRKTKSAAFYARKKTLVNL  176



>ref|XP_010661466.1| PREDICTED: 60S ribosomal protein L13a-2-like [Vitis vinifera]
Length=249

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  CEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA  368
            CEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA
Sbjct  121  CEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA  180

Query  369  ALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLE  548
             LARLK YEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LS EVGWNHYDTI+ LE
Sbjct  181  TLARLKAYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSLEVGWNHYDTIRELE  240

Query  549  NKRKERAQA  575
             KRKER  A
Sbjct  241  KKRKERRLA  249



>ref|XP_001630812.1| predicted protein [Nematostella vectensis]
 gb|EDO38749.1| predicted protein [Nematostella vectensis]
Length=201

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +3

Query  90   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  269
            +++V+D   H+LGRLAS +AK +L+GQRVVVVRCE+IC+SG   R K+KY  FLRKR NT
Sbjct  5    KQIVIDGAGHLLGRLASTVAKSILSGQRVVVVRCEKICISGNFYRNKLKYLDFLRKRTNT  64

Query  270  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  449
            KPSHGP HFRAPS+I WRT+RGMIPHKTK+G  A+ R+KV++GVPPPYDK KRMV+P AL
Sbjct  65   KPSHGPFHFRAPSRIFWRTVRGMIPHKTKKGTEAMNRMKVFDGVPPPYDKEKRMVVPSAL  124

Query  450  KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            KV+RL+ G K+C+LG+LS EVGW + D ++ LE KRK +++  +E +K++ KL   AE
Sbjct  125  KVIRLKPGRKFCVLGRLSHEVGWKYQDILETLEEKRKAKSKLYFEHKKKVQKLKQTAE  182



>ref|XP_004349662.1| ribosomal protein L13, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22573.1| ribosomal protein L13, putative [Acanthamoeba castellanii str. 
Neff]
Length=204

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLASI+AK++LNGQR+VVVRCEEI +SG   R K+KY  FL+K  N +P
Sbjct  10   LVIDGRGHLLGRLASIVAKQILNGQRLVVVRCEEINVSGSFFRNKLKYLSFLKKCSNVRP  69

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            +HGP H+RAPSKI WRT+RGM+ HKT RGA AL RLKV+EGVPPPYDK+KRMV P AL+V
Sbjct  70   THGPYHYRAPSKIFWRTVRGMVAHKTARGAEALGRLKVFEGVPPPYDKMKRMVCPAALRV  129

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            LRL+ G  Y ++G+LS EVGW H  T+K LE KRK R+ A YER+K L +L  KA
Sbjct  130  LRLKPGRAYTVIGRLSEEVGWKHAATVKKLEEKRKVRSAAYYERKKALARLQTKA  184



>emb|CDO99456.1| unnamed protein product [Coffea canephora]
Length=140

 Score =   234 bits (598),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  261  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  440
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGIPPPYDKIKRMVIP  60

Query  441  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRKERAQ AY+R+KQLT+L +KA
Sbjct  61   DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRELEKKRKERAQVAYQRKKQLTQLRIKA  120

Query  621  E  623
            E
Sbjct  121  E  121



>emb|CBI37325.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   234 bits (598),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  261  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  440
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIP  60

Query  441  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            DALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQLTKL VKA
Sbjct  61   DALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQLAYERKKQLTKLRVKA  120

Query  621  E  623
            E
Sbjct  121  E  121



>gb|AAX48846.1| L13a [Suberites domuncula]
Length=199

 Score =   236 bits (603),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = +3

Query  90   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  269
            R+V++D + H+LGRLASI+AK +L GQR+V+VRCE+I +SG   R K+KY +FL  R N 
Sbjct  2    RQVLIDGKGHLLGRLASIVAKCILQGQRIVIVRCEDINISGSFYRNKLKYLKFLNLRCNV  61

Query  270  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  449
             P  GP HFRAPS+I WRT+RGM+PHKTKRG  AL RLKV+EG+PPPYDK KRMV+P+AL
Sbjct  62   NPKRGPFHFRAPSRIFWRTVRGMVPHKTKRGMEALNRLKVFEGIPPPYDKQKRMVVPNAL  121

Query  450  KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +VLRL+ G KYC +G++S E+GW + D +K LE KRK RA   Y+R+KQ+ +   KAE
Sbjct  122  RVLRLKPGRKYCDIGRISHEIGWKYKDVVKTLEEKRKARATEFYQRKKQVLRFKAKAE  179



>gb|KHN23001.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=150

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  231  MKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPP  410
            MKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPP
Sbjct  1    MKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPP  60

Query  411  YDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERR  590
            YDK KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+A   YER+
Sbjct  61   YDKTKRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIRELEKKRKEKAAVVYERK  120

Query  591  KQLTKLXVKAE  623
            KQL KL VKAE
Sbjct  121  KQLNKLRVKAE  131



>ref|NP_001051312.2| Os03g0755700 [Oryza sativa Japonica Group]
 dbj|BAF13226.2| Os03g0755700 [Oryza sativa Japonica Group]
Length=178

 Score =   233 bits (594),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 126/163 (77%), Gaps = 25/163 (15%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA RVVVDARHHML RLASI+AKELLNG+RVVV                    
Sbjct  1    MVSGSGVCAPRVVVDARHHMLSRLASIIAKELLNGKRVVV--------------------  40

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
                 RMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YE V PPYD+ 
Sbjct  41   -----RMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEVVTPPYDRT  95

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLEN  551
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI+ L  
Sbjct  96   KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRALRT  138



>gb|EUB62915.1| 60S ribosomal protein L13a [Echinococcus granulosus]
 emb|CDI99730.1| ribosomal protein rpl13a [Echinococcus multilocularis]
 emb|CDS18961.1| ribosomal protein rpl13a [Echinococcus granulosus]
 emb|CDS37012.1| ribosomal protein rpl13a [Echinococcus multilocularis]
Length=202

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++DAR H+LGRLASI+AK LL GQR+VVVRCEEI +SG L R K+KYH FLRKRMNT P
Sbjct  8    IIIDARGHLLGRLASIVAKTLLQGQRIVVVRCEEINISGSLYRNKLKYHEFLRKRMNTNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            SHGP H+RAP+KI WRT+RGM+PHK  RG  AL+RLK +EG+PPPYDK KR+V+P AL+V
Sbjct  68   SHGPYHYRAPAKIFWRTVRGMLPHKLYRGKEALSRLKCFEGIPPPYDKKKRVVVPSALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRK  593
            LRL+   K+C L +LSSEVGW + + IK +E +RK RA   Y+++K
Sbjct  128  LRLKQRRKFCTLSRLSSEVGWKYENVIKKMEARRKARAAVWYKKKK  173



>ref|XP_002112893.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV25003.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=202

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++D R+H+LGRLAS +AK +L+GQRVVVVRCEE+ +SGG  R K+KY  FLRKR N  P
Sbjct  7    IIIDGRNHLLGRLASTIAKTILSGQRVVVVRCEELNISGGFYRNKLKYLDFLRKRCNVNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GP HFRAPS+ILWRT+RGM+PHKTKRG  AL RLK +EG+P PYDK+KR+V+P AL+V
Sbjct  67   RRGPFHFRAPSRILWRTVRGMVPHKTKRGEEALNRLKTFEGIPAPYDKMKRLVVPAALRV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            ++L+   K+ ++GKLSSEVGW + D I  LE KRK +A+A YE +++L K   +AE
Sbjct  127  VQLKPRRKFTVVGKLSSEVGWKYNDIISTLEEKRKAKAKAFYENKRRLQKFKREAE  182



>gb|EPZ33870.1| 60S ribosomal protein L13a [Rozella allomycis CSF55]
Length=201

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            V++D + H+LGRLASI+AK+LL GQ+VVVVRCEEI +SG   R K+KY  F+RKR    P
Sbjct  7    VIIDGKGHLLGRLASIVAKQLLKGQKVVVVRCEEINISGSFFRNKLKYAEFVRKRCVVNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WR +RGMIPHKT RGAAAL R+KV+EGVP PYDKVKR+V+PDAL+V
Sbjct  67   SRGPFHFRAPSRIFWRVVRGMIPHKTARGAAALERMKVFEGVPSPYDKVKRVVVPDALRV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYER  587
            LRL+ G K+C+L +LS E GW + + +K LE KRK +++A YER
Sbjct  127  LRLKPGRKFCVLSRLSQEYGWKYQEVVKTLEEKRKTKSKAFYER  170



>emb|CBI17324.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   229 bits (585),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  261  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  440
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIP  60

Query  441  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            DALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERA+ AYER+KQL KL VKA
Sbjct  61   DALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELEKKRKERAELAYERKKQLNKLRVKA  120

Query  621  E  623
            E
Sbjct  121  E  121



>emb|CDS32619.1| ribosomal protein rpl13a [Hymenolepis microstoma]
Length=202

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+DAR H+LGRLASI+AK LLNGQ++VVVRCEEI +SG L R K+KYH FLRKRMNT P
Sbjct  8    IVIDARDHLLGRLASIVAKTLLNGQKIVVVRCEEINISGSLYRNKLKYHEFLRKRMNTNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAP+KI WRT+RGM+PHK  RG  ALA+LK +EGVPPPYDK KR+V+P AL+V
Sbjct  68   SRGPYHFRAPAKIFWRTVRGMLPHKLYRGKTALAKLKCFEGVPPPYDKKKRVVVPSALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERR  590
            LRL+   K+C L +LSSEVGW + + I  +E +RK RA   Y+++
Sbjct  128  LRLKQRRKFCTLSRLSSEVGWKYENVINKMEARRKARAAVWYKKK  172



>gb|ABW23219.1| ribosomal protein rpl13a [Eurythoe complanata]
Length=202

 Score =   231 bits (589),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+DAR HMLGRLASI+AK +L GQ VV+VRCE I +SG   R K+KY  FLRKR NTKP
Sbjct  7    IVIDARGHMLGRLASIVAKTILQGQNVVIVRCEGINISGNFYRNKLKYLDFLRKRCNTKP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP H+RAPSKI WRT+RGM+PHK KRG  AL R+KV+EG+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHYRAPSKIFWRTVRGMLPHKLKRGKEALDRMKVFEGIPPPYDKEKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            LR++   K+C+LG+LS EVGW + + I  LE KRK +++  YE+RK + KL  +A
Sbjct  127  LRVKPRRKFCVLGRLSHEVGWKYQNVIATLEAKRKVKSKKFYEKRKNVEKLKKQA  181



>gb|AAR01666.1| putative ribosomal protein L13a [Oryza sativa Japonica Group]
Length=172

 Score =   230 bits (586),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 125/160 (78%), Gaps = 26/160 (16%)
 Frame = +3

Query  63   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGSG+CA RVVVDARHHML RLASI+AKELLNG+RVV                     
Sbjct  1    MVSGSGVCAPRVVVDARHHMLSRLASIIAKELLNGKRVV---------------------  39

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
                 RMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YE V PPYD+ 
Sbjct  40   -----RMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEVVTPPYDRT  94

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV  542
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI++
Sbjct  95   KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRI  134



>ref|XP_002436282.1| ribosomal protein L13A, putative [Ixodes scapularis]
 gb|EEC09112.1| ribosomal protein L13A, putative [Ixodes scapularis]
Length=205

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  75   SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  254
            +GI ++ +++D + H+LGRL++++AK LL+GQRVVVVRCE IC+SG   R K+KY  FLR
Sbjct  2    TGISSKPIIIDGQGHLLGRLSALIAKTLLHGQRVVVVRCEGICISGSFFRSKLKYLSFLR  61

Query  255  KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV  434
            KR N  P  GP HFRAPSKILWRT+RGM+PHKTKRGA AL RLK++EGVPPPYD+ KRMV
Sbjct  62   KRCNVNPKRGPYHFRAPSKILWRTVRGMVPHKTKRGALALDRLKMFEGVPPPYDRKKRMV  121

Query  435  IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXV  614
            +P AL+VLRL    KYC LG+L  EVGW + + I+ LE KRK +A   Y+ +K+  KL  
Sbjct  122  VPSALRVLRLNPRRKYCTLGRLGHEVGWKYQNVIESLEMKRKAKAALYYKDKKRDRKLFA  181

Query  615  KAE  623
            +A+
Sbjct  182  EAK  184



>gb|ESA01198.1| hypothetical protein GLOINDRAFT_334214 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX57733.1| ribosomal 60S subunit protein L16A [Rhizophagus irregularis DAOM 
197198w]
Length=202

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD + H++GRLASI+AK++L GQ+VV+VR EE+ +SG   R K+KYH +LRKRM   P
Sbjct  8    VVVDGKGHLIGRLASIVAKQILTGQKVVIVRAEELNVSGSFFRNKIKYHDYLRKRMIVNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPSK+ ++TIRGMIPHKT RGA AL RLK++EG+PPPYDK KRMV+PDAL+V
Sbjct  68   ARGPFHFRAPSKLFYKTIRGMIPHKTARGAEALKRLKIFEGIPPPYDKKKRMVVPDALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            LRL+ G KY  + +LS+EVGW + + +K LE KRK +++  YER+K+L K+  +A
Sbjct  128  LRLKPGRKYTTISRLSNEVGWKYGEVVKKLEEKRKVKSKEFYERKKKLEKIKNQA  182



>gb|EWM30220.1| 60s ribosomal protein l13a [Nannochloropsis gaditana]
Length=213

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN  266
            ++ VV+D R H+LGRL+SI+AKELL+GQ+VVVVRCEE+ +SGGLVR   +Y +FLRKR N
Sbjct  5    SKEVVIDGRGHLLGRLSSIVAKELLSGQKVVVVRCEELMISGGLVRNHTRYMQFLRKRTN  64

Query  267  TKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDA  446
            T P  GP H+RAPS+ILWRTIRGM+PHKT RGA ALARL  +EG+P PYD  KR+V+P A
Sbjct  65   TNPKRGPFHYRAPSRILWRTIRGMLPHKTFRGAQALARLTTFEGIPAPYDTKKRVVVPQA  124

Query  447  LKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            LK+LRL+ G ++C L +L+ EVGW H D +  LE KRK +A+A Y+++K  T     AE
Sbjct  125  LKILRLKPGRRFCTLSRLAHEVGWGHRDLVARLEAKRKIKAEAYYQQKKAGTAAKALAE  183



>gb|ETE70282.1| 60S ribosomal protein L13a [Ophiophagus hannah]
Length=203

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL KL  +AE
Sbjct  127  VRLKPTRKFAFLGRLAHEVGWKYQAITATLEEKRKEKAKVHYTKKKQLMKLRKQAE  182



>ref|XP_002507247.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68505.1| predicted protein [Micromonas sp. RCC299]
Length=199

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D R H+LGRLASI+AK+LL GQ VVVVR E I +SGG+VR + +Y  F R RMNTKP
Sbjct  5    VVIDGRGHLLGRLASIVAKQLLQGQHVVVVRAEGIVISGGIVRARQRYDYFKRLRMNTKP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            SHGP H+ AP+++LWRT+RGM+P+KT RGA A  R K YEG+PPPYDKVKR V+P+ALKV
Sbjct  65   SHGPFHYAAPARMLWRTVRGMLPYKTTRGACAFERFKAYEGIPPPYDKVKRAVVPEALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQ  596
            LRL AGHKYC+LG LS +VGW H  T++ LE KR   A   + ++K+
Sbjct  125  LRLAAGHKYCVLGDLSHQVGWKHKTTVEALEEKRAAAASEYWTKKKE  171



>ref|XP_003384047.1| PREDICTED: 60S ribosomal protein L13a-like [Amphimedon queenslandica]
Length=202

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            ++VDA+ H+LGRLASI+AK+LLNGQ++V++RCE I +SG + R K+KY +FLR R N KP
Sbjct  7    IIVDAKDHLLGRLASIVAKQLLNGQKIVILRCEYINISGSIYRNKVKYLKFLRLRCNVKP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPSKI WRT+RGM+PHKT+RG AAL RL VYEG+PP Y K KR+V+P AL++
Sbjct  67   SRGPFHFRAPSKIFWRTVRGMLPHKTERGKAALGRLSVYEGIPPMYIKKKRVVVPQALRI  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
            LRL+ G K+C+LG+LS EVGW + D +K LE KR+ R    YE++ +L +L  +A
Sbjct  127  LRLKPGRKFCVLGRLSHEVGWKYRDVMKTLEEKRQAREAIYYEKKIKLARLRTRA  181



>gb|KFM61542.1| 60S ribosomal protein L13a, partial [Stegodyphus mimosarum]
Length=205

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = +3

Query  75   SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  254
            +G   + +++D R H+LGRLA++ AK LLNGQ+VVVVRC+ I +SG   R K+KY  FLR
Sbjct  2    TGFSEKAIIIDGRGHLLGRLAALTAKTLLNGQKVVVVRCDGINISGSFFRSKLKYLSFLR  61

Query  255  KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV  434
            KR N  P+ GP HFRAPSKI WRT+RGM+PHKTKRG AAL RLKVYEG+PPPYDK KRMV
Sbjct  62   KRCNVNPARGPFHFRAPSKIFWRTVRGMLPHKTKRGDAALERLKVYEGIPPPYDKKKRMV  121

Query  435  IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKL  608
            +P AL+VL+L    KYC L +LS EVGW + + I  LE KRK +A A Y ++K+  KL
Sbjct  122  VPSALRVLKLHPRRKYCSLSRLSHEVGWKYQNVISTLEVKRKAKAAAYYGKKKRDEKL  179



>ref|XP_001491926.1| PREDICTED: 60S ribosomal protein L13a [Equus caballus]
 ref|XP_008522004.1| PREDICTED: 60S ribosomal protein L13a [Equus przewalskii]
Length=203

 Score =   228 bits (582),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQLT+L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAE  182



>ref|XP_003054822.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60074.1| predicted protein [Micromonas pusilla CCMP1545]
Length=199

 Score =   228 bits (581),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            V++D R H+LGRLASI+AK+LL GQ VVVVR E I +SGG+VR + KY  F R RMNTKP
Sbjct  5    VIIDGRGHLLGRLASIVAKQLLQGQHVVVVRAEGIVISGGMVRAQQKYDFFKRLRMNTKP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            SHGP H+ +PS++LWRT+RGM+P+KTKRGAAA  R K YEG+PPPYDK KR V+P+ALKV
Sbjct  65   SHGPFHYASPSRMLWRTVRGMVPYKTKRGAAAFERFKSYEGIPPPYDKCKRAVVPEALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQ  572
            LRL AGHKYC+LG LS  VGW H  T+K LE KR+ +A 
Sbjct  125  LRLGAGHKYCVLGDLSHRVGWKHQATVKSLEAKREAKAS  163



>ref|XP_008067417.1| PREDICTED: 60S ribosomal protein L13a [Tarsius syrichta]
Length=203

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQLT+L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAE  182



>ref|XP_007431701.1| PREDICTED: 60S ribosomal protein L13a-like [Python bivittatus]
Length=203

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL KL  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAITATLEEKRKEKAKLHYTKKKQLMKLRKQAE  182



>ref|XP_002741044.1| PREDICTED: 60S ribosomal protein L13a-like isoform X1 [Saccoglossus 
kowalevskii]
Length=202

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++DAR H+LGRLASI AK +L GQRVV+VRCE I +SG L R K+K+ +FLRKR NTKP
Sbjct  7    LLIDARGHLLGRLASITAKTILQGQRVVLVRCEGIVISGSLYRNKLKFLQFLRKRTNTKP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS++ WR +RGM+PHK KRG+ AL RLKV+EG+P PYDK KR V+P ALKV
Sbjct  67   SRGPFHFRAPSRVFWRVVRGMLPHKLKRGSDALDRLKVFEGIPAPYDKQKRFVVPSALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            LRL+   K+C LG+LSS+VGW +   I VLE KRK R++  Y +RKQ  +L  KA 
Sbjct  127  LRLKPYRKFCQLGRLSSDVGWKYAGVINVLEAKRKARSKIRYNKRKQEKRLWKKAS  182



>gb|AHA44488.1| 60S ribosomal-like protein [Pectinaria gouldii]
Length=203

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++D R H+LGRLASI++K +L GQ+VV+VRCEEI +SG   R K+KY  +LRKRMNTKP
Sbjct  8    ILIDGRGHLLGRLASIVSKSILQGQKVVIVRCEEINISGSFYRNKLKYLEYLRKRMNTKP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPSK+ ++ +RGM+PHK  RG AALA LKV++G+P PYDK KRMV+P ALKV
Sbjct  68   SRGPYHFRAPSKVFFKAVRGMVPHKLSRGKAALANLKVFDGIPAPYDKKKRMVVPSALKV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKL  608
            LRL    K C LG+LS EVGW++ DTI  LENKRKE+A   YE++K    L
Sbjct  128  LRLNPRRKSCQLGRLSHEVGWHYQDTIATLENKRKEQATKFYEKKKSTLNL  178



>ref|XP_004011713.1| PREDICTED: 60S ribosomal protein L13a-like [Ovis aries]
Length=203

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L GQ+VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGQKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPACKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  182



>gb|KFH71578.1| 60S ribosomal protein L16-B [Mortierella verticillata NRRL 6337]
Length=202

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+ L GQRVVVVRCEE+ +SG   R K+KYH FLRKR    P
Sbjct  8    VVIDGKGHLLGRLASIVAKQALTGQRVVVVRCEELNVSGSFFRNKLKYHAFLRKRCVVNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + G  HFRAPS+I +R IRGMIPHKT RGAAAL R+K++EGVPPPYD++KRMV+P AL+V
Sbjct  68   ARGAFHFRAPSRIFYRAIRGMIPHKTARGAAALDRIKLFEGVPPPYDRMKRMVVPSALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            L+L+ G KYC + ++S EVGW + D +  LE KRK +++A YER+K +  +  KA 
Sbjct  128  LKLKPGRKYCTIKRVSHEVGWKYNDVVANLEEKRKVKSKAFYERKKAIANVRAKAS  183



>ref|XP_004168353.1| PREDICTED: 60S ribosomal protein L13a-3-like, partial [Cucumis 
sativus]
Length=137

 Score =   225 bits (573),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  270  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  449
            KPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDAL
Sbjct  1    KPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDAL  60

Query  450  KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            KVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL KL +KAE
Sbjct  61   KVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLNKLRIKAE  118



>ref|XP_004694340.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Condylura cristata]
Length=203

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAE  182



>ref|XP_001507007.1| PREDICTED: 60S ribosomal protein L13a [Ornithorhynchus anatinus]
Length=203

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y R+K+ T+L  +AE
Sbjct  127  VRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKLHYRRKKKQTRLRKQAE  182



>ref|NP_001016486.1| ribosomal protein L13a [Xenopus (Silurana) tropicalis]
 emb|CAJ83235.1| ribosomal protein L13a [Xenopus (Silurana) tropicalis]
 gb|AAI35477.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gb|AAI60997.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gb|AAI68111.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
 gb|AAI68117.1| hypothetical protein LOC549240 [Xenopus (Silurana) tropicalis]
Length=231

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 141/186 (76%), Gaps = 1/186 (1%)
 Frame = +3

Query  69   SGSGICARRV-VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHR  245
            SG    AR+V ++D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  
Sbjct  25   SGGFKSARQVLIIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLA  84

Query  246  FLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVK  425
            FLRKRMNT PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK K
Sbjct  85   FLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRK  144

Query  426  RMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTK  605
            RMV+P ALK++RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++K + K
Sbjct  145  RMVVPAALKIVRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYNKKKIIVK  204

Query  606  LXVKAE  623
            L  +AE
Sbjct  205  LRKQAE  210



>gb|ABX75375.1| 60S ribosomal protein L13A [Lycosa singoriensis]
Length=205

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 131/178 (74%), Gaps = 0/178 (0%)
 Frame = +3

Query  75   SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  254
            +G   + +V+D R H+LGRLA++ AK LLNGQ+VVVVRCE I +SG   R K+KY  FLR
Sbjct  2    TGFSEKAIVIDGRGHLLGRLAALTAKTLLNGQKVVVVRCEGINISGSFFRSKLKYLSFLR  61

Query  255  KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV  434
            KR N  P+ GP HFRAPSKI WRT+RGM+PHKTKRG AAL RLK +EG+PPPYDK KRMV
Sbjct  62   KRCNVNPARGPFHFRAPSKIFWRTVRGMLPHKTKRGEAALDRLKAFEGIPPPYDKKKRMV  121

Query  435  IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKL  608
            +P AL+VL+L    KYC L +LS EVGW + + I  LE KRK +A   Y R+K+  K+
Sbjct  122  VPSALRVLKLHPRRKYCSLSRLSHEVGWKYQNVISTLELKRKAKASVFYARKKRDEKI  179



>ref|XP_008843288.1| PREDICTED: 60S ribosomal protein L13a [Nannospalax galili]
Length=203

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  182



>emb|CCQ18645.1| 60S ribosomal protein L13a [Sycon ciliatum]
Length=201

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  81   ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKR  260
            +  R +++D R+H+LGRLAS +AK LL+GQRVVVVRCEEI +SG   R K+KY ++LR R
Sbjct  2    VFERLILIDGRNHLLGRLASTIAKALLSGQRVVVVRCEEINISGSFYRNKLKYLKYLRLR  61

Query  261  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  440
             N KPS GP HFRAPSK+L R +RGMIPHK+ RGAAA+ RLKV+EGVPPPYD++K+MVIP
Sbjct  62   CNVKPSRGPFHFRAPSKMLVRVVRGMIPHKSVRGAAAMKRLKVFEGVPPPYDQMKKMVIP  121

Query  441  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKA  620
             AL+V+RL+ G K+C LG+++ EVGW + D +  LE KRK +A   YE +K++ +    A
Sbjct  122  SALRVIRLRPGRKFCRLGRIAHEVGWKYQDVVSTLEEKRKAKALVYYENKKKILRRKAAA  181

Query  621  E  623
            E
Sbjct  182  E  182



>ref|XP_003038672.1| 60S ribosomal protein L16 [Schizophyllum commune H4-8]
 gb|EFJ03770.1| ribosomal protein L13A [Schizophyllum commune H4-8]
Length=200

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 140/183 (77%), Gaps = 1/183 (1%)
 Frame = +3

Query  75   SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  254
            S   A  +V+D + H+LGRLASI+AK++L+GQ++VVVRCEEI +SG   R K++YH FL 
Sbjct  2    STFSATPIVIDGKGHLLGRLASIIAKQILSGQKIVVVRCEEINISGSFFRNKLRYHNFLH  61

Query  255  KRMNTKPS-HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRM  431
            K+    P  +GP HFRAPSKIL+R+IRGMIPHKT RGAAAL RLK++EGVPPPYD+ K+M
Sbjct  62   KKHLVNPKKNGPFHFRAPSKILYRSIRGMIPHKTARGAAALERLKLFEGVPPPYDRKKKM  121

Query  432  VIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLX  611
            V+PDAL+VLRL+ G KYC + +LS EVGW + D +  LE KRK +AQA +ER+    KL 
Sbjct  122  VVPDALRVLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKVAALKLR  181

Query  612  VKA  620
             KA
Sbjct  182  QKA  184



>ref|XP_011287982.1| PREDICTED: 60S ribosomal protein L13a [Felis catus]
Length=203

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  87   ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN  266
            A+ +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMN
Sbjct  4    AQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMN  63

Query  267  TKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDA  446
            T PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P A
Sbjct  64   TNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAA  123

Query  447  LKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            LKV+RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  124  LKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAE  182



>ref|XP_004597042.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Ochotona princeps]
Length=203

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAE  182



>ref|XP_005833834.1| large subunit ribosomal protein L13Ae_2, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX46854.1| large subunit ribosomal protein L13Ae_2, cytoplasmic [Guillardia 
theta CCMP2712]
Length=177

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD R H+LGRLASI+AKELLNGQRVV+VRCEE+ +SG  +R K+ +  +LRKR N+ P
Sbjct  6    VVVDCRGHLLGRLASIIAKELLNGQRVVLVRCEEVNISGAFIRNKLLFMSYLRKRKNSNP  65

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+++WRTIR M+ HKT R  AAL RLKV++GVPPPYDKVKRMV+PDAL+V
Sbjct  66   SSGPYHFRAPSRMVWRTIRAMMKHKTPRCQAALDRLKVFDGVPPPYDKVKRMVMPDALRV  125

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKL  608
            LRL+ G KY  LG++ SEVGW H DT+  LE KRK +  A + ++K+  K+
Sbjct  126  LRLRPGRKYTNLGRMCSEVGWKHRDTVLELEEKRKVKGAAYWAKKKEAIKV  176



>gb|ELR49590.1| 60S ribosomal protein L13a, partial [Bos mutus]
Length=199

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  3    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  62

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  63   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  122

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  123  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  178



>ref|XP_005336734.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Ictidomys tridecemlineatus]
Length=199

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  3    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  62

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  63   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  122

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  123  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  178



>ref|NP_001125810.1| 60S ribosomal protein L13a [Pongo abelii]
 sp|Q5RA38.3|RL13A_PONAB RecName: Full=60S ribosomal protein L13a [Pongo abelii]
 emb|CAH91372.1| hypothetical protein [Pongo abelii]
Length=203

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTSP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAE  182



>ref|XP_005879589.1| PREDICTED: 60S ribosomal protein L13a [Myotis brandtii]
Length=203

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAE  182



>ref|XP_004672300.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Jaculus jaculus]
Length=203

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  182



>ref|XP_003453268.1| PREDICTED: 60S ribosomal protein L13a-like [Oreochromis niloticus]
Length=205

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++D R H+LGRLA+I+AK++L G +VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  9    LLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  68

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPSKI WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  69   SRGPYHFRAPSKIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKV  128

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+ LLG+L+ EVGW +      LE KRKE+++  Y ++K L  L  KAE
Sbjct  129  VRLKPSRKFALLGRLAHEVGWKYQAITATLEEKRKEKSKLRYTKKKTLINLTKKAE  184



>ref|NP_001070466.1| 60S ribosomal protein L13a [Bos taurus]
 ref|XP_005692777.1| PREDICTED: 60S ribosomal protein L13a [Capra hircus]
 ref|XP_005905051.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Bos mutus]
 ref|XP_006080162.1| PREDICTED: 60S ribosomal protein L13a [Bubalus bubalis]
 ref|XP_010847921.1| PREDICTED: 60S ribosomal protein L13a [Bison bison bison]
 sp|Q3SZ90.3|RL13A_BOVIN RecName: Full=60S ribosomal protein L13a [Bos taurus]
 gb|AAI03040.1| Ribosomal protein L13a [Bos taurus]
 tpg|DAA19656.1| TPA: 60S ribosomal protein L13a [Bos taurus]
Length=203

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  182



>ref|XP_005336733.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Ictidomys tridecemlineatus]
Length=203

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  182



>gb|ABY28364.1| ribosomal protein L13A [Oncorhynchus masou formosanus]
Length=205

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++D R H+LGRLA+I+AK++L G +VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  9    LLLDGRGHLLGRLAAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  68

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPSKI WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALK+
Sbjct  69   SRGPYHFRAPSKIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKI  128

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+ LLG+L+ EVGW +      LE KRKE+A+  Y ++K +TKL   AE
Sbjct  129  VRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKARIRYTKKKTVTKLSKLAE  184



>ref|XP_005589974.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Macaca fascicularis]
Length=199

 Score =   226 bits (576),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  3    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  62

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  63   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  122

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  123  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  178



>ref|XP_005088148.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Mesocricetus 
auratus]
Length=203

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            LRL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  LRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAE  182



>ref|XP_004710493.1| PREDICTED: 60S ribosomal protein L13a [Echinops telfairi]
Length=203

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  182



>gb|EHH59787.1| hypothetical protein EGM_09978, partial [Macaca fascicularis]
Length=199

 Score =   226 bits (576),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  3    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  62

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  63   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  122

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  123  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  178



>sp|Q4R8Z2.3|RL13A_MACFA RecName: Full=60S ribosomal protein L13a [Macaca fascicularis]
 dbj|BAE00429.1| unnamed protein product [Macaca fascicularis]
Length=203

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTTTLEEKRKEKAKIHYRKKKQLMRLRKQAE  182



>ref|XP_004409938.1| PREDICTED: 60S ribosomal protein L13a [Odobenus rosmarus divergens]
Length=203

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  7    LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLXVKAE  623
            +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L  +AE
Sbjct  127  VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAE  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380