BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038G05

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341679.1|  PREDICTED: uncharacterized protein LOC102589286  93.6    3e-18   Solanum tuberosum [potatoes]
ref|XP_004235711.1|  PREDICTED: uncharacterized protein LOC101250783  93.2    3e-18   Solanum lycopersicum
ref|XP_009628246.1|  PREDICTED: uncharacterized protein LOC104118...  89.4    6e-17   
ref|XP_009628236.1|  PREDICTED: uncharacterized protein LOC104118...  89.4    7e-17   Nicotiana tomentosiformis
ref|XP_009786427.1|  PREDICTED: uncharacterized protein LOC104234...  87.8    2e-16   Nicotiana sylvestris
ref|XP_009786426.1|  PREDICTED: uncharacterized protein LOC104234...  87.8    2e-16   Nicotiana sylvestris
ref|XP_002279674.1|  PREDICTED: uncharacterized protein LOC100241173  78.6    3e-13   Vitis vinifera
emb|CDO98057.1|  unnamed protein product                              76.6    1e-12   Coffea canephora [robusta coffee]
ref|XP_010098052.1|  hypothetical protein L484_026183                 75.5    3e-12   Morus notabilis
ref|XP_007215312.1|  hypothetical protein PRUPE_ppa003521mg           74.3    5e-12   
ref|XP_004305292.1|  PREDICTED: uncharacterized protein LOC101294200  74.3    7e-12   Fragaria vesca subsp. vesca
ref|XP_008362706.1|  PREDICTED: uncharacterized protein LOC103426...  73.9    9e-12   
ref|XP_008362707.1|  PREDICTED: uncharacterized protein LOC103426...  73.9    9e-12   
gb|KJB13152.1|  hypothetical protein B456_002G059600                  73.2    1e-11   Gossypium raimondii
emb|CBI36151.3|  unnamed protein product                              72.8    2e-11   Vitis vinifera
gb|KHG04451.1|  Monodehydroascorbate reductase, fruit isozyme         73.2    2e-11   Gossypium arboreum [tree cotton]
ref|XP_010545713.1|  PREDICTED: uncharacterized protein LOC104817994  73.2    2e-11   Tarenaya hassleriana [spider flower]
emb|CAN72109.1|  hypothetical protein VITISV_044047                   72.8    2e-11   Vitis vinifera
gb|KDO51232.1|  hypothetical protein CISIN_1g015294mg                 72.0    2e-11   Citrus sinensis [apfelsine]
ref|XP_008342705.1|  PREDICTED: uncharacterized protein LOC103405477  72.8    2e-11   
ref|XP_002516075.1|  conserved hypothetical protein                   72.8    2e-11   Ricinus communis
ref|XP_004486732.1|  PREDICTED: uncharacterized protein LOC101506...  72.4    3e-11   Cicer arietinum [garbanzo]
ref|XP_006427010.1|  hypothetical protein CICLE_v10024988mg           72.4    3e-11   Citrus clementina [clementine]
gb|KDP37214.1|  hypothetical protein JCGZ_06270                       72.4    3e-11   Jatropha curcas
ref|XP_007024146.1|  Uncharacterized protein isoform 1                72.4    3e-11   
ref|XP_006465528.1|  PREDICTED: uncharacterized protein LOC102613887  72.4    3e-11   Citrus sinensis [apfelsine]
ref|XP_007024149.1|  Uncharacterized protein isoform 4                72.4    3e-11   
ref|XP_010907260.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...  71.6    4e-11   
ref|XP_006826988.1|  hypothetical protein AMTR_s00010p00207960        71.6    5e-11   Amborella trichopoda
ref|XP_008447501.1|  PREDICTED: uncharacterized protein LOC103489933  71.2    6e-11   Cucumis melo [Oriental melon]
ref|XP_003542101.1|  PREDICTED: uncharacterized protein LOC100791852  71.2    6e-11   Glycine max [soybeans]
ref|XP_004150357.1|  PREDICTED: uncharacterized protein LOC101204163  71.2    7e-11   
ref|XP_007150659.1|  hypothetical protein PHAVU_005G170800g           71.2    7e-11   Phaseolus vulgaris [French bean]
ref|XP_004169923.1|  PREDICTED: uncharacterized LOC101204163          71.2    7e-11   
gb|KGN58062.1|  hypothetical protein Csa_3G481220                     71.2    7e-11   Cucumis sativus [cucumbers]
ref|XP_002516584.1|  conserved hypothetical protein                   71.2    7e-11   Ricinus communis
ref|XP_002304192.2|  hypothetical protein POPTR_0003s05350g           70.5    9e-11   
ref|XP_008462152.1|  PREDICTED: uncharacterized protein LOC103500575  70.9    9e-11   Cucumis melo [Oriental melon]
ref|XP_004141776.1|  PREDICTED: uncharacterized protein LOC101222402  70.9    9e-11   Cucumis sativus [cucumbers]
gb|KDP34224.1|  hypothetical protein JCGZ_07795                       70.1    1e-10   Jatropha curcas
ref|XP_002281782.1|  PREDICTED: uncharacterized protein LOC100259547  70.1    1e-10   Vitis vinifera
ref|XP_011001614.1|  PREDICTED: uncharacterized protein LOC105108845  70.1    1e-10   Populus euphratica
ref|XP_002299694.2|  hypothetical protein POPTR_0001s18130g           70.1    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010251918.1|  PREDICTED: uncharacterized protein LOC104593650  70.1    2e-10   Nelumbo nucifera [Indian lotus]
gb|ABR18011.1|  unknown                                               69.3    2e-10   Picea sitchensis
ref|XP_010112163.1|  hypothetical protein L484_019902                 69.3    3e-10   
ref|XP_009147692.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.6    5e-10   Brassica rapa
gb|KFK35788.1|  hypothetical protein AALP_AA4G036700                  68.6    5e-10   Arabis alpina [alpine rockcress]
emb|CDP18480.1|  unnamed protein product                              68.2    6e-10   Coffea canephora [robusta coffee]
gb|KJB54879.1|  hypothetical protein B456_009G052500                  68.2    6e-10   Gossypium raimondii
ref|XP_006392932.1|  hypothetical protein EUTSA_v10011250mg           67.8    1e-09   Eutrema salsugineum [saltwater cress]
ref|XP_008447502.1|  PREDICTED: uncharacterized protein LOC103489935  67.8    1e-09   Cucumis melo [Oriental melon]
gb|EPS68177.1|  hypothetical protein M569_06594                       67.0    1e-09   Genlisea aurea
gb|KCW81524.1|  hypothetical protein EUGRSUZ_C02885                   67.4    1e-09   Eucalyptus grandis [rose gum]
ref|XP_004150356.1|  PREDICTED: uncharacterized protein LOC101203914  67.4    1e-09   Cucumis sativus [cucumbers]
ref|XP_004245249.1|  PREDICTED: uncharacterized protein LOC101255018  67.4    1e-09   Solanum lycopersicum
ref|XP_006356661.1|  PREDICTED: uncharacterized protein LOC102596799  67.0    1e-09   
ref|XP_004172478.1|  PREDICTED: uncharacterized protein LOC101231290  67.0    1e-09   
ref|XP_010033880.1|  PREDICTED: uncharacterized protein LOC104423116  67.0    1e-09   Eucalyptus grandis [rose gum]
ref|XP_011007598.1|  PREDICTED: uncharacterized protein LOC105113217  67.0    2e-09   Populus euphratica
ref|XP_011072341.1|  PREDICTED: uncharacterized protein LOC105157620  66.6    2e-09   Sesamum indicum [beniseed]
ref|XP_011019684.1|  PREDICTED: uncharacterized protein LOC105122326  66.6    2e-09   Populus euphratica
ref|XP_002308623.2|  hypothetical protein POPTR_0006s26050g           66.2    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004501198.1|  PREDICTED: uncharacterized protein LOC101510604  66.2    3e-09   
ref|XP_010691307.1|  PREDICTED: uncharacterized protein LOC104904665  66.2    3e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003597769.1|  hypothetical protein MTR_2g102050                66.2    3e-09   Medicago truncatula
gb|EYU29268.1|  hypothetical protein MIMGU_mgv1a002196mg              65.9    4e-09   Erythranthe guttata [common monkey flower]
gb|EYU21542.1|  hypothetical protein MIMGU_mgv1a001881mg              65.5    4e-09   Erythranthe guttata [common monkey flower]
ref|XP_011089542.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.5    5e-09   
ref|XP_010479739.1|  PREDICTED: uncharacterized protein LOC104758551  65.5    5e-09   Camelina sativa [gold-of-pleasure]
dbj|BAF00450.1|  putative bZIP protein                                65.1    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849796.2|  uncharacterized protein                             65.1    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324252.2|  hypothetical protein POPTR_0018s00880g           65.1    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009616206.1|  PREDICTED: uncharacterized protein LOC104108786  65.1    6e-09   Nicotiana tomentosiformis
ref|XP_010479738.1|  PREDICTED: kinesin-related protein 4-like        65.1    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010500831.1|  PREDICTED: uncharacterized protein LOC104778154  65.1    7e-09   Camelina sativa [gold-of-pleasure]
gb|EPS57365.1|  hypothetical protein M569_17453                       64.7    7e-09   Genlisea aurea
ref|XP_010462070.1|  PREDICTED: uncharacterized protein LOC104742736  65.1    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010931963.1|  PREDICTED: uncharacterized protein LOC105052734  65.1    7e-09   Elaeis guineensis
ref|XP_002891687.1|  hypothetical protein ARALYDRAFT_474348           65.1    7e-09   
ref|XP_009799127.1|  PREDICTED: uncharacterized protein LOC104245243  64.7    7e-09   Nicotiana sylvestris
ref|XP_007012028.1|  Golgin subfamily A member 4                      64.7    8e-09   
gb|KJB65700.1|  hypothetical protein B456_010G109200                  64.7    9e-09   Gossypium raimondii
ref|XP_007137162.1|  hypothetical protein PHAVU_009G105100g           64.3    1e-08   Phaseolus vulgaris [French bean]
ref|XP_011026550.1|  PREDICTED: uncharacterized protein LOC105127120  64.3    1e-08   Populus euphratica
ref|XP_010249762.1|  PREDICTED: uncharacterized protein LOC104592...  63.9    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010249763.1|  PREDICTED: uncharacterized protein LOC104592...  63.5    2e-08   
ref|XP_009345256.1|  PREDICTED: uncharacterized protein LOC103937065  63.5    2e-08   
ref|XP_010667633.1|  PREDICTED: uncharacterized protein LOC104884...  63.5    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010667640.1|  PREDICTED: uncharacterized protein LOC104884...  63.2    2e-08   
ref|XP_006306796.1|  hypothetical protein CARUB_v10008333mg           63.5    2e-08   Capsella rubella
ref|XP_008378117.1|  PREDICTED: uncharacterized protein LOC103441188  63.2    2e-08   
ref|XP_007225191.1|  hypothetical protein PRUPE_ppa002131mg           63.2    3e-08   Prunus persica
ref|XP_010519919.1|  PREDICTED: uncharacterized protein LOC104799211  63.2    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_003603595.1|  hypothetical protein MTR_3g109450                63.2    3e-08   Medicago truncatula
ref|XP_009151092.1|  PREDICTED: uncharacterized protein LOC103874418  63.2    3e-08   Brassica rapa
emb|CDX88193.1|  BnaA06g27840D                                        63.2    3e-08   
ref|XP_003523728.1|  PREDICTED: formin-like protein 8-like            63.2    3e-08   Glycine max [soybeans]
ref|XP_008220000.1|  PREDICTED: uncharacterized protein LOC103320143  62.8    4e-08   Prunus mume [ume]
ref|XP_009338711.1|  PREDICTED: uncharacterized protein LOC103931028  62.4    4e-08   Pyrus x bretschneideri [bai li]
ref|XP_008393906.1|  PREDICTED: uncharacterized protein LOC103456054  62.4    4e-08   
ref|XP_009368022.1|  PREDICTED: uncharacterized protein LOC103957563  62.4    4e-08   Pyrus x bretschneideri [bai li]
emb|CDX80528.1|  BnaC07g29160D                                        62.4    5e-08   
ref|XP_010254134.1|  PREDICTED: uncharacterized protein LOC104595215  62.4    5e-08   Nelumbo nucifera [Indian lotus]
gb|KFK27812.1|  hypothetical protein AALP_AA8G433100                  62.0    7e-08   Arabis alpina [alpine rockcress]
ref|NP_197941.1|  uncharacterized protein                             62.0    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004292865.1|  PREDICTED: uncharacterized protein LOC101308445  62.0    7e-08   Fragaria vesca subsp. vesca
ref|XP_002874269.1|  hypothetical protein ARALYDRAFT_910621           61.6    7e-08   
ref|XP_009398982.1|  PREDICTED: uncharacterized protein LOC103983491  61.6    7e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003527819.1|  PREDICTED: uncharacterized protein LOC100807597  61.6    9e-08   Glycine max [soybeans]
gb|KHN18210.1|  hypothetical protein glysoja_025100                   61.2    9e-08   Glycine soja [wild soybean]
dbj|BAJ96409.1|  predicted protein                                    61.6    9e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010454904.1|  PREDICTED: ABC transporter F family member 4...  61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010938806.1|  PREDICTED: uncharacterized protein LOC105057803  60.8    1e-07   
ref|XP_008777258.1|  PREDICTED: uncharacterized protein LOC103697215  60.5    1e-07   
ref|XP_010421422.1|  PREDICTED: DNA ligase 1-like isoform X3          60.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006287097.1|  hypothetical protein CARUB_v10000261mg           60.8    2e-07   Capsella rubella
ref|XP_010421420.1|  PREDICTED: DNA ligase 1-like isoform X1          60.8    2e-07   Camelina sativa [gold-of-pleasure]
gb|AAT93897.1|  unknown protein                                       60.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010421421.1|  PREDICTED: DNA ligase 1-like isoform X2          60.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010493822.1|  PREDICTED: DNA ligase 1-like                     60.5    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006394813.1|  hypothetical protein EUTSA_v10003682mg           60.5    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_003604444.1|  hypothetical protein MTR_4g012430                60.5    2e-07   
gb|AES86641.2|  BZIP protein                                          60.1    2e-07   Medicago truncatula
ref|XP_010942485.1|  PREDICTED: uncharacterized protein LOC105060463  60.5    2e-07   
ref|XP_008808244.1|  PREDICTED: uncharacterized protein LOC103720359  60.5    2e-07   Phoenix dactylifera
ref|XP_009383699.1|  PREDICTED: uncharacterized protein LOC103971407  59.7    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD01722.1|  hypothetical protein                                 58.2    4e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDX87081.1|  BnaC09g03960D                                        58.2    1e-06   
ref|XP_002457867.1|  hypothetical protein SORBIDRAFT_03g017360        57.4    1e-06   
gb|KDO79698.1|  hypothetical protein CISIN_1g004600mg                 57.8    2e-06   Citrus sinensis [apfelsine]
ref|XP_006476157.1|  PREDICTED: myosin-9-like                         57.8    2e-06   Citrus sinensis [apfelsine]
ref|XP_006450611.1|  hypothetical protein CICLE_v10007564mg           57.8    2e-06   Citrus clementina [clementine]
gb|AFW82165.1|  hypothetical protein ZEAMMB73_214762                  57.4    2e-06   
ref|XP_003568507.1|  PREDICTED: ras and Rab interactor 3              57.0    2e-06   Brachypodium distachyon [annual false brome]
ref|XP_010275436.1|  PREDICTED: uncharacterized protein LOC104610494  56.2    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006644200.1|  PREDICTED: uncharacterized protein LOC102708565  56.2    5e-06   
ref|XP_006576720.1|  PREDICTED: uncharacterized protein LOC100792843  55.8    6e-06   Glycine max [soybeans]
ref|XP_008813601.1|  PREDICTED: uncharacterized protein LOC103724193  55.8    7e-06   Phoenix dactylifera
ref|XP_002989601.1|  hypothetical protein SELMODRAFT_447743           55.8    7e-06   Selaginella moellendorffii
ref|XP_006445430.1|  hypothetical protein CICLE_v10018930mg           55.8    7e-06   Citrus clementina [clementine]
gb|KDO85511.1|  hypothetical protein CISIN_1g040600mg                 55.8    7e-06   Citrus sinensis [apfelsine]
ref|XP_006464424.1|  PREDICTED: uncharacterized protein LOC102627291  55.8    7e-06   
ref|NP_001169630.1|  hypothetical protein                             55.5    8e-06   Zea mays [maize]
dbj|BAJ94711.1|  predicted protein                                    55.1    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM82883.1|  unnamed protein product                              55.1    1e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002986032.1|  hypothetical protein SELMODRAFT_425043           54.7    2e-05   
ref|XP_006375135.1|  hypothetical protein POPTR_0014s04670g           54.7    2e-05   
ref|XP_004969399.1|  PREDICTED: uncharacterized protein LOC101757...  54.3    2e-05   Setaria italica
ref|NP_001043426.1|  Os01g0585600                                     54.3    2e-05   
gb|EEE54881.1|  hypothetical protein OsJ_02382                        54.3    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011032057.1|  PREDICTED: uncharacterized protein LOC105131006  53.9    3e-05   Populus euphratica
ref|XP_004968820.1|  PREDICTED: uncharacterized protein LOC101757982  53.9    3e-05   Setaria italica
ref|XP_001760149.1|  predicted protein                                53.9    3e-05   
ref|XP_010258777.1|  PREDICTED: uncharacterized protein LOC104598423  53.9    3e-05   Nelumbo nucifera [Indian lotus]
gb|KJB24879.1|  hypothetical protein B456_004G165900                  53.5    4e-05   Gossypium raimondii
ref|XP_010919721.1|  PREDICTED: uncharacterized protein LOC105043738  53.5    4e-05   Elaeis guineensis
gb|KJB24877.1|  hypothetical protein B456_004G165900                  53.5    4e-05   Gossypium raimondii
gb|EYU31893.1|  hypothetical protein MIMGU_mgv1a0019611mg             50.1    5e-05   Erythranthe guttata [common monkey flower]
ref|XP_009796082.1|  PREDICTED: uncharacterized protein LOC104242706  53.1    5e-05   Nicotiana sylvestris
ref|XP_009624469.1|  PREDICTED: uncharacterized protein LOC104115517  53.1    5e-05   Nicotiana tomentosiformis
ref|XP_006587779.1|  PREDICTED: uncharacterized protein LOC778134     53.1    6e-05   Glycine max [soybeans]
gb|EAY74707.1|  hypothetical protein OsI_02600                        52.8    6e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010089322.1|  hypothetical protein L484_021854                 52.8    7e-05   
gb|EEC70709.1|  hypothetical protein OsI_02082                        52.8    7e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006644314.1|  PREDICTED: uncharacterized protein LOC102718120  52.8    7e-05   Oryza brachyantha
ref|NP_001172370.1|  Os01g0500550                                     52.8    7e-05   
ref|XP_007139641.1|  hypothetical protein PHAVU_008G046800g           52.4    9e-05   Phaseolus vulgaris [French bean]
ref|XP_001762208.1|  predicted protein                                52.4    9e-05   
ref|XP_002511585.1|  conserved hypothetical protein                   52.4    9e-05   Ricinus communis
ref|XP_002273471.2|  PREDICTED: uncharacterized protein LOC100266818  52.0    1e-04   Vitis vinifera
gb|KEH17841.1|  BZIP transcription factor bZIP80, putative            52.0    1e-04   Medicago truncatula
ref|XP_002301229.1|  hypothetical protein POPTR_0002s13850g           52.0    1e-04   
ref|XP_009612588.1|  PREDICTED: uncharacterized protein LOC104105875  52.0    1e-04   Nicotiana tomentosiformis
ref|XP_004506851.1|  PREDICTED: uncharacterized protein LOC101489547  51.6    1e-04   Cicer arietinum [garbanzo]
ref|XP_003567735.1|  PREDICTED: uncharacterized protein LOC100824905  52.0    1e-04   Brachypodium distachyon [annual false brome]
gb|EPS68751.1|  hypothetical protein M569_06016                       51.6    2e-04   Genlisea aurea
ref|XP_009796808.1|  PREDICTED: uncharacterized protein LOC104243329  51.6    2e-04   Nicotiana sylvestris
ref|XP_001762329.1|  predicted protein                                51.6    2e-04   
ref|XP_010228227.1|  PREDICTED: formin-like protein 5                 51.6    2e-04   
ref|XP_006340943.1|  PREDICTED: uncharacterized protein LOC102600978  51.6    2e-04   
ref|XP_010692050.1|  PREDICTED: uncharacterized protein LOC104905271  51.6    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010316432.1|  PREDICTED: uncharacterized protein LOC101264882  51.6    2e-04   
ref|XP_004515356.1|  PREDICTED: uncharacterized protein LOC101490151  51.2    2e-04   Cicer arietinum [garbanzo]
gb|KDP28858.1|  hypothetical protein JCGZ_14629                       51.2    2e-04   Jatropha curcas
ref|XP_006591544.1|  PREDICTED: uncharacterized protein LOC100808077  51.2    2e-04   Glycine max [soybeans]
gb|KEH23438.1|  BZIP transcription factor bZIP80                      51.2    2e-04   Medicago truncatula
ref|XP_004492935.1|  PREDICTED: uncharacterized protein LOC101510124  51.2    3e-04   Cicer arietinum [garbanzo]
ref|XP_006573547.1|  PREDICTED: uncharacterized protein LOC102662030  50.8    3e-04   Glycine max [soybeans]
gb|KHG20396.1|  Ferric uptake regulation                              50.8    3e-04   Gossypium arboreum [tree cotton]
gb|AES65231.2|  DUF630 family protein                                 50.8    3e-04   Medicago truncatula
gb|EAY79532.1|  hypothetical protein OsI_34661                        50.8    3e-04   Oryza sativa Indica Group [Indian rice]
gb|KEH37419.1|  DUF630 family protein                                 50.8    3e-04   Medicago truncatula
ref|XP_003594980.1|  BZIP transcription factor bZIP82                 50.8    3e-04   
ref|NP_001065395.1|  Os10g0562700                                     50.8    3e-04   
ref|XP_010941314.1|  PREDICTED: uncharacterized protein LOC105059637  50.8    3e-04   Elaeis guineensis
gb|KHN22673.1|  hypothetical protein glysoja_027561                   50.8    3e-04   Glycine soja [wild soybean]
ref|XP_003543739.1|  PREDICTED: uncharacterized protein LOC100818...  50.8    3e-04   
gb|KJB22870.1|  hypothetical protein B456_004G070400                  50.8    3e-04   Gossypium raimondii
ref|XP_009383946.1|  PREDICTED: uncharacterized protein LOC103971612  50.8    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007134473.1|  hypothetical protein PHAVU_010G050100g           50.8    4e-04   Phaseolus vulgaris [French bean]
ref|XP_011017344.1|  PREDICTED: protein virilizer homolog             50.8    4e-04   Populus euphratica
ref|XP_009393120.1|  PREDICTED: uncharacterized protein LOC103978894  50.4    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004507886.1|  PREDICTED: uncharacterized protein LOC101505055  50.4    4e-04   Cicer arietinum [garbanzo]
ref|XP_010544575.1|  PREDICTED: uncharacterized protein LOC104817191  50.4    5e-04   Tarenaya hassleriana [spider flower]
ref|XP_010263219.1|  PREDICTED: uncharacterized protein LOC104601549  50.1    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_007052313.1|  BZIP domain class transcription factor           50.1    6e-04   
ref|XP_004229746.1|  PREDICTED: uncharacterized protein LOC101257405  50.1    6e-04   Solanum lycopersicum
ref|XP_010935104.1|  PREDICTED: uncharacterized protein LOC105055091  49.7    7e-04   
ref|XP_008658472.1|  PREDICTED: uncharacterized protein LOC100279...  50.1    7e-04   Zea mays [maize]
ref|XP_007157896.1|  hypothetical protein PHAVU_002G106900g           49.7    7e-04   Phaseolus vulgaris [French bean]
ref|XP_008440843.1|  PREDICTED: uncharacterized protein LOC103485...  49.7    7e-04   
emb|CAN79228.1|  hypothetical protein VITISV_011041                   49.7    8e-04   Vitis vinifera
gb|KGN48936.1|  hypothetical protein Csa_6G507110                     49.7    8e-04   Cucumis sativus [cucumbers]
ref|XP_008440844.1|  PREDICTED: uncharacterized protein LOC103485...  49.7    8e-04   Cucumis melo [Oriental melon]
ref|XP_004134851.1|  PREDICTED: uncharacterized protein LOC101220098  49.7    8e-04   
ref|XP_002467482.1|  hypothetical protein SORBIDRAFT_01g028920        49.7    8e-04   Sorghum bicolor [broomcorn]
emb|CDY61085.1|  BnaC06g41130D                                        49.7    8e-04   Brassica napus [oilseed rape]
ref|XP_009411587.1|  PREDICTED: uncharacterized protein LOC103993301  49.7    8e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010033513.1|  PREDICTED: uncharacterized protein LOC104422784  49.7    8e-04   Eucalyptus grandis [rose gum]
emb|CDY52975.1|  BnaA06g01600D                                        49.7    8e-04   Brassica napus [oilseed rape]
ref|XP_003569275.1|  PREDICTED: uncharacterized protein LOC100827...  49.7    9e-04   Brachypodium distachyon [annual false brome]
ref|XP_010524436.1|  PREDICTED: uncharacterized protein LOC104802494  49.7    9e-04   Tarenaya hassleriana [spider flower]
ref|XP_010231954.1|  PREDICTED: uncharacterized protein LOC100827...  49.3    0.001   Brachypodium distachyon [annual false brome]
ref|XP_004164995.1|  PREDICTED: uncharacterized protein LOC101224117  49.3    0.001   



>ref|XP_006341679.1| PREDICTED: uncharacterized protein LOC102589286 [Solanum tuberosum]
Length=755

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 112/160 (70%), Gaps = 13/160 (8%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEETV RCKERK FMKEAV+ARNAFAAAHS+Y +SLKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEETVTRCKERKHFMKEAVSARNAFAAAHSAYTMSLKNTGAALSDYAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSNYDlppppplpfftpsp-----lQR  510
            QF        + AA  + SSS      G PP  ++  D+PPPPPLP F+ +      LQR
Sbjct  61   QF-------PSTAAVAAASSSSSPLPGGTPPLSSAPIDMPPPPPLPPFSNTSFPTSPLQR  113

Query  511  AATMPEISIPTPDLKHedp-iixeteediedeSVHGLKHR  627
            AATMPEISIPTPD K  D  I  E E+D+E ES H L+HR
Sbjct  114  AATMPEISIPTPDPKRSDMIIEEENEDDMETESTHSLRHR  153



>ref|XP_004235711.1| PREDICTED: uncharacterized protein LOC101250783 [Solanum lycopersicum]
Length=754

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 112/159 (70%), Gaps = 13/159 (8%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEETV RCKERK FMKEAV+ARNAFAAAHS+Y +SLKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEETVTRCKERKHFMKEAVSARNAFAAAHSAYTMSLKNTGAALSDYAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSNYDlppppplpfftpsp-----lQR  510
            QF        + AA+ + SSS      G PP  ++  D+PPPPPLP F  +      LQR
Sbjct  61   QF-------PSNAAAAAASSSSSPLPGGTPPLSSAPIDMPPPPPLPPFPNTSFPASPLQR  113

Query  511  AATMPEISIPTPDLKHedp-iixeteediedeSVHGLKH  624
            AATMPEISIPTPD K  D  I  E E+D+E ES HGL+H
Sbjct  114  AATMPEISIPTPDPKRSDMIIEEENEDDMETESTHGLRH  152



>ref|XP_009628246.1| PREDICTED: uncharacterized protein LOC104118644 isoform X2 [Nicotiana 
tomentosiformis]
Length=614

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 104/161 (65%), Gaps = 17/161 (11%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEETV RCKERK FMKEAV+ARNAFAAAHS+Y +SLKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEETVTRCKERKHFMKEAVSARNAFAAAHSAYTMSLKNTGAALSDYAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSNYDlppppplpfftpspl------Q  507
            QF           ++ + ++S      G+ P ++S     PPPP      +P       Q
Sbjct  61   QF----------PSTAAVAASSSSPLSGVTPPLSSTPLDMPPPPPLPPFSNPSFPPSPLQ  110

Query  508  RAATMPEISIPTPDLKHedp-iixeteediedeSVHGLKHR  627
            RAATMPEISIP P+ K  D  I  E E+D+E ES H L+HR
Sbjct  111  RAATMPEISIPVPEPKRSDMIIEEENEDDMETESTHSLRHR  151



>ref|XP_009628236.1| PREDICTED: uncharacterized protein LOC104118644 isoform X1 [Nicotiana 
tomentosiformis]
Length=739

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 104/161 (65%), Gaps = 17/161 (11%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEETV RCKERK FMKEAV+ARNAFAAAHS+Y +SLKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEETVTRCKERKHFMKEAVSARNAFAAAHSAYTMSLKNTGAALSDYAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSNYDlppppplpfftpspl------Q  507
            QF           ++ + ++S      G+ P ++S     PPPP      +P       Q
Sbjct  61   QF----------PSTAAVAASSSSPLSGVTPPLSSTPLDMPPPPPLPPFSNPSFPPSPLQ  110

Query  508  RAATMPEISIPTPDLKHedp-iixeteediedeSVHGLKHR  627
            RAATMPEISIP P+ K  D  I  E E+D+E ES H L+HR
Sbjct  111  RAATMPEISIPVPEPKRSDMIIEEENEDDMETESTHSLRHR  151



>ref|XP_009786427.1| PREDICTED: uncharacterized protein LOC104234548 isoform X2 [Nicotiana 
sylvestris]
Length=631

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 106/160 (66%), Gaps = 18/160 (11%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEETV RCKERK FMKEAV++RNAFAAAHS+Y +SLKNTGAAL DYA GE 
Sbjct  20   MGCTQSKIENEETVTRCKERKFFMKEAVSSRNAFAAAHSAYTMSLKNTGAALSDYAHGEV  79

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSNYDlppppplpfftpspl-----QR  510
            QF             ++ +++      G PP  ++  D+PPPPPLP F+         QR
Sbjct  80   QF------------PSTAAATSSPLPGGTPPLSSTPLDMPPPPPLPPFSNPSFPPSPLQR  127

Query  511  AATMPEISIPTPDLKHedp-iixeteediedeSVHGLKHR  627
            AATMPEISIP P  K  D  I  E E+D+E ES H L+HR
Sbjct  128  AATMPEISIPEPQPKRSDMIIEEENEDDMETESTHSLRHR  167



>ref|XP_009786426.1| PREDICTED: uncharacterized protein LOC104234548 isoform X1 [Nicotiana 
sylvestris]
Length=756

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 106/160 (66%), Gaps = 18/160 (11%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEETV RCKERK FMKEAV++RNAFAAAHS+Y +SLKNTGAAL DYA GE 
Sbjct  20   MGCTQSKIENEETVTRCKERKFFMKEAVSSRNAFAAAHSAYTMSLKNTGAALSDYAHGEV  79

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSNYDlppppplpfftpspl-----QR  510
            QF             ++ +++      G PP  ++  D+PPPPPLP F+         QR
Sbjct  80   QF------------PSTAAATSSPLPGGTPPLSSTPLDMPPPPPLPPFSNPSFPPSPLQR  127

Query  511  AATMPEISIPTPDLKHedp-iixeteediedeSVHGLKHR  627
            AATMPEISIP P  K  D  I  E E+D+E ES H L+HR
Sbjct  128  AATMPEISIPEPQPKRSDMIIEEENEDDMETESTHSLRHR  167



>ref|XP_002279674.1| PREDICTED: uncharacterized protein LOC100241173 [Vitis vinifera]
Length=722

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 81/136 (60%), Gaps = 30/136 (22%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V RCKERK+FMK+AV ARNAFAAAHS+YA+SLKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEEIVTRCKERKLFMKDAVTARNAFAAAHSAYAMSLKNTGAALSDYAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSN----YDlppppplpfftpspl--Q  507
            Q                        +  +P    SN    Y+  PPPP P         Q
Sbjct  61   Q------------------------NPQLPTQTNSNNPPHYETLPPPPPPLPNFPAAPLQ  96

Query  508  RAATMPEISIPTPDLK  555
            RAATMPE+ +P PD K
Sbjct  97   RAATMPELKLPKPDSK  112



>emb|CDO98057.1| unnamed protein product [Coffea canephora]
Length=749

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 85/137 (62%), Gaps = 22/137 (16%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+IENEETV RCKERK +MK+AVAARNAFAAAHS+YA++LKNTGAAL DYA GE 
Sbjct  1    MGCNQSRIENEETVTRCKERKQYMKDAVAARNAFAAAHSAYAMALKNTGAALSDYAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSM------TSNYDlppppplpfftpsplQ  507
            Q+                 SS   S  G P S+            PP PP     P P+Q
Sbjct  61   QY----------------PSSPSSSVHGGPASLPQPPVDHLPPPPPPLPPFHQPPPPPIQ  104

Query  508  RAATMPEISIPTPDLKH  558
            RAA+MPE+S P  DLKH
Sbjct  105  RAASMPEMSFPKRDLKH  121



>ref|XP_010098052.1| hypothetical protein L484_026183 [Morus notabilis]
 gb|EXB74489.1| hypothetical protein L484_026183 [Morus notabilis]
Length=743

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE VARCK+RK FMKEAV+ARNAFAAAHSSYA+ LKNTGAAL DYA+GE 
Sbjct  1    MGCTQSKIENEEAVARCKDRKHFMKEAVSARNAFAAAHSSYAMYLKNTGAALSDYAQGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_007215312.1| hypothetical protein PRUPE_ppa003521mg [Prunus persica]
 gb|EMJ16511.1| hypothetical protein PRUPE_ppa003521mg [Prunus persica]
Length=568

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCTQSKIENEE V+RCKERK FMKE+V +RNAFAAAHSSYA+ LKNTGAAL DYA+GE
Sbjct  1    MGCTQSKIENEEAVSRCKERKQFMKESVTSRNAFAAAHSSYAIYLKNTGAALSDYAQGE  59



>ref|XP_004305292.1| PREDICTED: uncharacterized protein LOC101294200 [Fragaria vesca 
subsp. vesca]
Length=733

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V+RCKERK+FMK+AV++RNAFAAAHSSYA+ LKNTGAAL DYA+GE 
Sbjct  1    MGCTQSKIENEEAVSRCKERKLFMKDAVSSRNAFAAAHSSYAIYLKNTGAALSDYAQGEV  60



>ref|XP_008362706.1| PREDICTED: uncharacterized protein LOC103426389 isoform X1 [Malus 
domestica]
Length=744

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V+RCK+RK+FMKEAV+ RNAFAAAHSSYA+ LKNTGAAL DYA+GE 
Sbjct  1    MGCTQSKIENEEAVSRCKDRKLFMKEAVSFRNAFAAAHSSYAIYLKNTGAALSDYAQGEV  60



>ref|XP_008362707.1| PREDICTED: uncharacterized protein LOC103426389 isoform X2 [Malus 
domestica]
Length=711

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V+RCK+RK+FMKEAV+ RNAFAAAHSSYA+ LKNTGAAL DYA+GE 
Sbjct  1    MGCTQSKIENEEAVSRCKDRKLFMKEAVSFRNAFAAAHSSYAIYLKNTGAALSDYAQGEV  60



>gb|KJB13152.1| hypothetical protein B456_002G059600 [Gossypium raimondii]
 gb|KJB13153.1| hypothetical protein B456_002G059600 [Gossypium raimondii]
Length=742

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QS+IENEE VARCKERK FMKEAVAARNAFAAAHS+YA+SLKNTGAAL DYA GE 
Sbjct  1    MGCSQSRIENEEAVARCKERKQFMKEAVAARNAFAAAHSAYAMSLKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>emb|CBI36151.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V RCKERK+FMK+AV ARNAFAAAHS+YA+SLKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEEIVTRCKERKLFMKDAVTARNAFAAAHSAYAMSLKNTGAALSDYAHGEL  60

Query  346  QF  351
            + 
Sbjct  61   KL  62



>gb|KHG04451.1| Monodehydroascorbate reductase, fruit isozyme [Gossypium arboreum]
Length=741

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QS+IENEE VARCKERK FMKEAVAARNAFAAAHS+YA+SLKNTGAAL DYA GE 
Sbjct  1    MGCSQSRIENEEAVARCKERKQFMKEAVAARNAFAAAHSAYAMSLKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_010545713.1| PREDICTED: uncharacterized protein LOC104817994 [Tarenaya hassleriana]
Length=834

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  157  GVPMGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAE  336
            G  MGCTQSKIENEE V RCKERK FMK++V+ARNAFAAAH++YA++LKNTGAAL DYA 
Sbjct  43   GAKMGCTQSKIENEEAVTRCKERKQFMKDSVSARNAFAAAHAAYAMALKNTGAALSDYAH  102

Query  337  GE  342
            GE
Sbjct  103  GE  104



>emb|CAN72109.1| hypothetical protein VITISV_044047 [Vitis vinifera]
Length=728

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 82/134 (61%), Gaps = 30/134 (22%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V RCKERK  MK+AV ARNAFAAAHS+YA+SLKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEEIVTRCKERKXXMKDAVTARNAFAAAHSAYAMSLKNTGAALSDYAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSN------YDlppppplpfftpsplQ  507
            Q                        +  +P    SN         PPPPPLP F  +PLQ
Sbjct  61   Q------------------------NPQLPTQTNSNNPPHYEXLPPPPPPLPNFPAAPLQ  96

Query  508  RAATMPEISIPTPD  549
            RAATMPE+ +P PD
Sbjct  97   RAATMPELKLPKPD  110



>gb|KDO51232.1| hypothetical protein CISIN_1g015294mg [Citrus sinensis]
Length=409

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V RCK+RK FMKEAV ARNAFAAAHS+YA++LKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEEAVTRCKDRKQFMKEAVGARNAFAAAHSAYAMALKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_008342705.1| PREDICTED: uncharacterized protein LOC103405477 [Malus domestica]
Length=736

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V+RCK+RK+FMK+AV+ RNAFAAAHSSYA+ LKNTGAAL DYA+GE 
Sbjct  1    MGCTQSKIENEEAVSRCKDRKLFMKQAVSFRNAFAAAHSSYAIYLKNTGAALSDYAQGEV  60



>ref|XP_002516075.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46495.1| conserved hypothetical protein [Ricinus communis]
Length=714

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCTQSKIENEE V+RCKERK FMKEAV+ARNAFAAAHS+Y++SLKNTGAAL DY +GE
Sbjct  1    MGCTQSKIENEEAVSRCKERKQFMKEAVSARNAFAAAHSAYSISLKNTGAALSDYTQGE  59



>ref|XP_004486732.1| PREDICTED: uncharacterized protein LOC101506888 isoform X1 [Cicer 
arietinum]
 ref|XP_004486733.1| PREDICTED: uncharacterized protein LOC101506888 isoform X2 [Cicer 
arietinum]
Length=753

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKIENEE VARCKERK FMKEAV+ RNAFAAAHS+Y  SLKNTGAAL D+A GE 
Sbjct  1    MGCNQSKIENEEAVARCKERKRFMKEAVSTRNAFAAAHSAYTTSLKNTGAALGDFAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_006427010.1| hypothetical protein CICLE_v10024988mg [Citrus clementina]
 gb|ESR40250.1| hypothetical protein CICLE_v10024988mg [Citrus clementina]
Length=736

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V RCK+RK FMKEAV ARNAFAAAHS+YA++LKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEEAVTRCKDRKQFMKEAVGARNAFAAAHSAYAMALKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>gb|KDP37214.1| hypothetical protein JCGZ_06270 [Jatropha curcas]
Length=729

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE VARCKERK FMKEAV+ARNAFAAAHS+YA+SLKNTGAAL DYA+ E 
Sbjct  1    MGCTQSKIENEEAVARCKERKQFMKEAVSARNAFAAAHSAYAISLKNTGAALSDYAQSEV  60



>ref|XP_007024146.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007024147.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007024148.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26768.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26769.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26770.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=736

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE V RCKERK FMKEAVAARNAFAAAHS+YA+SLKNTGAAL DYA GE 
Sbjct  1    MGCSQSKIENEEAVTRCKERKQFMKEAVAARNAFAAAHSAYAMSLKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_006465528.1| PREDICTED: uncharacterized protein LOC102613887 [Citrus sinensis]
Length=736

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V RCK+RK FMKEAV ARNAFAAAHS+YA++LKNTGAAL DYA GE 
Sbjct  1    MGCTQSKIENEEAVTRCKDRKQFMKEAVGARNAFAAAHSAYAMALKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_007024149.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY26771.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=743

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE V RCKERK FMKEAVAARNAFAAAHS+YA+SLKNTGAAL DYA GE 
Sbjct  1    MGCSQSKIENEEAVTRCKERKQFMKEAVAARNAFAAAHSAYAMSLKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_010907260.1| PREDICTED: LOW QUALITY PROTEIN: proline-rich receptor-like protein 
kinase PERK14 [Elaeis guineensis]
Length=740

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE VARCKERK +MK AV++RNAFAAAHS+Y+V+LKNTGAAL DYA+GE 
Sbjct  1    MGCTQSKIENEEAVARCKERKQWMKVAVSSRNAFAAAHSAYSVALKNTGAALSDYAQGEV  60



>ref|XP_006826988.1| hypothetical protein AMTR_s00010p00207960 [Amborella trichopoda]
 gb|ERM94225.1| hypothetical protein AMTR_s00010p00207960 [Amborella trichopoda]
Length=693

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE+V RCKERK  MKEAV ARN FAAAHSSY  +LKNTGAAL DYA GE+
Sbjct  1    MGCTQSKIENEESVGRCKERKQHMKEAVTARNGFAAAHSSYIFTLKNTGAALSDYAHGES  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_008447501.1| PREDICTED: uncharacterized protein LOC103489933 [Cucumis melo]
Length=736

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 88/131 (67%), Gaps = 8/131 (6%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE +ARCKERK+ MK+AV ARNAFAAAHS+Y++SLKNTGAAL DYA GE 
Sbjct  1    MGCSQSKIENEEAIARCKERKIHMKDAVTARNAFAAAHSAYSMSLKNTGAALSDYAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSNYDlppppplpfftpsp-lQRAATM  522
            Q            + ++ S+    SS   P +       PPPPPLP    S  LQRAATM
Sbjct  61   Q-------NPQFVSVSTQSNPGVTSSAAAPVTAPFESFPPPPPPLPPSNFSTPLQRAATM  113

Query  523  PEISIPTPDLK  555
            P++++  PDLK
Sbjct  114  PQMNVYNPDLK  124



>ref|XP_003542101.1| PREDICTED: uncharacterized protein LOC100791852 [Glycine max]
Length=749

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 82/128 (64%), Gaps = 9/128 (7%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKIENEE VARCKERK FMK++V++RNAFAAAHSSYA  LKNTGAAL D+A GE 
Sbjct  1    MGCNQSKIENEEAVARCKERKRFMKDSVSSRNAFAAAHSSYATCLKNTGAALGDFAHGEV  60

Query  346  QFtsasaaaaaaaastsgsssvpgssvGIPPSMTSNYDlppppplpfftpsplQRAATMP  525
            Q              ++ +++   SS  +P        LPPPP   F    PLQRAA+MP
Sbjct  61   Q---------NPQLHSNDNNTTSSSSSYVPAPQPFEIPLPPPPLPDFSPAQPLQRAASMP  111

Query  526  EISIPTPD  549
            EI I  PD
Sbjct  112  EIKINNPD  119



>ref|XP_004150357.1| PREDICTED: uncharacterized protein LOC101204163 [Cucumis sativus]
Length=707

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE +ARCKERK+ MK+AV ARNAFAAAHS+Y++SLKNTGAAL DYA GE 
Sbjct  1    MGCSQSKIENEEAIARCKERKIHMKDAVTARNAFAAAHSAYSMSLKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_007150659.1| hypothetical protein PHAVU_005G170800g [Phaseolus vulgaris]
 gb|ESW22653.1| hypothetical protein PHAVU_005G170800g [Phaseolus vulgaris]
Length=744

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKIENEE VARCKERK FMK+AV++RNAFAAAHS+YA  LKNTGAAL D+A+GE 
Sbjct  1    MGCNQSKIENEEAVARCKERKRFMKDAVSSRNAFAAAHSAYATCLKNTGAALGDFAQGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_004169923.1| PREDICTED: uncharacterized LOC101204163 [Cucumis sativus]
Length=715

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE +ARCKERK+ MK+AV ARNAFAAAHS+Y++SLKNTGAAL DYA GE 
Sbjct  1    MGCSQSKIENEEAIARCKERKIHMKDAVTARNAFAAAHSAYSMSLKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>gb|KGN58062.1| hypothetical protein Csa_3G481220 [Cucumis sativus]
Length=736

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE +ARCKERK+ MK+AV ARNAFAAAHS+Y++SLKNTGAAL DYA GE 
Sbjct  1    MGCSQSKIENEEAIARCKERKIHMKDAVTARNAFAAAHSAYSMSLKNTGAALSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_002516584.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45925.1| conserved hypothetical protein [Ricinus communis]
Length=728

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK+ENEE+VARCKERK+ MKEAV ARNAFAA HS + +SLKNTGAAL DYA+GE 
Sbjct  1    MGCAQSKVENEESVARCKERKILMKEAVVARNAFAAGHSGFTISLKNTGAALSDYAQGEV  60



>ref|XP_002304192.2| hypothetical protein POPTR_0003s05350g, partial [Populus trichocarpa]
 gb|EEE79171.2| hypothetical protein POPTR_0003s05350g, partial [Populus trichocarpa]
Length=461

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE ++RCKERK+FMKEAV+ARNAFAAAHSSY++SLKNTGAAL+D+A+ E
Sbjct  1    MGCNQSKIENEEAISRCKERKLFMKEAVSARNAFAAAHSSYSISLKNTGAALNDFAQAE  59



>ref|XP_008462152.1| PREDICTED: uncharacterized protein LOC103500575 [Cucumis melo]
Length=705

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE V+RCK+RKMFMK+AV ARNAFAAAHSSYA+SLKNTGA L DYA GE 
Sbjct  1    MGCSQSKIENEEVVSRCKDRKMFMKDAVTARNAFAAAHSSYAMSLKNTGAVLSDYAHGEG  60



>ref|XP_004141776.1| PREDICTED: uncharacterized protein LOC101222402 [Cucumis sativus]
 ref|XP_004169318.1| PREDICTED: uncharacterized protein LOC101224589 [Cucumis sativus]
 gb|KGN45358.1| hypothetical protein Csa_7G446740 [Cucumis sativus]
Length=700

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE V+RCK+RKMFMK+AV ARNAFAAAHSSYA+SLKNTGA L DYA GE 
Sbjct  1    MGCSQSKIENEEVVSRCKDRKMFMKDAVTARNAFAAAHSSYAMSLKNTGAVLSDYAHGEG  60



>gb|KDP34224.1| hypothetical protein JCGZ_07795 [Jatropha curcas]
Length=751

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK++NEE+VARCKERKM MKEAV ARNA AA HS + +SLKNTGAAL DYA GE 
Sbjct  1    MGCAQSKVDNEESVARCKERKMLMKEAVVARNALAAGHSGFTISLKNTGAALSDYAHGEV  60



>ref|XP_002281782.1| PREDICTED: uncharacterized protein LOC100259547 [Vitis vinifera]
 ref|XP_010648551.1| PREDICTED: uncharacterized protein LOC100259547 [Vitis vinifera]
Length=707

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+IENEE V+RCKERK+ MKEA+AARNAFAA H+ Y ++LKNTGAAL+DY EGEA
Sbjct  1    MGCAQSRIENEEAVSRCKERKILMKEALAARNAFAAGHTGYTMALKNTGAALNDYGEGEA  60

Query  346  Q  348
            +
Sbjct  61   E  61



>ref|XP_011001614.1| PREDICTED: uncharacterized protein LOC105108845 [Populus euphratica]
Length=698

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE ++RCKERK+FMKEAV+ARNAFAAAHS+Y++SLKNTGAAL+D+A+ E
Sbjct  1    MGCNQSKIENEEAISRCKERKLFMKEAVSARNAFAAAHSAYSISLKNTGAALNDFAQAE  59



>ref|XP_002299694.2| hypothetical protein POPTR_0001s18130g [Populus trichocarpa]
 gb|EEE84499.2| hypothetical protein POPTR_0001s18130g [Populus trichocarpa]
Length=696

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V+RCK+R+ FMKEAV+ RNAFAAAHSSYA+SLKNTGAAL+DYA+GE
Sbjct  1    MGCNQSKIENEEAVSRCKDRRHFMKEAVSNRNAFAAAHSSYAMSLKNTGAALNDYAQGE  59



>ref|XP_010251918.1| PREDICTED: uncharacterized protein LOC104593650 [Nelumbo nucifera]
Length=740

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V+RCK+RK +MK+AV ARNAFAAAHS++ + LKNTGAAL DY +GE 
Sbjct  1    MGCTQSKIENEEAVSRCKDRKQYMKDAVTARNAFAAAHSAFTMGLKNTGAALSDYGQGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>gb|ABR18011.1| unknown [Picea sitchensis]
Length=724

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE+V RCKERK  MKE+VAARNAFAAAHS+Y   LKNTGAAL+DY +GE+
Sbjct  1    MGCSQSKIENEESVVRCKERKQLMKESVAARNAFAAAHSAYITLLKNTGAALNDYGQGES  60



>ref|XP_010112163.1| hypothetical protein L484_019902 [Morus notabilis]
 gb|EXC32788.1| hypothetical protein L484_019902 [Morus notabilis]
Length=821

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+IENEE+V+RCKERK+ MKEAV ARNAFAA HS YAV+LKNTGAAL DYA GE+
Sbjct  1    MGCAQSRIENEESVSRCKERKILMKEAVVARNAFAAGHSGYAVALKNTGAALSDYAHGES  60

Query  346  Q  348
            +
Sbjct  61   E  61



>ref|XP_009147692.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103871216 
[Brassica rapa]
Length=800

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK FMK+AV ARNAFAAAHS+YA++LKNTGAAL DYA GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQFMKDAVVARNAFAAAHSAYAMALKNTGAALSDYAHGE  59



>gb|KFK35788.1| hypothetical protein AALP_AA4G036700 [Arabis alpina]
Length=807

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK FMK+AV ARNAFAAAHS+Y+++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQFMKDAVTARNAFAAAHSAYSMALKNTGAALSDYSHGE  59



>emb|CDP18480.1| unnamed protein product [Coffea canephora]
Length=726

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQS+I+NEE+V+RCKER+  MKEAV+ARNAFA+AHS YAVSLKN GAAL DYA+GEA
Sbjct  1    MGCTQSRIDNEESVSRCKERRNLMKEAVSARNAFASAHSGYAVSLKNIGAALSDYAQGEA  60



>gb|KJB54879.1| hypothetical protein B456_009G052500 [Gossypium raimondii]
Length=736

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+I+NEE+VARCK+RK+ MKEAV ARNAFAAAHS YA+SLKNTGAAL DY  GEA
Sbjct  1    MGCAQSRIDNEESVARCKDRKILMKEAVVARNAFAAAHSGYAISLKNTGAALSDYGHGEA  60

Query  346  QF  351
            + 
Sbjct  61   EV  62



>ref|XP_006392932.1| hypothetical protein EUTSA_v10011250mg [Eutrema salsugineum]
 gb|ESQ30218.1| hypothetical protein EUTSA_v10011250mg [Eutrema salsugineum]
Length=790

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK FMK+AV+ RNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQFMKDAVSNRNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>ref|XP_008447502.1| PREDICTED: uncharacterized protein LOC103489935 [Cucumis melo]
Length=722

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE +ARCK+RK+ MK+AVAARNAFAAAHS+Y +SLKNTGA+L DYA GE 
Sbjct  1    MGCSQSKIENEEAIARCKDRKIHMKDAVAARNAFAAAHSAYVMSLKNTGASLSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>gb|EPS68177.1| hypothetical protein M569_06594 [Genlisea aurea]
Length=438

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKIENEETV RCKERK +M+ AV ARN FAAAH S A+SLKNTGAAL D+A GEA
Sbjct  1    MGCGQSKIENEETVNRCKERKQYMERAVTARNKFAAAHVSNAMSLKNTGAALSDFAHGEA  60



>gb|KCW81524.1| hypothetical protein EUGRSUZ_C02885 [Eucalyptus grandis]
Length=747

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+NEE+VARCKER+ FMK+AVAARNAFAA H+ YA++LKNTGAAL DY  GEA
Sbjct  1    MGCAQSKIDNEESVARCKERRNFMKDAVAARNAFAAGHTGYAMALKNTGAALGDYGHGEA  60

Query  346  Q  348
            +
Sbjct  61   E  61



>ref|XP_004150356.1| PREDICTED: uncharacterized protein LOC101203914 [Cucumis sativus]
 gb|KGN58063.1| hypothetical protein Csa_3G481230 [Cucumis sativus]
Length=722

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE +ARCK+RK+ MK+AVAARNAFAA HS+Y +SLKNTGA+L DYA GE 
Sbjct  1    MGCSQSKIENEEAIARCKDRKIHMKDAVAARNAFAAGHSAYVMSLKNTGASLSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_004245249.1| PREDICTED: uncharacterized protein LOC101255018 [Solanum lycopersicum]
Length=725

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+I+NEE+V+RCK+R+ FMKEAV  RN FAAAHS+Y+++LKNTGAAL DYA+GE
Sbjct  1    MGCAQSRIDNEESVSRCKDRRNFMKEAVNYRNFFAAAHSAYSIALKNTGAALSDYAQGE  59



>ref|XP_006356661.1| PREDICTED: uncharacterized protein LOC102596799 [Solanum tuberosum]
Length=719

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+I+NEE+V+RCK+R+ FMKEAV  RN FAAAHS+Y+++LKNTGAAL DYA+GE
Sbjct  1    MGCAQSRIDNEESVSRCKDRRNFMKEAVNYRNFFAAAHSAYSIALKNTGAALSDYAQGE  59



>ref|XP_004172478.1| PREDICTED: uncharacterized protein LOC101231290 [Cucumis sativus]
Length=696

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE +ARCK+RK+ MK+AVAARNAFAA HS+Y +SLKNTGA+L DYA GE 
Sbjct  1    MGCSQSKIENEEAIARCKDRKIHMKDAVAARNAFAAGHSAYVMSLKNTGASLSDYAHGEV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_010033880.1| PREDICTED: uncharacterized protein LOC104423116 [Eucalyptus grandis]
 gb|KCW53731.1| hypothetical protein EUGRSUZ_J02988 [Eucalyptus grandis]
Length=726

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEE V RCKER+  MKEAVA RNAFAAAH++YAV+LKNTGAAL DYA GE+
Sbjct  1    MGCTQSKIENEEAVNRCKERRQHMKEAVATRNAFAAAHAAYAVALKNTGAALSDYAAGES  60



>ref|XP_011007598.1| PREDICTED: uncharacterized protein LOC105113217 [Populus euphratica]
Length=688

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V+RCK+R+ FMKEAV+ RNAFAAAHSSYA+SLKNTGAAL+DYA+ E
Sbjct  1    MGCHQSKIENEEAVSRCKDRRHFMKEAVSNRNAFAAAHSSYAMSLKNTGAALNDYAQSE  59



>ref|XP_011072341.1| PREDICTED: uncharacterized protein LOC105157620 [Sesamum indicum]
Length=743

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEETV RCKERK  M+ AV ARN FAAAHS++A+SLKNTGAAL D+A+GE 
Sbjct  1    MGCTQSKIENEETVNRCKERKQHMERAVTARNKFAAAHSAHAMSLKNTGAALSDFAQGEV  60

Query  346  QF  351
             +
Sbjct  61   VY  62



>ref|XP_011019684.1| PREDICTED: uncharacterized protein LOC105122326 [Populus euphratica]
Length=763

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK++NEE+V+RCKERK+ MKEAVAARNAFAA HS YA+ LKNTGAAL DY  GEA
Sbjct  1    MGCAQSKVDNEESVSRCKERKILMKEAVAARNAFAAGHSGYAIYLKNTGAALSDYGHGEA  60



>ref|XP_002308623.2| hypothetical protein POPTR_0006s26050g [Populus trichocarpa]
 gb|EEE92146.2| hypothetical protein POPTR_0006s26050g [Populus trichocarpa]
Length=767

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK++NEE+V+RCKERK+ MKEAVAARNAFAA HS YA+ LKNTGAAL DY  GEA
Sbjct  1    MGCAQSKVDNEESVSRCKERKILMKEAVAARNAFAAGHSGYAIYLKNTGAALSDYGHGEA  60



>ref|XP_004501198.1| PREDICTED: uncharacterized protein LOC101510604 [Cicer arietinum]
Length=696

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+IENEE+VARCK+RK  M+EAV ARNAFAA HS YA++LKNTGAAL DYA GE 
Sbjct  1    MGCAQSRIENEESVARCKDRKNLMREAVVARNAFAAGHSGYAMALKNTGAALSDYAHGET  60

Query  346  QF  351
              
Sbjct  61   HL  62



>ref|XP_010691307.1| PREDICTED: uncharacterized protein LOC104904665 [Beta vulgaris 
subsp. vulgaris]
Length=777

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+QSKIENEE V+RCK+RK FMK AV+ARNAFAAAHSSYA+SLKN GAAL D+A+GE 
Sbjct  1    MGCSQSKIENEEAVSRCKDRKSFMKSAVSARNAFAAAHSSYAMSLKNAGAALSDFAQGEV  60



>ref|XP_003597769.1| hypothetical protein MTR_2g102050 [Medicago truncatula]
 gb|AES68020.1| BZIP protein [Medicago truncatula]
Length=760

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKIENEE++ RCKERK +MKEAV++RNAFAAAH++Y+ SLKNTGAAL D++ GE 
Sbjct  1    MGCNQSKIENEESILRCKERKRYMKEAVSSRNAFAAAHTAYSTSLKNTGAALGDFSHGEV  60



>gb|EYU29268.1| hypothetical protein MIMGU_mgv1a002196mg [Erythranthe guttata]
Length=702

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKIENEE+V+RCKER+  MK+AV+ RNAFA+AHS Y+VSLK+TGAAL DYA+GE 
Sbjct  1    MGCAQSKIENEESVSRCKERRNLMKDAVSVRNAFASAHSGYSVSLKDTGAALSDYAQGEV  60



>gb|EYU21542.1| hypothetical protein MIMGU_mgv1a001881mg [Erythranthe guttata]
Length=745

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIENEETV RC+ERK  M+ +V ARN FAAAHS++A+SLKNTGAAL D+A+GE 
Sbjct  1    MGCTQSKIENEETVNRCRERKQHMERSVTARNKFAAAHSAHAMSLKNTGAALSDFAQGEV  60

Query  346  QF  351
             +
Sbjct  61   IY  62



>ref|XP_011089542.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105170443 
[Sesamum indicum]
Length=717

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+NEE+V+RCKER+  MKEAV+ RNAFA+AHS YAVSLK+TGAAL DYA+GE 
Sbjct  1    MGCAQSKIDNEESVSRCKERRNIMKEAVSVRNAFASAHSGYAVSLKDTGAALSDYAQGEV  60



>ref|XP_010479739.1| PREDICTED: uncharacterized protein LOC104758551, partial [Camelina 
sativa]
Length=687

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK  MK+AV ARNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>dbj|BAF00450.1| putative bZIP protein [Arabidopsis thaliana]
Length=798

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK  MK+AV ARNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>ref|NP_849796.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51544.1|AC037424_9 bZIP protein, putative; 48652-45869 [Arabidopsis thaliana]
 gb|AEE32783.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
Length=798

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK  MK+AV ARNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>ref|XP_002324252.2| hypothetical protein POPTR_0018s00880g [Populus trichocarpa]
 gb|EEF02817.2| hypothetical protein POPTR_0018s00880g [Populus trichocarpa]
Length=764

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK++NEE V+RCKERK+ MKEAV ARNAFAA HS Y +SLKNTGA+L DY  GEA
Sbjct  1    MGCAQSKVDNEEPVSRCKERKILMKEAVTARNAFAAGHSGYTISLKNTGASLSDYGHGEA  60



>ref|XP_009616206.1| PREDICTED: uncharacterized protein LOC104108786 [Nicotiana tomentosiformis]
Length=728

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+++NEE+V+RCKER+  MKEAV  RN FAAAHS+Y+++LKNTGAAL DYA+GE
Sbjct  1    MGCAQSRLDNEESVSRCKERRNLMKEAVNYRNFFAAAHSAYSMALKNTGAALSDYAQGE  59



>ref|XP_010479738.1| PREDICTED: kinesin-related protein 4-like [Camelina sativa]
Length=804

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK  MK+AV ARNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>ref|XP_010500831.1| PREDICTED: uncharacterized protein LOC104778154 [Camelina sativa]
Length=809

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK  MK+AV ARNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>gb|EPS57365.1| hypothetical protein M569_17453, partial [Genlisea aurea]
Length=434

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSK++NE++VARCKER+  MKEAVA RNAFAAAHS YAV+LK TGAAL DYA+GE
Sbjct  1    MGCAQSKVDNEDSVARCKERRNLMKEAVAVRNAFAAAHSGYAVALKETGAALSDYAQGE  59



>ref|XP_010462070.1| PREDICTED: uncharacterized protein LOC104742736 [Camelina sativa]
Length=808

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK  MK+AV ARNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>ref|XP_010931963.1| PREDICTED: uncharacterized protein LOC105052734 [Elaeis guineensis]
 ref|XP_010931964.1| PREDICTED: uncharacterized protein LOC105052734 [Elaeis guineensis]
Length=740

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+NEE V RCKERK +MKEAV+ RNAFAAAHS+Y VS+KNTGAAL DY  GE 
Sbjct  1    MGCAQSKIDNEEAVTRCKERKKWMKEAVSYRNAFAAAHSAYVVSVKNTGAALSDYGRGEV  60



>ref|XP_002891687.1| hypothetical protein ARALYDRAFT_474348 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67946.1| hypothetical protein ARALYDRAFT_474348 [Arabidopsis lyrata subsp. 
lyrata]
Length=800

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCKERK  MK+AV ARNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>ref|XP_009799127.1| PREDICTED: uncharacterized protein LOC104245243 [Nicotiana sylvestris]
Length=726

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+++NEE+V+RCKER+  MKEAV  RN FAAAHS+Y+++LKNTGAAL DYA+GE
Sbjct  1    MGCAQSRLDNEESVSRCKERRNLMKEAVNYRNFFAAAHSAYSMALKNTGAALSDYAQGE  59



>ref|XP_007012028.1| Golgin subfamily A member 4 [Theobroma cacao]
 gb|EOY29647.1| Golgin subfamily A member 4 [Theobroma cacao]
Length=741

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+I+NEE+VARCK+RK  MK+AV ARNAFAA HS YA+SLKNTGAAL DY  GEA
Sbjct  1    MGCAQSRIDNEESVARCKDRKTLMKDAVIARNAFAAGHSGYAISLKNTGAALSDYGHGEA  60



>gb|KJB65700.1| hypothetical protein B456_010G109200 [Gossypium raimondii]
Length=726

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+IENEE+V RCK+RK  MK+AV  RNAFAA HS YA+SLKNTGAAL DY  GEA
Sbjct  1    MGCAQSRIENEESVVRCKDRKNLMKDAVVTRNAFAAGHSGYAISLKNTGAALSDYGHGEA  60

Query  346  Q  348
            +
Sbjct  61   E  61



>ref|XP_007137162.1| hypothetical protein PHAVU_009G105100g [Phaseolus vulgaris]
 gb|ESW09156.1| hypothetical protein PHAVU_009G105100g [Phaseolus vulgaris]
Length=694

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+I+NEE+V+RCKERK  MK+AV ARNAFAA HS YAV+LKNTGAAL DYA GE
Sbjct  1    MGCAQSRIDNEESVSRCKERKNLMKDAVVARNAFAAGHSGYAVALKNTGAALSDYAHGE  59



>ref|XP_011026550.1| PREDICTED: uncharacterized protein LOC105127120 [Populus euphratica]
Length=755

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK++NEE V+RCKERK+ MKEAVAARNAFAA HS Y +SLKNTGA+L DY  GEA
Sbjct  1    MGCAQSKVDNEEPVSRCKERKILMKEAVAARNAFAAGHSGYTISLKNTGASLSDYGHGEA  60



>ref|XP_010249762.1| PREDICTED: uncharacterized protein LOC104592230 isoform X1 [Nelumbo 
nucifera]
Length=703

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIE+EE V RCKERK FM+EAV+ R AFAAAH +Y +SLK+TG AL +YA+ EA
Sbjct  1    MGCTQSKIESEEAVVRCKERKRFMREAVSTRGAFAAAHVNYYMSLKSTGGALSEYAQYEA  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_010249763.1| PREDICTED: uncharacterized protein LOC104592230 isoform X2 [Nelumbo 
nucifera]
Length=670

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQSKIE+EE V RCKERK FM+EAV+ R AFAAAH +Y +SLK+TG AL +YA+ EA
Sbjct  1    MGCTQSKIESEEAVVRCKERKRFMREAVSTRGAFAAAHVNYYMSLKSTGGALSEYAQYEA  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_009345256.1| PREDICTED: uncharacterized protein LOC103937065 [Pyrus x bretschneideri]
Length=713

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+I+NEE+V+RCKER+  MKEAV ARNAFA+ HS YAVSLKN GAAL DY  GE 
Sbjct  1    MGCAQSRIDNEESVSRCKERRNLMKEAVVARNAFASGHSGYAVSLKNAGAALSDYGHGET  60

Query  346  QF  351
            Q 
Sbjct  61   QV  62



>ref|XP_010667633.1| PREDICTED: uncharacterized protein LOC104884645 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+IENEE V+RCKERK+ MKEA+ AR AFA  HS+YA++LKN G+AL DY  GE
Sbjct  1    MGCAQSRIENEEAVSRCKERKILMKEALLARTAFAVGHSAYAIALKNAGSALSDYGHGE  59



>ref|XP_010667640.1| PREDICTED: uncharacterized protein LOC104884645 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=650

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+IENEE V+RCKERK+ MKEA+ AR AFA  HS+YA++LKN G+AL DY  GE
Sbjct  1    MGCAQSRIENEEAVSRCKERKILMKEALLARTAFAVGHSAYAIALKNAGSALSDYGHGE  59



>ref|XP_006306796.1| hypothetical protein CARUB_v10008333mg [Capsella rubella]
 gb|EOA39694.1| hypothetical protein CARUB_v10008333mg [Capsella rubella]
Length=801

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE V RCK+RK  MK+AV ARNAFAAAHS+YA++LKNTGAAL DY+ GE
Sbjct  1    MGCAQSKIENEEAVTRCKDRKKLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE  59



>ref|XP_008378117.1| PREDICTED: uncharacterized protein LOC103441188 [Malus domestica]
Length=710

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+I+NEE+V+RCKER+  MKEAV ARNAFA+ HS YAVSLKN GAAL DY  GE 
Sbjct  1    MGCAQSRIDNEESVSRCKERRNLMKEAVVARNAFASGHSGYAVSLKNAGAALSDYGHGET  60

Query  346  QF  351
            Q 
Sbjct  61   QV  62



>ref|XP_007225191.1| hypothetical protein PRUPE_ppa002131mg [Prunus persica]
 gb|EMJ26390.1| hypothetical protein PRUPE_ppa002131mg [Prunus persica]
Length=711

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+I+NEE+V+RCKER+  MKEAV ARNAFA+ HS Y ++LKN GAAL DY  GE 
Sbjct  1    MGCAQSRIDNEESVSRCKERRNLMKEAVVARNAFASGHSGYTMALKNAGAALSDYGHGET  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_010519919.1| PREDICTED: uncharacterized protein LOC104799211 [Tarenaya hassleriana]
Length=762

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  MKEAV ARNAFAA HS+YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVMKEAVVARNAFAAGHSAYAMALKNTGAALSDYGHGES  60



>ref|XP_003603595.1| hypothetical protein MTR_3g109450 [Medicago truncatula]
 gb|AES73846.1| BZIP protein [Medicago truncatula]
Length=712

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+I+NEE+V+RCK+RK  M+EAVAARNAFAA HS YA++LKNTGAAL DYA GE 
Sbjct  1    MGCAQSRIDNEESVSRCKDRKNLMREAVAARNAFAAGHSGYAMALKNTGAALSDYAHGET  60

Query  346  QF  351
              
Sbjct  61   HL  62



>ref|XP_009151092.1| PREDICTED: uncharacterized protein LOC103874418 [Brassica rapa]
Length=735

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK++NEE+VARCKER+  +KEAV A  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSKVDNEESVARCKERRNVIKEAVTASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>emb|CDX88193.1| BnaA06g27840D [Brassica napus]
Length=737

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK++NEE+VARCKER+  +KEAV A  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSKVDNEESVARCKERRNVIKEAVTASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_003523728.1| PREDICTED: formin-like protein 8-like [Glycine max]
Length=699

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+I+NEE+V+RCK+RK  MK+AV ARNAFAA HS YA +LKNTGAAL DYA GE
Sbjct  1    MGCAQSRIDNEESVSRCKDRKNLMKDAVVARNAFAAGHSGYAFALKNTGAALSDYAHGE  59



>ref|XP_008220000.1| PREDICTED: uncharacterized protein LOC103320143 [Prunus mume]
Length=713

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+I+NEE+V RCKER+  MKEAV +RNAFA+ HS Y ++LKN GAAL DY  GE 
Sbjct  1    MGCAQSRIDNEESVTRCKERRNLMKEAVVSRNAFASGHSGYTMALKNAGAALSDYGHGET  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_009338711.1| PREDICTED: uncharacterized protein LOC103931028 [Pyrus x bretschneideri]
Length=709

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+IENEE+V RCK+R+  MKEAV ARNAFA+ HS YAV+LKN GAAL DY  GE 
Sbjct  1    MGCAQSRIENEESVLRCKDRRNLMKEAVVARNAFASGHSGYAVALKNAGAALSDYGHGET  60

Query  346  QF  351
            Q 
Sbjct  61   QV  62



>ref|XP_008393906.1| PREDICTED: uncharacterized protein LOC103456054 [Malus domestica]
Length=711

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+IENEE+V RCK+R+  MKEAV ARNAFA+ HS YAV+LKN GAAL DY  GE 
Sbjct  1    MGCAQSRIENEESVLRCKDRRNLMKEAVVARNAFASGHSGYAVALKNAGAALSDYGHGET  60

Query  346  QF  351
            Q 
Sbjct  61   QV  62



>ref|XP_009368022.1| PREDICTED: uncharacterized protein LOC103957563 [Pyrus x bretschneideri]
Length=709

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+IENEE+V RCK+R+  MKEAV ARNAFA+ HS YAV+LKN GAAL DY  GE 
Sbjct  1    MGCAQSRIENEESVLRCKDRRNLMKEAVVARNAFASGHSGYAVALKNAGAALSDYGHGET  60

Query  346  QF  351
            Q 
Sbjct  61   QV  62



>emb|CDX80528.1| BnaC07g29160D [Brassica napus]
Length=733

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK++NEE VARCKER+  +KEAV A  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSKVDNEEAVARCKERRNVIKEAVTASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_010254134.1| PREDICTED: uncharacterized protein LOC104595215 [Nelumbo nucifera]
Length=710

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCTQS+IE EE V RCKERK FM+EAV+ RNAFAAAH +Y+VSLK+TG AL DYA+ + 
Sbjct  1    MGCTQSRIETEEAVIRCKERKQFMREAVSKRNAFAAAHVAYSVSLKSTGGALTDYAQCQV  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>gb|KFK27812.1| hypothetical protein AALP_AA8G433100 [Arabis alpina]
Length=755

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAV+A  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVSASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|NP_197941.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM13874.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91720.1| unknown protein [Arabidopsis thaliana]
 gb|AED93470.1| uncharacterized protein AT5G25590 [Arabidopsis thaliana]
Length=775

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAV+A  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVSASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_004292865.1| PREDICTED: uncharacterized protein LOC101308445 [Fragaria vesca 
subsp. vesca]
Length=722

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+I+NEE+V RCKER+  M+EAV ARNAFAA HS Y ++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRIDNEESVTRCKERRNLMREAVVARNAFAAGHSGYVMALKNTGAALSDYGHGES  60



>ref|XP_002874269.1| hypothetical protein ARALYDRAFT_910621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50528.1| hypothetical protein ARALYDRAFT_910621 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAV+A  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVSASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_009398982.1| PREDICTED: uncharacterized protein LOC103983491 [Musa acuminata 
subsp. malaccensis]
Length=729

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKIENEE+V RCK RK+FM++AVA+RNAFAAA ++YAV+LKNTGAAL ++ + E
Sbjct  1    MGCAQSKIENEESVVRCKNRKLFMRDAVASRNAFAAAQAAYAVALKNTGAALSEFGQSE  59



>ref|XP_003527819.1| PREDICTED: uncharacterized protein LOC100807597 [Glycine max]
Length=711

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+I+NEE+V+RCK+RK  +K+AV ARNAFAA HS YAV+LKNTGAAL DYA GE
Sbjct  1    MGCAQSRIDNEESVSRCKDRKNLIKDAVVARNAFAAGHSGYAVALKNTGAALSDYAHGE  59



>gb|KHN18210.1| hypothetical protein glysoja_025100 [Glycine soja]
Length=625

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+I+NEE+V+RCK+RK  +K+AV ARNAFAA HS YAV+LKNTGAAL DYA GE
Sbjct  1    MGCAQSRIDNEESVSRCKDRKNLIKDAVVARNAFAAGHSGYAVALKNTGAALSDYAHGE  59



>dbj|BAJ96409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=791

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+IENEE VARCKER+ FMK AVAARNAFAAAHS+YA SL++TGAAL ++A GE
Sbjct  1    MGCAQSRIENEEAVARCKERRQFMKAAVAARNAFAAAHSAYAFSLRDTGAALSEFAHGE  59



>ref|XP_010454904.1| PREDICTED: ABC transporter F family member 4-like isoform X1 
[Camelina sativa]
 ref|XP_010454905.1| PREDICTED: ABC transporter F family member 4-like isoform X2 
[Camelina sativa]
Length=798

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAVA   AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVAGSKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_010938806.1| PREDICTED: uncharacterized protein LOC105057803 [Elaeis guineensis]
Length=670

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE V RC+ERK +MKEAV ARNAFAAAHS+YAV+LKNTGAAL ++ +GE 
Sbjct  1    MGCAQSRVDNEEAVTRCRERKQWMKEAVTARNAFAAAHSAYAVALKNTGAALSEFGQGEV  60



>ref|XP_008777258.1| PREDICTED: uncharacterized protein LOC103697215 [Phoenix dactylifera]
Length=413

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+++NEE V RC+ERK +MKEAV ARNAFAAAHS+YAV+LKNTGAAL ++ +GE
Sbjct  1    MGCAQSRVDNEEAVFRCRERKQWMKEAVTARNAFAAAHSAYAVALKNTGAALSEFGQGE  59



>ref|XP_010421422.1| PREDICTED: DNA ligase 1-like isoform X3 [Camelina sativa]
Length=790

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAVAA  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVAASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_006287097.1| hypothetical protein CARUB_v10000261mg [Capsella rubella]
 gb|EOA19995.1| hypothetical protein CARUB_v10000261mg [Capsella rubella]
Length=791

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAVAA  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVAASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_010421420.1| PREDICTED: DNA ligase 1-like isoform X1 [Camelina sativa]
Length=796

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAVAA  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVAASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>gb|AAT93897.1| unknown protein [Oryza sativa Japonica Group]
Length=847

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+IENEE VARCKER+ +MK AV ARNAFAAAHS+YA+SL++TGAAL ++A GE
Sbjct  1    MGCAQSRIENEEAVARCKERRQWMKSAVQARNAFAAAHSAYAMSLRDTGAALSEFAHGE  59



>ref|XP_010421421.1| PREDICTED: DNA ligase 1-like isoform X2 [Camelina sativa]
Length=792

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAVAA  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVAASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_010493822.1| PREDICTED: DNA ligase 1-like [Camelina sativa]
Length=800

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAVAA  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVAASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_006394813.1| hypothetical protein EUTSA_v10003682mg [Eutrema salsugineum]
 gb|ESQ32099.1| hypothetical protein EUTSA_v10003682mg [Eutrema salsugineum]
Length=770

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCKER+  +KEAVAA  AFAA H +YA++LKNTGAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKERRNVIKEAVAASKAFAAGHFAYAIALKNTGAALSDYGHGES  60



>ref|XP_003604444.1| hypothetical protein MTR_4g012430 [Medicago truncatula]
Length=523

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK+ENEE +  CK+R  FMK+AVAARN FAAAHSSYA SLKNTGAAL D+A+GE 
Sbjct  1    MGCFQSKMENEEAITSCKDRHYFMKQAVAARNNFAAAHSSYAASLKNTGAALIDFAQGEQ  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>gb|AES86641.2| BZIP protein [Medicago truncatula]
Length=512

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK+ENEE +  CK+R  FMK+AVAARN FAAAHSSYA SLKNTGAAL D+A+GE 
Sbjct  1    MGCFQSKMENEEAITSCKDRHYFMKQAVAARNNFAAAHSSYAASLKNTGAALIDFAQGEQ  60

Query  346  Q  348
            Q
Sbjct  61   Q  61



>ref|XP_010942485.1| PREDICTED: uncharacterized protein LOC105060463 [Elaeis guineensis]
Length=734

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE V RC+ERK +MKEAV ARNAFAAAHS+YAV+LKNTGAAL ++ +GE 
Sbjct  1    MGCAQSRVDNEEAVFRCRERKQWMKEAVTARNAFAAAHSAYAVALKNTGAALSEFGQGEV  60



>ref|XP_008808244.1| PREDICTED: uncharacterized protein LOC103720359 [Phoenix dactylifera]
Length=735

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE V RC+ERK +MKEAV ARNAFAAAHS+YAV+LKNTGAAL ++ +GE 
Sbjct  1    MGCAQSRVDNEEAVFRCRERKQWMKEAVTARNAFAAAHSAYAVALKNTGAALSEFGQGEV  60



>ref|XP_009383699.1| PREDICTED: uncharacterized protein LOC103971407 [Musa acuminata 
subsp. malaccensis]
Length=751

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE V RCKER+ +MK AVA RNAFAAAHS+YAV+LKNTGAAL ++ +GEA
Sbjct  1    MGCAQSRVDNEEAVTRCKERRQWMKAAVAERNAFAAAHSAYAVALKNTGAALSEFGQGEA  60



>dbj|BAD01722.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD03267.1| hypothetical protein [Oryza sativa Japonica Group]
Length=247

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  169  GCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            GC QS+IENEE VA+CKER+ +MK  V ARNAFAA HS+YA+SL++TGAAL ++A GE
Sbjct  53   GCAQSRIENEEAVAKCKERRQWMKSVVQARNAFAAVHSAYAMSLRDTGAALFEFAHGE  110



>emb|CDX87081.1| BnaC09g03960D [Brassica napus]
Length=534

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS+++NEE VARCK+R+  +KEAV A  AFAA H +YA++LKN GAAL DY  GE+
Sbjct  1    MGCAQSRVDNEEAVARCKDRRNVIKEAVTASKAFAAGHFAYAIALKNAGAALSDYGHGES  60



>ref|XP_002457867.1| hypothetical protein SORBIDRAFT_03g017360 [Sorghum bicolor]
 gb|EES02987.1| hypothetical protein SORBIDRAFT_03g017360 [Sorghum bicolor]
Length=403

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+ EE V+RC+ERK  M +AV +RN FAAAH+ Y V LK+TG AL D+A+GEA
Sbjct  1    MGCGQSKIDQEEAVSRCRERKRLMADAVVSRNGFAAAHTGYTVRLKSTGGALSDFAQGEA  60



>gb|KDO79698.1| hypothetical protein CISIN_1g004600mg [Citrus sinensis]
Length=743

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+NEE VAR K+R+  MK+AV+ARNAFA+ HS Y+ +LKN GAAL D+A GE+
Sbjct  1    MGCAQSKIDNEEAVARSKDRRNLMKDAVSARNAFASGHSGYSFALKNVGAALSDFAHGES  60



>ref|XP_006476157.1| PREDICTED: myosin-9-like [Citrus sinensis]
Length=745

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+NEE VAR K+R+  MK+AV+ARNAFA+ HS Y+ +LKN GAAL D+A GE+
Sbjct  1    MGCAQSKIDNEEAVARSKDRRNLMKDAVSARNAFASGHSGYSFALKNVGAALSDFAHGES  60



>ref|XP_006450611.1| hypothetical protein CICLE_v10007564mg [Citrus clementina]
 gb|ESR63851.1| hypothetical protein CICLE_v10007564mg [Citrus clementina]
Length=745

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+NEE VAR K+R+  MK+AV+ARNAFA+ HS Y+ +LKN GAAL D+A GE+
Sbjct  1    MGCAQSKIDNEEAVARSKDRRNLMKDAVSARNAFASGHSGYSFALKNVGAALSDFAHGES  60



>gb|AFW82165.1| hypothetical protein ZEAMMB73_214762 [Zea mays]
Length=775

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+IENEE VARCKER+  MK AVA+RNAFAAAHS+YA SL++TG+AL ++A GE
Sbjct  1    MGCAQSRIENEEAVARCKERRQLMKAAVASRNAFAAAHSAYACSLRDTGSALSEFAHGE  59



>ref|XP_003568507.1| PREDICTED: ras and Rab interactor 3 [Brachypodium distachyon]
Length=779

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS+IENEE VARCKER+  MK AVAARN FAAAHS+YA SL++TGAAL ++A GE
Sbjct  1    MGCAQSRIENEEAVARCKERRQCMKGAVAARNGFAAAHSAYAFSLRDTGAALSEFAHGE  59



>ref|XP_010275436.1| PREDICTED: uncharacterized protein LOC104610494 [Nelumbo nucifera]
Length=756

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  A+AHS Y  SL+ TG+AL D+A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHLASAHSDYLRSLRLTGSALADFAAGE  59



>ref|XP_006644200.1| PREDICTED: uncharacterized protein LOC102708565 [Oryza brachyantha]
Length=760

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+ EE V+RC++RK  M +AV ARNAFAAAHS+Y V LK+TG AL D+A+GEA
Sbjct  1    MGCGQSKIDQEEAVSRCRDRKKLMADAVQARNAFAAAHSAYTVLLKSTGGALSDFAQGEA  60



>ref|XP_006576720.1| PREDICTED: uncharacterized protein LOC100792843 [Glycine max]
Length=799

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NEETV RCKER+ FMK+AV AR+  AAAHS Y   L+ TG+AL+ +A GE
Sbjct  1    MGCTASKLDNEETVRRCKERRRFMKDAVYARHHLAAAHSDYCRCLRLTGSALYTFAAGE  59



>ref|XP_008813601.1| PREDICTED: uncharacterized protein LOC103724193 [Phoenix dactylifera]
Length=760

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT S+++NE+TV RCKER+ FMKEAV +R+  A+AHS Y  SL+ TG+AL  +A+GE
Sbjct  1    MGCTASRLDNEDTVRRCKERRRFMKEAVDSRHHLASAHSEYLNSLRLTGSALTRFAQGE  59



>ref|XP_002989601.1| hypothetical protein SELMODRAFT_447743 [Selaginella moellendorffii]
 gb|EFJ09271.1| hypothetical protein SELMODRAFT_447743 [Selaginella moellendorffii]
Length=690

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NEE VARCK RK FMK AVA+R+ FAA+H++Y  +LKN GAA   + E E
Sbjct  1    MGCTSSKVDNEEKVARCKARKRFMKHAVASRHQFAASHAAYVQALKNVGAAFRQFGETE  59



>ref|XP_006445430.1| hypothetical protein CICLE_v10018930mg [Citrus clementina]
 gb|ESR58670.1| hypothetical protein CICLE_v10018930mg [Citrus clementina]
Length=785

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAH+ Y+ +L+ TG+AL D+A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHMAAAHADYSRTLRLTGSALCDFAAGE  59



>gb|KDO85511.1| hypothetical protein CISIN_1g040600mg [Citrus sinensis]
Length=754

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAH+ Y+ +L+ TG+AL D+A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHMAAAHADYSRTLRLTGSALCDFAAGE  59



>ref|XP_006464424.1| PREDICTED: uncharacterized protein LOC102627291 [Citrus sinensis]
Length=769

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAH+ Y+ +L+ TG+AL D+A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHMAAAHADYSRTLRLTGSALCDFAAGE  59



>ref|NP_001169630.1| hypothetical protein [Zea mays]
 gb|ACN34343.1| unknown [Zea mays]
 tpg|DAA54627.1| TPA: hypothetical protein ZEAMMB73_367183 [Zea mays]
Length=783

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+ EE V RC+ERK  M +AVA+RN FAAAH+ Y V LK+TG AL D+A+GEA
Sbjct  1    MGCGQSKIDQEEAVFRCRERKRLMADAVASRNGFAAAHTGYTVRLKSTGGALSDFAQGEA  60



>dbj|BAJ94711.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=804

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+ EE V RC++RK  M +AV ARNAFAAAHS+Y + LK+TG AL D+A GEA
Sbjct  1    MGCAQSKIDQEEAVCRCRDRKRLMADAVQARNAFAAAHSAYTILLKSTGGALSDFAHGEA  60



>emb|CDM82883.1| unnamed protein product [Triticum aestivum]
Length=797

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+ EE V RC++RK  M +AV ARNAFAAAHS+Y V LK+TG AL D+A GEA
Sbjct  1    MGCAQSKIDQEEAVCRCRDRKRLMADAVQARNAFAAAHSAYTVLLKSTGGALSDFAHGEA  60



>ref|XP_002986032.1| hypothetical protein SELMODRAFT_425043 [Selaginella moellendorffii]
 gb|EFJ12851.1| hypothetical protein SELMODRAFT_425043 [Selaginella moellendorffii]
Length=807

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NEE VARCK RK FMK AVA+R+ FAA+H++Y  +LKN GAA   + E E
Sbjct  1    MGCTSSKVDNEEKVARCKARKRFMKHAVASRHQFAASHAAYVQALKNVGAAFRQFGETE  59



>ref|XP_006375135.1| hypothetical protein POPTR_0014s04670g [Populus trichocarpa]
 gb|ERP52932.1| hypothetical protein POPTR_0014s04670g [Populus trichocarpa]
Length=786

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAH+ Y  SL+ TG+AL ++A GE+
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHLAAAHADYCRSLRVTGSALSNFAAGES  60



>ref|XP_004969399.1| PREDICTED: uncharacterized protein LOC101757723 isoform X1 [Setaria 
italica]
 ref|XP_004969400.1| PREDICTED: uncharacterized protein LOC101757723 isoform X2 [Setaria 
italica]
Length=732

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC+ SK++NEE V RCK+R+  MK+ V  R   AAAH +Y  +L+NTGA L D+AE E+
Sbjct  1    MGCSNSKVDNEEPVRRCKDRRQLMKQLVRRRPELAAAHIAYLHALRNTGATLRDFAELES  60



>ref|NP_001043426.1| Os01g0585600 [Oryza sativa Japonica Group]
 dbj|BAF05340.1| Os01g0585600 [Oryza sativa Japonica Group]
 dbj|BAG89301.1| unnamed protein product [Oryza sativa Japonica Group]
Length=685

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK+E+EE V RCK+R+  MK+ +  R   AAA ++Y  SL+NTGA L  +AE E+
Sbjct  1    MGCTHSKVEDEEAVRRCKDRRKLMKQLMRRRVELAAAQTAYLQSLRNTGATLRQFAEVES  60



>gb|EEE54881.1| hypothetical protein OsJ_02382 [Oryza sativa Japonica Group]
Length=687

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK+E+EE V RCK+R+  MK+ +  R   AAA ++Y  SL+NTGA L  +AE E+
Sbjct  1    MGCTHSKVEDEEAVRRCKDRRKLMKQLMRRRVELAAAQTAYLQSLRNTGATLRQFAEVES  60



>ref|XP_011032057.1| PREDICTED: uncharacterized protein LOC105131006 [Populus euphratica]
Length=790

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE+
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHLAAAHADYCRSLRVTGSALSSFAAGES  60



>ref|XP_004968820.1| PREDICTED: uncharacterized protein LOC101757982 [Setaria italica]
Length=791

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI+ EE V RC++RK  M +AV ARNAFAAAH+ Y V LK+TG AL D+A GEA
Sbjct  1    MGCGQSKIDQEEAVCRCRDRKRLMADAVVARNAFAAAHTGYTVRLKSTGGALSDFAHGEA  60



>ref|XP_001760149.1| predicted protein [Physcomitrella patens]
 gb|EDQ74905.1| predicted protein [Physcomitrella patens]
Length=594

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+ SK++NE+ VARCK+RK  MK+ + +R+ FAA+H+ +  SLK  G+A   +AEGE
Sbjct  1    MGCSNSKVDNEDAVARCKQRKQLMKKTILSRHNFAASHAQFVSSLKGVGSAFRQFAEGE  59



>ref|XP_010258777.1| PREDICTED: uncharacterized protein LOC104598423 [Nelumbo nucifera]
Length=771

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAHS Y  SL+ TG+AL ++A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHLAAAHSDYLRSLRLTGSALVEFAAGE  59



>gb|KJB24879.1| hypothetical protein B456_004G165900 [Gossypium raimondii]
Length=615

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+ SK++NE+TV RCK+R+ FMKEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCSASKLDNEDTVRRCKDRRRFMKEAVNARHHLAAAHADYCRSLRVTGSALSSFATGE  59



>ref|XP_010919721.1| PREDICTED: uncharacterized protein LOC105043738 [Elaeis guineensis]
Length=759

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT S+++NE+TV RCKER+  MKEAV +R+  A+AHS Y  SL+ TG+AL  +A+GE
Sbjct  1    MGCTASRLDNEDTVRRCKERRRLMKEAVDSRHHLASAHSEYLNSLRLTGSALTRFAQGE  59



>gb|KJB24877.1| hypothetical protein B456_004G165900 [Gossypium raimondii]
 gb|KJB24878.1| hypothetical protein B456_004G165900 [Gossypium raimondii]
Length=813

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+ SK++NE+TV RCK+R+ FMKEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCSASKLDNEDTVRRCKDRRRFMKEAVNARHHLAAAHADYCRSLRVTGSALSSFATGE  59



>gb|EYU31893.1| hypothetical protein MIMGU_mgv1a0019611mg, partial [Erythranthe 
guttata]
Length=92

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAHS Y  SL+ TG+A   +A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRHLMKEAVFARHHLAAAHSDYCRSLRITGSAHVTFASGE  59



>ref|XP_009796082.1| PREDICTED: uncharacterized protein LOC104242706 [Nicotiana sylvestris]
Length=852

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  A+AHS Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHLASAHSDYCRSLRITGSALSTFAAGE  59



>ref|XP_009624469.1| PREDICTED: uncharacterized protein LOC104115517 [Nicotiana tomentosiformis]
Length=854

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  A+AHS Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHLASAHSDYCRSLRITGSALSTFAAGE  59



>ref|XP_006587779.1| PREDICTED: uncharacterized protein LOC778134 [Glycine max]
Length=768

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK+ENE+TV RCKER+  MKEAV  R+  AAAHS Y  SL+ TG+AL  ++ GE
Sbjct  1    MGCTASKLENEDTVRRCKERRRLMKEAVYVRHHLAAAHSDYCRSLRLTGSALSTFSTGE  59



>gb|EAY74707.1| hypothetical protein OsI_02600 [Oryza sativa Indica Group]
Length=713

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK+E+EE V RCK+R+  MK+ V  R   AAA ++Y  SL+NTGA L  +AE E+
Sbjct  1    MGCTHSKVEDEEAVRRCKDRRKLMKQLVRRRVELAAAQTAYLQSLRNTGATLRQFAEVES  60



>ref|XP_010089322.1| hypothetical protein L484_021854 [Morus notabilis]
 gb|EXB37647.1| hypothetical protein L484_021854 [Morus notabilis]
Length=851

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+ FMKEAV AR+  AAAH+ Y  SL+ TGAAL  ++  E
Sbjct  1    MGCTASKLDNEDTVRRCKERRRFMKEAVQARHHLAAAHADYCRSLRLTGAALSSFSSFE  59



>gb|EEC70709.1| hypothetical protein OsI_02082 [Oryza sativa Indica Group]
Length=797

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKI+ EE V RC++R+  M +AV ARNAFAAAHS+Y V LK+TG AL D+A+GE
Sbjct  1    MGCGQSKIDQEEAVCRCRDRRKLMADAVQARNAFAAAHSAYTVLLKSTGGALSDFAQGE  59



>ref|XP_006644314.1| PREDICTED: uncharacterized protein LOC102718120 [Oryza brachyantha]
Length=686

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK+E+EE V RCK+R+  MK+ V  R   AAAH++Y  SL+NTGA L  +AE E+
Sbjct  1    MGCTHSKVEDEEAVRRCKDRRRLMKQLVRRRVDLAAAHTAYLQSLRNTGATLRQFAEVES  60



>ref|NP_001172370.1| Os01g0500550 [Oryza sativa Japonica Group]
 dbj|BAD73247.1| bZIP protein-like [Oryza sativa Japonica Group]
 gb|EEE54643.1| hypothetical protein OsJ_01915 [Oryza sativa Japonica Group]
 dbj|BAH91100.1| Os01g0500550 [Oryza sativa Japonica Group]
Length=752

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QSKI+ EE V RC++R+  M +AV ARNAFAAAHS+Y V LK+TG AL D+A+GE
Sbjct  1    MGCGQSKIDQEEAVCRCRDRRKLMADAVQARNAFAAAHSAYTVLLKSTGGALSDFAQGE  59



>ref|XP_007139641.1| hypothetical protein PHAVU_008G046800g [Phaseolus vulgaris]
 gb|ESW11635.1| hypothetical protein PHAVU_008G046800g [Phaseolus vulgaris]
Length=818

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK+ENE+TV RCK+R+  MK+AV AR+  AAAHS Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASKLENEDTVRRCKDRRRLMKDAVYARHQLAAAHSDYCRSLRLTGSALSTFAAGE  59



>ref|XP_001762208.1| predicted protein [Physcomitrella patens]
 gb|EDQ73000.1| predicted protein [Physcomitrella patens]
Length=685

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC  SK++NEE VARC +RK  MK+ VA+R+  AA+H+ + VSLK  G+A   +AEGE 
Sbjct  1    MGCANSKVDNEEGVARCNQRKRLMKQTVASRHNLAASHAQFVVSLKGVGSAFRQFAEGEV  60

Query  346  Q  348
            +
Sbjct  61   K  61



>ref|XP_002511585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50254.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVHARHHLAAAHADYCRSLRVTGSALCSFAAGE  59



>ref|XP_002273471.2| PREDICTED: uncharacterized protein LOC100266818 [Vitis vinifera]
Length=845

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+ V RCKER+  MKEAV AR+  AAAH+ Y  SL+ TG+AL ++A GE
Sbjct  1    MGCTASKLDNEDAVRRCKERRRLMKEAVYARHHLAAAHADYCRSLRITGSALSEFAAGE  59



>gb|KEH17841.1| BZIP transcription factor bZIP80, putative [Medicago truncatula]
Length=723

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NEETV RCKER+  MKEA+ AR+  AAAHS Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTVSKLDNEETVRRCKERRRLMKEALYARHYLAAAHSDYCNSLRLTGSALSTFAAGE  59



>ref|XP_002301229.1| hypothetical protein POPTR_0002s13850g [Populus trichocarpa]
 gb|EEE80502.1| hypothetical protein POPTR_0002s13850g [Populus trichocarpa]
Length=767

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK++NE+TV RCKER+  MKEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE+
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMKEAVYARHHLAAAHADYCHSLRVTGSALCAFAAGES  60



>ref|XP_009612588.1| PREDICTED: uncharacterized protein LOC104105875 [Nicotiana tomentosiformis]
Length=631

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  S++E EE V+RCK RK +MK+ V +R AF+A+HS Y  SL+NTG+AL  +A GE
Sbjct  1    MGCWYSRLEREELVSRCKARKRYMKQLVKSRQAFSASHSMYLRSLRNTGSALLQFATGE  59



>ref|XP_004506851.1| PREDICTED: uncharacterized protein LOC101489547 [Cicer arietinum]
Length=568

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAE-GE  342
            MGC +SK+EN+ET++  K+R  FMK+ V  RN FA+AHSSYA SLKNTGAAL D+A+ GE
Sbjct  1    MGCYESKMENQETISNSKDRNYFMKQTVTFRNNFASAHSSYAASLKNTGAALIDFAQAGE  60

Query  343  AQ  348
             Q
Sbjct  61   HQ  62



>ref|XP_003567735.1| PREDICTED: uncharacterized protein LOC100824905 [Brachypodium 
distachyon]
Length=796

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSKI  EE V RC++RK  M +AV ARNAFAAAHS+Y V LK+TG AL D+A GE+
Sbjct  1    MGCGQSKISQEEAVCRCRDRKRLMGDAVQARNAFAAAHSTYTVLLKSTGGALSDFAHGES  60



>gb|EPS68751.1| hypothetical protein M569_06016 [Genlisea aurea]
Length=816

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+ SK+ NE+TV RCKER+  MKEAV ARN  ++AH+ Y  SL+ TGAAL  +A GE
Sbjct  1    MGCSNSKLGNEDTVRRCKERRRLMKEAVCARNHLSSAHAEYCRSLRATGAALVTFASGE  59



>ref|XP_009796808.1| PREDICTED: uncharacterized protein LOC104243329 [Nicotiana sylvestris]
Length=628

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  S++E EE V+RCK RK +MK+ V +R AF+A+HS Y  SL+NTG+AL  +A GE
Sbjct  1    MGCWYSRLEREELVSRCKARKRYMKQLVKSRQAFSASHSMYLRSLRNTGSALLQFATGE  59



>ref|XP_001762329.1| predicted protein [Physcomitrella patens]
 gb|EDQ72796.1| predicted protein, partial [Physcomitrella patens]
Length=597

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC  SKI+NEE ++RCK+RK  MK+ VA+R+ FAA+H+ + VSLK  G+A   +AEGE 
Sbjct  1    MGCNNSKIDNEEGLSRCKQRKHLMKQIVASRHNFAASHAMFVVSLKGVGSAFRQFAEGEV  60

Query  346  Q  348
            +
Sbjct  61   K  61



>ref|XP_010228227.1| PREDICTED: formin-like protein 5 [Brachypodium distachyon]
Length=741

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QSK + E  VARC+ERK  ++ AV AR A + AH+ +A +L+N GAAL DYA GEA
Sbjct  1    MGCGQSKEDAEGAVARCRERKHLLRAAVEARYALSGAHAGHAAALRNVGAALSDYATGEA  60



>ref|XP_006340943.1| PREDICTED: uncharacterized protein LOC102600978 [Solanum tuberosum]
Length=591

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC  S++E EE V+RCK RK +MK+ V +R AF+A+HS Y  SL+NTG+AL  +A GE 
Sbjct  1    MGCWYSRLEREELVSRCKARKRYMKQLVKSRQAFSASHSMYLRSLRNTGSALLQFATGET  60

Query  346  QF  351
              
Sbjct  61   DL  62



>ref|XP_010692050.1| PREDICTED: uncharacterized protein LOC104905271 [Beta vulgaris 
subsp. vulgaris]
Length=813

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCKER+  +K+AV AR+  AAAH+ Y  SL+ TG AL D+A G+
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLIKDAVFARHHLAAAHADYCRSLRITGVALSDFAAGQ  59



>ref|XP_010316432.1| PREDICTED: uncharacterized protein LOC101264882 [Solanum lycopersicum]
Length=637

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC  S++E EE V+RCK RK +MK+ V +R AF+A+HS Y  SL+NTG+AL  +A GE 
Sbjct  1    MGCWYSRLEREELVSRCKARKRYMKQLVKSRQAFSASHSMYLRSLRNTGSALLQFATGET  60

Query  346  QF  351
              
Sbjct  61   DL  62



>ref|XP_004515356.1| PREDICTED: uncharacterized protein LOC101490151 [Cicer arietinum]
Length=739

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NEETV RCKER  FMK+AV AR+  AAAHS Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTVSKLDNEETVRRCKERCRFMKDAVYARHHLAAAHSDYCDSLRLTGSALCAFAAGE  59



>gb|KDP28858.1| hypothetical protein JCGZ_14629 [Jatropha curcas]
Length=810

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK++NE+TV RCKER+  +KEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE+
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLIKEAVYARHHLAAAHADYCRSLRITGSALCSFAAGES  60



>ref|XP_006591544.1| PREDICTED: uncharacterized protein LOC100808077 [Glycine max]
Length=483

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  SKIE EETV+RCK RK +MK+ V AR+AF+AAH  Y  SL+ TG+AL  +A  E
Sbjct  1    MGCCHSKIEREETVSRCKARKRYMKQFVQARHAFSAAHVMYIRSLRATGSALFQFANAE  59



>gb|KEH23438.1| BZIP transcription factor bZIP80 [Medicago truncatula]
Length=843

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  SK+ENE+TV RCK+R+  MKEAV AR+  AAAHS Y  SL+ TG AL  +A GE
Sbjct  1    MGCAASKLENEDTVRRCKDRRRLMKEAVYARHHLAAAHSDYCRSLRLTGTALSTFASGE  59



>ref|XP_004492935.1| PREDICTED: uncharacterized protein LOC101510124 [Cicer arietinum]
Length=859

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK+ENE+TV RCK+R+  MKEAV AR+  AAAHS Y  SL+ TG AL  +A GE
Sbjct  1    MGCTASKLENEDTVRRCKDRRRLMKEAVYARHHLAAAHSDYCRSLRLTGTALSTFASGE  59



>ref|XP_006573547.1| PREDICTED: uncharacterized protein LOC102662030 [Glycine max]
Length=625

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  SKIE EETV+RCK RK +MK+ V AR+AF+AAH  Y  SL+ TG+AL  +A  E
Sbjct  1    MGCCHSKIEREETVSRCKARKRYMKQFVQARHAFSAAHVMYIRSLRATGSALFQFANAE  59



>gb|KHG20396.1| Ferric uptake regulation [Gossypium arboreum]
 gb|KHG24748.1| Ferric uptake regulation [Gossypium arboreum]
Length=834

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NEE V RCK+R+  MKEAV AR+  A+AH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASKLDNEEIVRRCKDRRRLMKEAVHARHHLASAHADYCRSLRVTGSALASFAAGE  59



>gb|AES65231.2| DUF630 family protein [Medicago truncatula]
Length=898

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+QSK+++EE+V  CK+RK F+K+AV  R  FA  H +Y  S+K   AAL DY EG+
Sbjct  1    MGCSQSKLDDEESVQLCKDRKRFIKQAVEQRTRFATGHIAYIESMKRVSAALRDYIEGD  59



>gb|EAY79532.1| hypothetical protein OsI_34661 [Oryza sativa Indica Group]
Length=767

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEG  339
            MGCT SK+E E+TV RCKER+  MKEAVA+R   A+AH+ Y  SL+ T AAL  +A+G
Sbjct  1    MGCTASKVEQEDTVRRCKERRRHMKEAVASRQQLASAHADYLRSLRLTAAALSRFAQG  58



>gb|KEH37419.1| DUF630 family protein [Medicago truncatula]
Length=927

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+QSK+++EE+V  CK+RK F+K+AV  R  FA  H +Y  S+K   AAL DY EG+
Sbjct  1    MGCSQSKLDDEESVQLCKDRKRFIKQAVEQRTRFATGHIAYIESMKRVSAALRDYIEGD  59



>ref|XP_003594980.1| BZIP transcription factor bZIP82 [Medicago truncatula]
Length=956

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+QSK+++EE+V  CK+RK F+K+AV  R  FA  H +Y  S+K   AAL DY EG+
Sbjct  1    MGCSQSKLDDEESVQLCKDRKRFIKQAVEQRTRFATGHIAYIESMKRVSAALRDYIEGD  59



>ref|NP_001065395.1| Os10g0562700 [Oryza sativa Japonica Group]
 gb|AAK31266.1|AC079890_2 putative leucine zipper protein [Oryza sativa Japonica Group]
 gb|AAK01315.2| bZIP [Oryza sativa Indica Group]
 gb|AAK13058.1| bZIP protein [Oryza sativa]
 gb|AAP55028.1| bZIP, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27232.1| Os10g0562700 [Oryza sativa Japonica Group]
 gb|EAZ16987.1| hypothetical protein OsJ_32472 [Oryza sativa Japonica Group]
 dbj|BAH01606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=767

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEG  339
            MGCT SK+E E+TV RCKER+  MKEAVA+R   A+AH+ Y  SL+ T AAL  +A+G
Sbjct  1    MGCTASKVEQEDTVRRCKERRRHMKEAVASRQQLASAHADYLRSLRLTAAALSRFAQG  58



>ref|XP_010941314.1| PREDICTED: uncharacterized protein LOC105059637 [Elaeis guineensis]
Length=640

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC QS++E EE VARCK R+ +MK  VA R AFAA HS Y  SL++TGAAL  +A  EA
Sbjct  1    MGCCQSRLEREEVVARCKARRRYMKHLVAERQAFAAFHSLYLRSLRSTGAALLQFANAEA  60

Query  346  QF  351
              
Sbjct  61   HL  62



>gb|KHN22673.1| hypothetical protein glysoja_027561 [Glycine soja]
Length=749

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+QSK+++EE V  CK+RK F+K+AV  R  FA  H++Y  SLK   AAL DY EG+
Sbjct  1    MGCSQSKLDDEEAVKLCKDRKRFIKQAVEQRTQFATGHAAYIQSLKRVSAALLDYLEGD  59



>ref|XP_003543739.1| PREDICTED: uncharacterized protein LOC100818631 isoform X1 [Glycine 
max]
 ref|XP_006593525.1| PREDICTED: uncharacterized protein LOC100818631 isoform X2 [Glycine 
max]
Length=749

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+QSK+++EE V  CK+RK F+K+AV  R  FA  H++Y  SLK   AAL DY EG+
Sbjct  1    MGCSQSKLDDEEAVKLCKDRKRFIKQAVEQRTQFATGHAAYIQSLKRVSAALLDYLEGD  59



>gb|KJB22870.1| hypothetical protein B456_004G070400 [Gossypium raimondii]
Length=820

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NEE V RCK+R+  MKEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASKLDNEEIVRRCKDRRRLMKEAVHARHHLAAAHADYCRSLRVTGSALASFAAGE  59



>ref|XP_009383946.1| PREDICTED: uncharacterized protein LOC103971612 [Musa acuminata 
subsp. malaccensis]
Length=772

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT S++ENE+ V RCKER+  MKEAV +R+  A+AH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASRLENEDCVRRCKERRRLMKEAVCSRHHLASAHADYLRSLRLTGSALASFAVGE  59



>ref|XP_007134473.1| hypothetical protein PHAVU_010G050100g [Phaseolus vulgaris]
 gb|ESW06467.1| hypothetical protein PHAVU_010G050100g [Phaseolus vulgaris]
Length=810

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NEETV RCKER   MK+AV AR+  AAAHS Y   L+ TG+AL+++A  E
Sbjct  1    MGCTASKLDNEETVMRCKERHRLMKDAVYARHHLAAAHSDYCHCLRLTGSALYNFAAAE  59



>ref|XP_011017344.1| PREDICTED: protein virilizer homolog [Populus euphratica]
Length=784

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGCT SK++NE+TV RCKER+  M+EAV AR   AAAH+ Y  SL+ TG+AL  +A GE+
Sbjct  1    MGCTASKLDNEDTVRRCKERRRLMQEAVYARYHLAAAHADYCHSLRVTGSALCAFAAGES  60



>ref|XP_009393120.1| PREDICTED: uncharacterized protein LOC103978894 [Musa acuminata 
subsp. malaccensis]
Length=668

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAE  336
            MGC QS++ N+E V RCKER+ +MK AV ARNAFAAAHS+YA SLK+TGAAL ++ +
Sbjct  1    MGCAQSRVNNDEAVTRCKERRQWMKAAVVARNAFAAAHSAYAASLKDTGAALSEFGQ  57



>ref|XP_004507886.1| PREDICTED: uncharacterized protein LOC101505055 [Cicer arietinum]
Length=760

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+QS++++EE V  CK+RK F+KEAV  R  FA  H +Y  SLK   AAL DY EG+
Sbjct  1    MGCSQSRLDDEEAVKLCKDRKRFIKEAVEFRTQFATGHIAYIQSLKRVSAALLDYFEGD  59



>ref|XP_010544575.1| PREDICTED: uncharacterized protein LOC104817191 [Tarenaya hassleriana]
Length=790

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+TV RCK+R+  +KEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASKLDNEDTVRRCKDRRRLIKEAVHARHHLAAAHADYCRSLRLTGSALSSFAAGE  59



>ref|XP_010263219.1| PREDICTED: uncharacterized protein LOC104601549 [Nelumbo nucifera]
 ref|XP_010263220.1| PREDICTED: uncharacterized protein LOC104601549 [Nelumbo nucifera]
 ref|XP_010263221.1| PREDICTED: uncharacterized protein LOC104601549 [Nelumbo nucifera]
Length=765

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC+ S+++NEE V  CK+RK F+K+AV  R  FA  H +Y  SLK   AAL DY EG+
Sbjct  1    MGCSSSRLDNEEAVQLCKDRKRFIKQAVEQRIRFAYGHVAYIQSLKRVSAALRDYVEGD  59



>ref|XP_007052313.1| BZIP domain class transcription factor [Theobroma cacao]
 gb|EOX96470.1| BZIP domain class transcription factor [Theobroma cacao]
Length=823

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  SK++NE+TV RCK+R+  MKEAV AR+  AAAH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCAASKLDNEDTVRRCKDRRRLMKEAVHARHHLAAAHADYCRSLRFTGSALSSFAAGE  59



>ref|XP_004229746.1| PREDICTED: uncharacterized protein LOC101257405 [Solanum lycopersicum]
Length=853

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  SK++NE+TV RCK+R+  MKEAV AR+  AAAHS Y  SL+ TG+AL  +A GE
Sbjct  1    MGCAASKLDNEDTVRRCKDRRRLMKEAVYARHHLAAAHSDYCRSLRVTGSALSTFAAGE  59



>ref|XP_010935104.1| PREDICTED: uncharacterized protein LOC105055091 [Elaeis guineensis]
Length=565

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC QS++E EE VARCK R+ +MK  V  R AFAAAHS Y  SL++TGAAL  +A  E
Sbjct  1    MGCCQSRLEKEEAVARCKARRRYMKHLVEERQAFAAAHSLYLRSLRSTGAALLQFANAE  59



>ref|XP_008658472.1| PREDICTED: uncharacterized protein LOC100279303 isoform X1 [Zea 
mays]
 gb|AFW87852.1| hypothetical protein ZEAMMB73_997437 [Zea mays]
Length=781

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEG  339
            MGCT SK+E E+TV RCKER+  MK+AVAAR   A+AH+ Y  SL+ T AAL  +A+G
Sbjct  1    MGCTASKVEQEDTVRRCKERRRHMKDAVAARQLLASAHADYLRSLRVTAAALSRFAQG  58



>ref|XP_007157896.1| hypothetical protein PHAVU_002G106900g [Phaseolus vulgaris]
 gb|ESW29890.1| hypothetical protein PHAVU_002G106900g [Phaseolus vulgaris]
Length=646

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  S+IE EETV+RCK RK +MK+ V AR+AF+AAH+ Y  SL+ TG+AL  +A  E
Sbjct  1    MGCCHSRIEREETVSRCKARKRYMKQFVQARHAFSAAHAMYIRSLRATGSALFQFANAE  59



>ref|XP_008440843.1| PREDICTED: uncharacterized protein LOC103485147 isoform X1 [Cucumis 
melo]
Length=625

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  S++E EETV+RCK RK +MK+ V AR AF+A+HS Y  SL+ TGAAL  ++  E
Sbjct  1    MGCCYSRLEREETVSRCKARKRYMKQLVKARQAFSASHSLYIRSLRGTGAALRQFSNAE  59



>emb|CAN79228.1| hypothetical protein VITISV_011041 [Vitis vinifera]
Length=924

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++NE+ V RCKER+  MKEAV AR+  AAAH+ Y  SL+ TG+AL ++A GE
Sbjct  1    MGCTASKLDNEDAVRRCKERRRLMKEAVYARHHLAAAHADYCRSLRITGSALSEFAAGE  59



>gb|KGN48936.1| hypothetical protein Csa_6G507110 [Cucumis sativus]
Length=624

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  S++E EETV+RCK RK +MK+ V AR AF+A+HS Y  SL+ TGAAL  ++  E
Sbjct  1    MGCCYSRLEREETVSRCKARKRYMKQLVKARQAFSASHSLYIRSLRGTGAALRQFSNAE  59



>ref|XP_008440844.1| PREDICTED: uncharacterized protein LOC103485147 isoform X2 [Cucumis 
melo]
Length=624

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  S++E EETV+RCK RK +MK+ V AR AF+A+HS Y  SL+ TGAAL  ++  E
Sbjct  1    MGCCYSRLEREETVSRCKARKRYMKQLVKARQAFSASHSLYIRSLRGTGAALRQFSNAE  59



>ref|XP_004134851.1| PREDICTED: uncharacterized protein LOC101220098 [Cucumis sativus]
 ref|XP_004158857.1| PREDICTED: uncharacterized LOC101220098 [Cucumis sativus]
Length=618

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGC  S++E EETV+RCK RK +MK+ V AR AF+A+HS Y  SL+ TGAAL  ++  E
Sbjct  1    MGCCYSRLEREETVSRCKARKRYMKQLVKARQAFSASHSLYIRSLRGTGAALRQFSNAE  59



>ref|XP_002467482.1| hypothetical protein SORBIDRAFT_01g028920 [Sorghum bicolor]
 gb|EER94480.1| hypothetical protein SORBIDRAFT_01g028920 [Sorghum bicolor]
Length=785

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEG  339
            MGCT SK+E E+TV RCKER+  MK+AVAAR   A+AH+ Y  SL+ T AAL  +A+G
Sbjct  1    MGCTASKVEQEDTVRRCKERRRHMKDAVAARQLLASAHADYLRSLRVTAAALSRFAQG  58



>emb|CDY61085.1| BnaC06g41130D [Brassica napus]
Length=746

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKE  243
            MGC QSKIENEE V RCKERK FMK+
Sbjct  1    MGCAQSKIENEEAVTRCKERKQFMKD  26



>ref|XP_009411587.1| PREDICTED: uncharacterized protein LOC103993301 [Musa acuminata 
subsp. malaccensis]
Length=770

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT S++ENE+ V RCKER+  MKEAV +R+  A+AHS Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASRLENEDCVRRCKERRRLMKEAVHSRHHLASAHSDYLCSLRLTGSALTRFALGE  59



>ref|XP_010033513.1| PREDICTED: uncharacterized protein LOC104422784 [Eucalyptus grandis]
 gb|KCW53188.1| hypothetical protein EUGRSUZ_J02464 [Eucalyptus grandis]
Length=633

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC  S++E EE V+RC+ RK +MK+ V AR  F+ +H+ Y  +L++TG+AL  +A GEA
Sbjct  1    MGCCYSRVEREEMVSRCRARKRYMKQFVKARQGFSVSHAMYLRALRSTGSALLQFANGEA  60



>emb|CDY52975.1| BnaA06g01600D [Brassica napus]
Length=747

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKE  243
            MGC QSKIENEE V RCKERK FMK+
Sbjct  1    MGCAQSKIENEEAVTRCKERKQFMKD  26



>ref|XP_003569275.1| PREDICTED: uncharacterized protein LOC100827275 isoform X2 [Brachypodium 
distachyon]
Length=696

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC  SK+++EE V RC++RK  MK+ V+ R   AAAH +Y  +L+NTGA L  +AE E+
Sbjct  1    MGCRHSKVKDEEAVRRCRDRKKLMKQLVSRRVDLAAAHITYLQALRNTGATLRQFAEVES  60

Query  346  QF  351
              
Sbjct  61   AL  62



>ref|XP_010524436.1| PREDICTED: uncharacterized protein LOC104802494 [Tarenaya hassleriana]
Length=791

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK+ NE+TV RCK+R+  MKEAV AR+  AAAH+ Y  +L+ TG+AL  +A GE
Sbjct  1    MGCTVSKLGNEDTVRRCKDRRHLMKEAVHARHLLAAAHADYCRTLRLTGSALSSFAAGE  59



>ref|XP_010231954.1| PREDICTED: uncharacterized protein LOC100827275 isoform X1 [Brachypodium 
distachyon]
Length=698

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGEA  345
            MGC  SK+++EE V RC++RK  MK+ V+ R   AAAH +Y  +L+NTGA L  +AE E+
Sbjct  1    MGCRHSKVKDEEAVRRCRDRKKLMKQLVSRRVDLAAAHITYLQALRNTGATLRQFAEVES  60

Query  346  QF  351
              
Sbjct  61   AL  62



>ref|XP_004164995.1| PREDICTED: uncharacterized protein LOC101224117 [Cucumis sativus]
Length=555

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  166  MGCTQSKIENEETVARCKERKMFMKEavaarnafaaahssyavsLKNTGAALHDYAEGE  342
            MGCT SK++ E+TV RCKER+  MKEAV +R+  AAAH+ Y  SL+ TG+AL  +A GE
Sbjct  1    MGCTASKLDQEDTVRRCKERRRLMKEAVYSRHHLAAAHADYCRSLRLTGSALCAFAAGE  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250