BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038F12

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342010.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    276   9e-84   
ref|XP_006342009.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    276   1e-83   
ref|XP_009767345.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    266   5e-80   Nicotiana sylvestris
ref|NP_001265966.1|  Hop-interacting protein THI044                     263   1e-78   Solanum lycopersicum
ref|XP_010320044.1|  PREDICTED: hop-interacting protein THI044 is...    263   1e-78   Solanum lycopersicum
ref|XP_009587872.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    261   7e-78   Nicotiana tomentosiformis
gb|EYU38854.1|  hypothetical protein MIMGU_mgv1a001581mg                259   1e-77   Erythranthe guttata [common monkey flower]
gb|KJB58154.1|  hypothetical protein B456_009G196600                    242   5e-72   Gossypium raimondii
gb|KJB58153.1|  hypothetical protein B456_009G196600                    243   2e-71   Gossypium raimondii
ref|XP_002307697.1|  hypothetical protein POPTR_0005s25630g             242   3e-71   
ref|XP_006383730.1|  hypothetical protein POPTR_0005s25630g             242   3e-71   
ref|XP_007017698.1|  Chaperone DnaJ-domain superfamily protein is...    239   1e-70   
ref|XP_002262674.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    239   4e-70   Vitis vinifera
ref|XP_011045148.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    239   4e-70   Populus euphratica
ref|XP_007017697.1|  Chaperone DnaJ-domain superfamily protein is...    239   4e-70   
ref|XP_007017696.1|  Chaperone DnaJ-domain superfamily protein is...    239   7e-70   
emb|CDP07437.1|  unnamed protein product                                237   4e-69   Coffea canephora [robusta coffee]
gb|KHG01462.1|  accumulation and replication of chloroplasts 6, c...    233   6e-68   Gossypium arboreum [tree cotton]
ref|XP_011083887.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    232   9e-68   
ref|XP_006435106.1|  hypothetical protein CICLE_v100003721mg            217   2e-66   
ref|XP_007227000.1|  hypothetical protein PRUPE_ppa001578mg             229   2e-66   Prunus persica
ref|XP_010271467.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    229   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_004173365.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    214   3e-64   
gb|EPS66110.1|  hypothetical protein M569_08664                         223   5e-64   Genlisea aurea
ref|XP_008221317.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    222   6e-64   Prunus mume [ume]
emb|CDP18569.1|  unnamed protein product                                207   1e-63   Coffea canephora [robusta coffee]
ref|XP_010535306.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    219   6e-63   Tarenaya hassleriana [spider flower]
gb|KDO84753.1|  hypothetical protein CISIN_1g003752mg                   218   8e-63   Citrus sinensis [apfelsine]
ref|XP_010535302.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    219   8e-63   Tarenaya hassleriana [spider flower]
ref|XP_006473599.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    218   9e-63   Citrus sinensis [apfelsine]
ref|XP_006473598.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    218   1e-62   Citrus sinensis [apfelsine]
gb|KDO84752.1|  hypothetical protein CISIN_1g003752mg                   218   1e-62   Citrus sinensis [apfelsine]
gb|KDO84751.1|  hypothetical protein CISIN_1g003752mg                   218   1e-62   Citrus sinensis [apfelsine]
ref|XP_006473597.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    218   2e-62   Citrus sinensis [apfelsine]
gb|KDO84749.1|  hypothetical protein CISIN_1g003752mg                   218   2e-62   Citrus sinensis [apfelsine]
ref|XP_008444775.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    218   3e-62   Cucumis melo [Oriental melon]
ref|XP_004152763.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    218   3e-62   
ref|XP_002510483.1|  heat shock protein binding protein, putative       217   4e-62   Ricinus communis
ref|XP_010095543.1|  hypothetical protein L484_016017                   217   6e-62   Morus notabilis
ref|XP_009335546.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    216   8e-62   Pyrus x bretschneideri [bai li]
ref|XP_004499214.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    216   1e-61   Cicer arietinum [garbanzo]
gb|KGN62655.1|  hypothetical protein Csa_2G365130                       216   2e-61   Cucumis sativus [cucumbers]
ref|XP_004291818.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    213   1e-60   Fragaria vesca subsp. vesca
gb|KDP38591.1|  hypothetical protein JCGZ_04516                         213   1e-60   Jatropha curcas
ref|XP_010672203.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    213   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006601331.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    211   3e-60   Glycine max [soybeans]
ref|XP_006601329.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    211   4e-60   Glycine max [soybeans]
ref|XP_006601330.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    211   4e-60   
ref|XP_003549451.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    211   5e-60   Glycine max [soybeans]
ref|XP_007160698.1|  hypothetical protein PHAVU_001G009500g             211   5e-60   Phaseolus vulgaris [French bean]
ref|XP_010484901.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    203   6e-60   
ref|XP_008388150.1|  PREDICTED: LOW QUALITY PROTEIN: protein ACCU...    211   8e-60   
emb|CAN78894.1|  hypothetical protein VITISV_009566                     209   4e-59   Vitis vinifera
ref|XP_003545049.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    208   8e-59   Glycine max [soybeans]
ref|XP_006596571.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    207   8e-59   Glycine max [soybeans]
gb|AAQ18644.1|  truncated division protein                              199   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KCW67921.1|  hypothetical protein EUGRSUZ_F01622                     206   2e-58   Eucalyptus grandis [rose gum]
ref|XP_010061021.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    207   3e-58   Eucalyptus grandis [rose gum]
ref|NP_199063.1|  protein accumulation and replication of chlorop...    203   7e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY61131.1|  BnaCnng37370D                                          202   1e-56   Brassica napus [oilseed rape]
gb|KFK32921.1|  hypothetical protein AALP_AA6G306600                    201   3e-56   Arabis alpina [alpine rockcress]
gb|AAQ18646.1|  division protein                                        201   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ18645.1|  division protein                                        201   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006854866.1|  hypothetical protein AMTR_s00182p00037730          199   1e-55   Amborella trichopoda
ref|XP_006403373.1|  hypothetical protein EUTSA_v10003151mg             197   6e-55   Eutrema salsugineum [saltwater cress]
ref|XP_006403374.1|  hypothetical protein EUTSA_v10003151mg             197   7e-55   Eutrema salsugineum [saltwater cress]
ref|XP_006280025.1|  hypothetical protein CARUB_v10025901mg             197   8e-55   
ref|XP_006280026.1|  hypothetical protein CARUB_v10025901mg             197   1e-54   Capsella rubella
ref|XP_010907355.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    197   1e-54   Elaeis guineensis
ref|XP_010907356.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    196   1e-54   Elaeis guineensis
ref|XP_008777706.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    195   2e-54   Phoenix dactylifera
ref|XP_002865514.1|  hypothetical protein ARALYDRAFT_494787             194   8e-54   
ref|XP_003589356.1|  hypothetical protein MTR_1g023310                  192   2e-53   Medicago truncatula
ref|XP_010494186.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    192   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009101846.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    190   2e-52   Brassica rapa
ref|XP_009101847.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    190   2e-52   Brassica rapa
gb|KHN12665.1|  Protein ACCUMULATION AND REPLICATION OF CHLOROPLA...    189   4e-52   Glycine soja [wild soybean]
gb|AIU49242.1|  ARC6                                                    179   4e-49   Eucalyptus grandis [rose gum]
gb|AIU49259.1|  ARC6                                                    177   1e-48   Populus trichocarpa [western balsam poplar]
gb|AIU49256.1|  ARC6                                                    175   8e-48   Erythranthe guttata [common monkey flower]
gb|AIU49258.1|  ARC6                                                    173   5e-47   Solanum tuberosum [potatoes]
gb|AIU49260.1|  ARC6                                                    172   8e-47   Prunus persica
ref|XP_009393636.1|  PREDICTED: LOW QUALITY PROTEIN: protein ACCU...    174   1e-46   
gb|AIU49271.1|  ARC6                                                    172   1e-46   Vitis vinifera
gb|AIU49268.1|  ARC6                                                    172   1e-46   Solanum lycopersicum
gb|AIU49234.1|  ARC6                                                    172   2e-46   Theobroma cacao [chocolate]
gb|AIU49238.1|  ARC6                                                    171   3e-46   Gossypium raimondii
gb|AIU49237.1|  ARC6                                                    167   4e-45   Citrus clementina [clementine]
gb|AIU49243.1|  ARC6                                                    167   6e-45   Glycine max [soybeans]
gb|AIU49241.1|  ARC6                                                    167   9e-45   Citrus sinensis [apfelsine]
gb|AIU49247.1|  ARC6                                                    166   2e-44   Chloranthus japonicus
gb|AIU49236.1|  ARC6                                                    166   2e-44   Sarcandra glabra
ref|XP_004952074.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    167   2e-44   Setaria italica
ref|XP_002453221.1|  hypothetical protein SORBIDRAFT_04g001860          167   3e-44   Sorghum bicolor [broomcorn]
gb|AIU49272.1|  ARC6                                                    166   3e-44   Lactuca sativa [cultivated lettuce]
gb|AIU49280.1|  ARC6                                                    164   7e-44   Trachycarpus fortunei
gb|AIU49264.1|  ARC6                                                    164   8e-44   Ricinus communis
gb|AIU49245.1|  ARC6                                                    164   1e-43   Buxus sinica
ref|NP_001148117.1|  LOC100281725                                       166   1e-43   Zea mays [maize]
gb|AIU49239.1|  ARC6                                                    164   1e-43   Carica papaya [mamon]
gb|AIU49262.1|  ARC6                                                    164   1e-43   Phaseolus vulgaris [French bean]
gb|AIU49277.1|  ARC6                                                    164   1e-43   Houttuynia cordata [chameleon-plant]
gb|AIU49253.1|  ARC6                                                    163   2e-43   Medicago truncatula
gb|AIU49275.1|  ARC6                                                    162   4e-43   Platanus x hispanica [London plane tree]
gb|AIU49228.1|  ARC6                                                    160   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AIU49232.1|  ARC6                                                    151   3e-42   Pinellia ternata
gb|AIU49255.1|  ARC6                                                    159   5e-42   Manihot esculenta [manioc]
gb|AIU49240.1|  ARC6                                                    159   5e-42   Capsella rubella
gb|AIU49230.1|  ARC6                                                    159   6e-42   Magnolia denudata [haku-mokuren]
gb|AIU49226.1|  ARC6                                                    158   1e-41   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU49227.1|  ARC6                                                    158   1e-41   Arabidopsis lyrata [lyrate rockcress]
gb|AIU49244.1|  ARC6                                                    158   1e-41   Illicium henryi
gb|AIU49231.1|  ARC6                                                    157   4e-41   Musa acuminata [banana]
ref|XP_003573630.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    158   6e-41   Brachypodium distachyon [annual false brome]
gb|AIU49274.1|  ARC6                                                    156   7e-41   Cinnamomum camphora
gb|AIU49270.1|  ARC6                                                    155   1e-40   Schrenkiella parvula
gb|AIU49251.1|  ARC6                                                    155   1e-40   Asparagus officinalis
gb|AIU49254.1|  ARC6                                                    155   1e-40   Canna indica [canna]
gb|EEC72377.1|  hypothetical protein OsI_05646                          157   2e-40   Oryza sativa Indica Group [Indian rice]
gb|AIU49265.1|  ARC6                                                    154   4e-40   Dioscorea oppositifolia
gb|AIU49252.1|  ARC6                                                    152   4e-40   Aristolochia tagala
gb|AIU49266.1|  ARC6                                                    153   7e-40   Yucca filamentosa [Adam's-needle]
dbj|BAJ84942.1|  predicted protein                                      154   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU49279.1|  ARC6                                                    153   1e-39   Alisma plantago-aquatica
gb|AIU49249.1|  ARC6                                                    152   1e-39   Chimonanthus praecox [wintersweet]
gb|AIU49246.1|  ARC6                                                    150   1e-38   Iris japonica
gb|AIU49235.1|  ARC6                                                    149   2e-38   Acorus calamus [flagroot]
gb|AIU49250.1|  ARC6                                                    147   2e-37   Pandanus utilis
gb|AIU49248.1|  ARC6                                                    146   3e-37   Ceratophyllum demersum [hornwort]
gb|AIU49276.1|  ARC6                                                    141   2e-35   Ginkgo biloba [ginkgo]
gb|AIU49261.1|  ARC6                                                    140   2e-35   Panicum virgatum
gb|AIU49267.1|  ARC6                                                    139   9e-35   Setaria italica
gb|AIU49269.1|  ARC6                                                    138   2e-34   Sorghum bicolor [broomcorn]
gb|AIU49278.1|  ARC6                                                    137   3e-34   Zea mays [maize]
ref|XP_002993317.1|  hypothetical protein SELMODRAFT_136906             138   4e-34   
ref|XP_002970022.1|  hypothetical protein SELMODRAFT_92361              137   6e-34   
tpg|DAA01472.1|  TPA: plastid division protein precursor                137   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_001778770.1|  predicted protein                                  132   9e-32   
gb|AIU49233.1|  ARC6                                                    129   4e-31   Brachypodium distachyon [annual false brome]
gb|EMT09082.1|  hypothetical protein F775_15576                         123   5e-29   
gb|AIU49229.1|  ARC6                                                    117   8e-27   Lilium brownii [Hong Kong lily]
gb|AIU49281.1|  ARC6                                                    100   2e-21   Cabomba caroliniana
gb|EMS50085.1|  hypothetical protein TRIUR3_08207                     98.6    5e-20   Triticum urartu
ref|XP_001775455.1|  predicted protein                                89.0    9e-17   
ref|XP_001690917.1|  ARC6-like protein                                76.3    1e-12   Chlamydomonas reinhardtii
ref|XP_002948207.1|  molecular chaperone                              74.7    5e-12   Volvox carteri f. nagariensis
ref|WP_015138840.1|  DnaJ-class molecular chaperone with C-termin...  73.6    1e-11   Nostoc sp. PCC 7524
ref|WP_040934288.1|  molecular chaperone DnaJ                         67.8    3e-10   
ref|XP_005850325.1|  hypothetical protein CHLNCDRAFT_50630            68.9    5e-10   Chlorella variabilis
ref|WP_040934251.1|  hypothetical protein                             68.6    5e-10   
ref|WP_010996860.1|  molecular chaperone DnaJ                         68.6    6e-10   Nostocaceae
ref|WP_012411828.1|  molecular chaperone DnaJ                         68.6    6e-10   Nostoc punctiforme
emb|CDN10095.1|  Cell division protein ZipN/Ftn2/Arc6, specific f...  68.6    6e-10   Richelia intracellularis
ref|WP_015111182.1|  heat shock protein DnaJ domain-containing pr...  68.2    7e-10   Nostoc sp. PCC 7107
ref|WP_011320955.1|  molecular chaperone DnaJ                         68.2    8e-10   Trichormus variabilis
ref|WP_041035189.1|  molecular chaperone DnaJ                         67.8    9e-10   Tolypothrix campylonemoides
gb|KIE09218.1|  molecular chaperone DnaJ                              67.4    1e-09   Tolypothrix bouteillei VB521301
ref|WP_037216276.1|  molecular chaperone DnaJ                         67.0    1e-09   
ref|WP_011132921.1|  molecular chaperone DnaJ                         66.6    2e-09   Prochlorococcus marinus
ref|WP_026082540.1|  molecular chaperone DnaJ                         66.6    2e-09   Mastigocladopsis repens
ref|WP_026148342.1|  molecular chaperone DnaJ                         66.6    2e-09   Leptolyngbya boryana
ref|WP_015132095.1|  heat shock protein DnaJ domain-containing pr...  66.2    3e-09   Calothrix sp. PCC 7507
gb|KIY95131.1|  heat shock protein binding protein, putative          65.5    4e-09   Monoraphidium neglectum
ref|WP_017653142.1|  hypothetical protein                             65.9    4e-09   Fortiea contorta
ref|WP_035153088.1|  molecular chaperone DnaJ                         65.9    4e-09   Calothrix sp. 336/3
ref|WP_032521687.1|  molecular chaperone DnaJ                         65.5    5e-09   Prochlorococcus marinus
ref|WP_017744790.1|  hypothetical protein                             65.5    5e-09   Scytonema hofmannii
ref|WP_025951624.1|  hypothetical protein                             62.0    6e-09   
ref|WP_039752682.1|  molecular chaperone DnaJ                         65.1    6e-09   
ref|WP_025935350.1|  molecular chaperone DnaJ                         64.7    8e-09   
ref|WP_015205679.1|  DnaJ-class molecular chaperone with C-termin...  64.7    8e-09   Cylindrospermum stagnale
emb|CCH66171.1|  Cell division protein ZipN/Ftn2/Arc6, specific f...  64.3    1e-08   Richelia intracellularis HH01
gb|EFA70078.1|  Heat shock protein DnaJ-like protein                  64.3    1e-08   Cylindrospermopsis raciborskii CS-505
ref|WP_016868967.1|  molecular chaperone DnaJ                         64.3    1e-08   Fischerella muscicola
ref|WP_026732158.1|  molecular chaperone DnaJ                         64.3    1e-08   Fischerella sp. PCC 9605
ref|WP_016871253.1|  molecular chaperone DnaJ                         64.3    1e-08   Fischerella thermalis
ref|WP_015218233.1|  heat shock protein DnaJ domain-containing pr...  64.3    1e-08   Cyanobacterium aponinum
ref|WP_009756661.1|  molecular chaperone DnaJ                         64.3    1e-08   Fischerella thermalis
ref|WP_025959118.1|  molecular chaperone DnaJ                         63.9    1e-08   
ref|WP_007098532.1|  molecular chaperone DnaJ                         63.9    2e-08   Synechococcus sp. RS9916
ref|WP_032513087.1|  molecular chaperone DnaJ                         63.9    2e-08   Prochlorococcus marinus
gb|EAQ68061.1|  hypothetical protein RS9917_01961                     63.9    2e-08   Synechococcus sp. RS9917
ref|WP_025922530.1|  molecular chaperone DnaJ                         63.9    2e-08   
ref|WP_012008175.1|  molecular chaperone DnaJ                         63.5    2e-08   Prochlorococcus marinus
ref|WP_012597992.1|  molecular chaperone DnaJ                         63.5    2e-08   Cyanothece sp. PCC 7424
ref|WP_002805815.1|  molecular chaperone DnaJ                         63.5    2e-08   Prochlorococcus marinus
ref|WP_025948023.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_029635770.1|  molecular chaperone DnaJ [                       63.5    2e-08   [Scytonema hofmanni] UTEX B 1581
ref|WP_025900778.1|  MULTISPECIES: molecular chaperone DnaJ           63.5    2e-08   
ref|WP_025963882.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_025954818.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_025882076.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_025930738.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_011376929.1|  molecular chaperone DnaJ                         63.5    2e-08   Prochlorococcus marinus
ref|WP_032520255.1|  molecular chaperone DnaJ                         63.5    2e-08   Prochlorococcus marinus
ref|WP_025964428.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_025944153.1|  MULTISPECIES: molecular chaperone DnaJ           63.5    2e-08   
ref|WP_025920840.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_025891920.1|  MULTISPECIES: molecular chaperone DnaJ           63.5    2e-08   
ref|WP_025973496.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_025979959.1|  molecular chaperone DnaJ                         63.5    2e-08   
ref|WP_011818905.1|  molecular chaperone DnaJ                         63.2    2e-08   Prochlorococcus marinus
ref|WP_010873289.1|  hypothetical protein                             63.2    2e-08   Synechocystis
ref|WP_025913751.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025962584.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025945318.1|  MULTISPECIES: molecular chaperone DnaJ           63.2    3e-08   
ref|WP_025914934.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025968203.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025944857.1|  molecular chaperone DnaJ                         63.2    3e-08   Prochlorococcus
ref|WP_025937489.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025929470.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_032516397.1|  molecular chaperone DnaJ                         63.2    3e-08   Prochlorococcus marinus
ref|WP_025972416.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025957934.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_042850839.1|  molecular chaperone DnaJ                         63.2    3e-08   Prochlorococcus sp. MIT 0604
ref|WP_025924768.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025923403.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_040008779.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025975543.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025933866.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025925521.1|  MULTISPECIES: molecular chaperone DnaJ           63.2    3e-08   
ref|WP_025980809.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025956921.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025952004.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_011863402.1|  molecular chaperone DnaJ                         63.2    3e-08   Prochlorococcus marinus
ref|WP_025968806.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025964932.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025939675.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_044304252.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025934504.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025957367.1|  MULTISPECIES: molecular chaperone DnaJ           63.2    3e-08   
ref|WP_025894872.1|  molecular chaperone DnaJ                         63.2    3e-08   
ref|WP_025946263.1|  molecular chaperone DnaJ                         62.8    3e-08   
ref|WP_038545715.1|  molecular chaperone DnaJ                         62.8    3e-08   Synechococcus sp. KORDI-100
ref|WP_011820752.1|  molecular chaperone DnaJ                         62.8    4e-08   Prochlorococcus marinus
ref|WP_015199039.1|  heat shock protein DnaJ domain-containing pr...  62.8    4e-08   Calothrix parietina
ref|WP_038001523.1|  molecular chaperone DnaJ                         62.8    4e-08   Synechococcus sp. RS9917
ref|WP_032527217.1|  molecular chaperone DnaJ                         62.8    4e-08   Prochlorococcus marinus
ref|WP_015213299.1|  heat shock protein DnaJ domain protein           62.4    4e-08   Anabaena cylindrica
ref|WP_025979364.1|  molecular chaperone DnaJ                         62.4    4e-08   
ref|WP_025926855.1|  molecular chaperone DnaJ                         62.4    5e-08   
ref|WP_044452516.1|  molecular chaperone DnaJ                         62.4    5e-08   Mastigocladus laminosus
ref|WP_017312724.1|  molecular chaperone DnaJ                         62.4    5e-08   Fischerella sp. PCC 9339
ref|WP_027845444.1|  molecular chaperone DnaJ                         62.4    5e-08   Mastigocoleus testarum
ref|WP_006197353.1|  molecular chaperone DnaJ                         62.4    6e-08   Nodularia spumigena
ref|WP_041226169.1|  molecular chaperone DnaJ                         62.4    6e-08   
ref|WP_025974717.1|  molecular chaperone DnaJ                         62.0    7e-08   
gb|KIJ81316.1|  molecular chaperone DnaJ                              62.0    7e-08   Scytonema tolypothrichoides VB-61278
ref|WP_016873793.1|  hypothetical protein                             62.0    8e-08   Chlorogloeopsis fritschii
ref|WP_013191126.1|  molecular chaperone DnaJ                         61.6    8e-08   Trichormus azollae
ref|WP_016951882.1|  hypothetical protein                             61.6    8e-08   Anabaena sp. PCC 7108
ref|WP_025965831.1|  molecular chaperone DnaJ                         61.2    9e-08   
ref|WP_044492352.1|  molecular chaperone DnaJ                         61.6    1e-07   Moorea producens
ref|WP_029979563.1|  molecular chaperone DnaJ                         58.5    1e-07   
ref|WP_025975105.1|  molecular chaperone DnaJ                         61.2    1e-07   
ref|WP_025928733.1|  molecular chaperone DnaJ                         61.2    1e-07   
ref|WP_025946957.1|  molecular chaperone DnaJ                         61.2    1e-07   
ref|WP_037990789.1|  molecular chaperone DnaJ                         61.2    1e-07   Synechococcus sp. CC9616
gb|AFZ11017.1|  heat shock protein DnaJ domain protein                61.2    1e-07   Crinalium epipsammum PCC 9333
ref|WP_015188061.1|  heat shock protein DnaJ domain protein           60.8    1e-07   Gloeocapsa sp. PCC 7428
ref|WP_016860016.1|  molecular chaperone DnaJ                         60.8    1e-07   Fischerella muscicola
ref|WP_036905295.1|  cell division protein                            60.8    2e-07   Prochlorococcus marinus
ref|WP_011824265.1|  cell division protein                            60.8    2e-07   Prochlorococcus marinus
ref|WP_011294942.1|  cell division protein                            60.5    2e-07   Prochlorococcus marinus
ref|WP_032518251.1|  molecular chaperone DnaJ                         60.5    2e-07   Prochlorococcus marinus
ref|WP_012954144.1|  DnaJ-class molecular chaperone                   60.1    3e-07   
ref|WP_026720628.1|  molecular chaperone DnaJ                         60.1    3e-07   Fischerella sp. PCC 9431
ref|WP_032523209.1|  molecular chaperone DnaJ                         59.7    3e-07   
ref|WP_025969421.1|  molecular chaperone DnaJ                         60.1    3e-07   
ref|WP_032524875.1|  molecular chaperone DnaJ                         60.1    3e-07   Prochlorococcus marinus
ref|WP_036912820.1|  MULTISPECIES: molecular chaperone DnaJ           59.7    4e-07   Prochlorococcus
ref|WP_025960005.1|  molecular chaperone DnaJ                         59.3    4e-07   
gb|AFW66593.1|  hypothetical protein ZEAMMB73_835383                  59.3    4e-07   
ref|WP_011826580.1|  molecular chaperone DnaJ                         59.3    5e-07   
ref|WP_036480294.1|  hypothetical protein                             59.3    6e-07   Myxosarcina sp. GI1
gb|AHF64200.1|  hypothetical protein Syncc8109_1848                   58.9    7e-07   Synechococcus sp. WH 8109
ref|WP_011244461.1|  MULTISPECIES: cell division protein FtsA         58.5    8e-07   Synechococcus
emb|CCQ63587.1|  hypothetical protein CWATWH0401_3376                 58.5    9e-07   Crocosphaera watsonii WH 0401
ref|WP_006515270.1|  DnaJ-class molecular chaperone with C-termin...  58.2    1e-06   Leptolyngbya sp. PCC 7375
ref|WP_019477323.1|  hypothetical protein                             58.2    1e-06   
ref|WP_011363873.1|  molecular chaperone DnaJ                         58.2    1e-06   
ref|WP_011129727.1|  molecular chaperone DnaJ                         57.8    1e-06   
ref|WP_015223473.1|  heat shock protein DnaJ domain-containing pr...  57.8    1e-06   
ref|WP_036403326.1|  molecular chaperone DnaJ                         57.8    2e-06   
ref|WP_028082102.1|  molecular chaperone DnaJ                         57.8    2e-06   
ref|WP_011128483.1|  molecular chaperone DnaJ                         57.8    2e-06   
ref|WP_009546783.1|  MULTISPECIES: molecular chaperone DnaJ           57.8    2e-06   
gb|ELR96504.1|  DnaJ-class molecular chaperone with C-terminal Zn...  57.8    2e-06   
ref|WP_024970393.1|  molecular chaperone DnaJ                         57.8    2e-06   
ref|WP_016515469.1|  DnaJ domain protein                              57.4    2e-06   
ref|WP_002777145.1|  molecular chaperone DnaJ                         57.4    2e-06   
ref|WP_015172812.1|  heat shock protein DnaJ domain-containing pr...  57.4    2e-06   
gb|EHA60080.1|  hypothetical protein Syn8016DRAFT_2461                57.4    2e-06   
ref|WP_042790316.1|  molecular chaperone DnaJ                         57.4    2e-06   
ref|WP_036001765.1|  hypothetical protein                             57.4    2e-06   
emb|CAK24159.1|  DnaJ domain containing protein                       57.4    2e-06   
ref|WP_002754240.1|  molecular chaperone DnaJ                         57.4    2e-06   
ref|WP_040055044.1|  hypothetical protein                             57.4    2e-06   
emb|CCI31988.1|  Heat shock protein DnaJ-like (fragment)              57.0    2e-06   
ref|WP_012626469.1|  molecular chaperone DnaJ                         57.4    3e-06   
ref|WP_026099206.1|  hypothetical protein                             57.0    3e-06   
ref|WP_023076535.1|  class molecular chaperone with c-terminal zn...  57.0    3e-06   
ref|WP_007312512.1|  molecular chaperone DnaJ                         57.0    3e-06   
ref|WP_015116621.1|  DnaJ-class molecular chaperone with C-termin...  57.0    3e-06   
ref|WP_007307442.1|  molecular chaperone DnaJ                         57.0    3e-06   
ref|WP_034937925.1|  hypothetical protein                             57.0    3e-06   
ref|WP_021830118.1|  Cell division protein ZipN/Ftn2/Arc6, specif...  57.0    3e-06   
ref|WP_038653882.1|  cell division protein                            57.0    3e-06   
ref|WP_015153410.1|  heat shock protein DnaJ domain-containing pr...  57.0    3e-06   
ref|WP_038026700.1|  hypothetical protein                             56.6    3e-06   
gb|EFA72613.1|  Heat shock protein DnaJ-like protein                  57.0    3e-06   
ref|WP_039715562.1|  hypothetical protein                             57.0    3e-06   
ref|WP_019489773.1|  hypothetical protein                             56.6    4e-06   
ref|WP_002791575.1|  molecular chaperone DnaJ                         56.6    4e-06   
ref|WP_028947592.1|  hypothetical protein                             56.6    4e-06   
ref|WP_015182304.1|  DnaJ-class molecular chaperone with C-termin...  56.2    5e-06   
ref|WP_017319819.1|  hypothetical protein                             56.2    6e-06   
ref|WP_013321797.1|  molecular chaperone DnaJ                         56.2    6e-06   
ref|WP_011618706.1|  molecular chaperone DnaJ                         56.2    6e-06   
ref|WP_038014758.1|  molecular chaperone DnaJ                         56.2    6e-06   
ref|WP_015078573.1|  heat shock protein DnaJ domain-containing pr...  55.8    7e-06   
ref|WP_040553798.1|  molecular chaperone DnaJ                         55.8    8e-06   
ref|XP_006646807.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...  55.5    8e-06   
ref|WP_004163913.1|  molecular chaperone DnaJ                         55.5    9e-06   
ref|WP_028090990.1|  molecular chaperone DnaJ                         55.5    1e-05   
gb|EKQ71071.1|  DnaJ-class molecular chaperone with C-terminal Zn...  55.1    1e-05   
gb|KDP45812.1|  hypothetical protein JCGZ_17419                       55.1    1e-05   
ref|WP_008272482.1|  molecular chaperone DnaJ                         54.7    1e-05   
ref|WP_009789414.1|  molecular chaperone DnaJ                         54.7    2e-05   
ref|WP_036616141.1|  hypothetical protein                             54.7    2e-05   
ref|WP_006041925.1|  molecular chaperone DnaJ                         54.7    2e-05   
gb|AII47445.1|  hypothetical protein KR49_13720                       54.7    2e-05   
ref|XP_008803150.1|  PREDICTED: plastid division protein CDP1, ch...  54.7    2e-05   
ref|WP_006616379.1|  molecular chaperone DnaJ                         54.3    2e-05   
ref|WP_009631810.1|  DnaJ-class molecular chaperone with C-termin...  54.3    2e-05   
ref|WP_041428889.1|  molecular chaperone DnaJ                         54.3    2e-05   
ref|WP_012161917.1|  molecular chaperone DnaJ                         54.3    3e-05   
ref|WP_011360295.1|  molecular chaperone DnaJ                         53.9    3e-05   
ref|WP_010472857.1|  molecular chaperone DnaJ                         53.9    3e-05   
ref|WP_018398080.1|  hypothetical protein                             53.9    4e-05   
ref|WP_044106014.1|  hypothetical protein                             53.5    4e-05   
ref|WP_019476717.1|  hypothetical protein                             53.1    4e-05   
ref|WP_043697557.1|  molecular chaperone DnaJ                         53.5    4e-05   
ref|WP_004161336.1|  molecular chaperone DnaJ                         53.1    5e-05   
ref|WP_017295431.1|  hypothetical protein                             52.8    8e-05   
gb|AFY73232.1|  DnaJ-class molecular chaperone with C-terminal Zn...  52.8    8e-05   
ref|WP_039200890.1|  molecular chaperone DnaJ                         52.4    9e-05   
ref|WP_027401610.1|  molecular chaperone DnaJ                         52.4    9e-05   
ref|WP_002767801.1|  molecular chaperone DnaJ                         52.4    1e-04   
ref|WP_041429974.1|  hypothetical protein                             52.0    1e-04   
ref|WP_026032798.1|  molecular chaperone DnaJ                         52.4    1e-04   
ref|WP_036899333.1|  molecular chaperone DnaJ                         52.0    1e-04   
ref|WP_015226685.1|  heat shock protein DnaJ domain-containing pr...  52.0    1e-04   
emb|CEF97403.1|  Domain of unknown function DUF4101                   52.0    2e-04   
ref|WP_006634160.1|  molecular chaperone DnaJ                         51.6    2e-04   
ref|XP_010935545.1|  PREDICTED: plastid division protein CDP1, ch...  51.6    2e-04   
ref|WP_011430338.1|  molecular chaperone DnaJ                         51.6    2e-04   
ref|XP_010935547.1|  PREDICTED: plastid division protein CDP1, ch...  51.6    2e-04   
ref|XP_010935546.1|  PREDICTED: plastid division protein CDP1, ch...  51.6    2e-04   
ref|XP_010935548.1|  PREDICTED: plastid division protein CDP1, ch...  51.6    2e-04   
ref|WP_015178609.1|  heat shock protein DnaJ domain protein           51.6    2e-04   
ref|XP_010935544.1|  PREDICTED: plastid division protein CDP1, ch...  51.6    2e-04   
ref|WP_011433070.1|  molecular chaperone DnaJ                         51.2    2e-04   
ref|WP_004162716.1|  molecular chaperone DnaJ                         51.2    2e-04   
ref|WP_011614264.1|  heat shock protein DnaJ-like                     51.2    2e-04   
ref|WP_002761053.1|  molecular chaperone DnaJ                         51.2    2e-04   
ref|WP_011936123.1|  DnaJ domain-containing protein                   51.2    2e-04   
gb|EYU22294.1|  hypothetical protein MIMGU_mgv1a001394mg              51.2    2e-04   
ref|WP_012267063.1|  molecular chaperone DnaJ                         51.2    3e-04   
ref|WP_036918592.1|  MULTISPECIES: cell division protein              50.8    4e-04   
ref|WP_036902359.1|  cell division protein                            50.8    4e-04   
ref|WP_017717189.1|  hypothetical protein                             50.4    5e-04   
ref|WP_015160491.1|  DnaJ-class molecular chaperone with C-termin...  50.4    5e-04   
ref|XP_006847842.1|  hypothetical protein AMTR_s00029p00059460        50.1    6e-04   
ref|XP_010940349.1|  PREDICTED: plastid division protein CDP1, ch...  50.1    7e-04   
ref|WP_006911686.1|  DnaJ domain protein                              49.7    8e-04   
ref|XP_008811229.1|  PREDICTED: plastid division protein CDP1, ch...  49.7    8e-04   
ref|XP_010940348.1|  PREDICTED: plastid division protein CDP1, ch...  49.7    8e-04   
ref|WP_026079455.1|  hypothetical protein                             49.7    0.001   



>ref|XP_006342010.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X2 [Solanum tuberosum]
Length=818

 Score =   276 bits (707),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 165/209 (79%), Gaps = 14/209 (7%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ--PPNARRLHRFSAVSGGASSA-------PTTFSASKWA  211
            M+ALT L+ GIC+PRL+ P Q      ++  R +AV+GGASS        PT FSASKWA
Sbjct  1    MEALTQLSFGICTPRLSSPFQLAAAGGKKPPRLNAVNGGASSVTGGTSSLPTNFSASKWA  60

Query  212  DRLFADFQFLPSTSTPDPPDHKSTTAT-----LTPPLDILERNVSLPIDFYRVLGAEPHF  376
            DRL ADFQFLPST+T D  D +++T+T     + PP+   +R++S+PIDFYRVLGAE HF
Sbjct  61   DRLLADFQFLPSTTTSDSSDFQNSTSTTSVTTIPPPVAPSDRHISMPIDFYRVLGAEAHF  120

Query  377  LGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDT  556
            LGDGIRR Y+ARI+KPPQYGYS EALI RRQILQAACETL D +SRR+YNQGLA HEFDT
Sbjct  121  LGDGIRRCYDARITKPPQYGYSQEALIGRRQILQAACETLVDSTSRREYNQGLAQHEFDT  180

Query  557  LLTQVPWDKVPGALCVLQESGDTELVLQI  643
            +LT VPWDKVPGA+CVLQE+G+TE+VLQI
Sbjct  181  ILTPVPWDKVPGAMCVLQEAGETEVVLQI  209



>ref|XP_006342009.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X1 [Solanum tuberosum]
Length=825

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 165/209 (79%), Gaps = 14/209 (7%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ--PPNARRLHRFSAVSGGASSA-------PTTFSASKWA  211
            M+ALT L+ GIC+PRL+ P Q      ++  R +AV+GGASS        PT FSASKWA
Sbjct  1    MEALTQLSFGICTPRLSSPFQLAAAGGKKPPRLNAVNGGASSVTGGTSSLPTNFSASKWA  60

Query  212  DRLFADFQFLPSTSTPDPPDHKSTTAT-----LTPPLDILERNVSLPIDFYRVLGAEPHF  376
            DRL ADFQFLPST+T D  D +++T+T     + PP+   +R++S+PIDFYRVLGAE HF
Sbjct  61   DRLLADFQFLPSTTTSDSSDFQNSTSTTSVTTIPPPVAPSDRHISMPIDFYRVLGAEAHF  120

Query  377  LGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDT  556
            LGDGIRR Y+ARI+KPPQYGYS EALI RRQILQAACETL D +SRR+YNQGLA HEFDT
Sbjct  121  LGDGIRRCYDARITKPPQYGYSQEALIGRRQILQAACETLVDSTSRREYNQGLAQHEFDT  180

Query  557  LLTQVPWDKVPGALCVLQESGDTELVLQI  643
            +LT VPWDKVPGA+CVLQE+G+TE+VLQI
Sbjct  181  ILTPVPWDKVPGAMCVLQEAGETEVVLQI  209



>ref|XP_009767345.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Nicotiana sylvestris]
Length=816

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 165/211 (78%), Gaps = 16/211 (8%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNAR----RLHRF----SAVSGGASSAPTTFSASKWAD  214
            M+ALTHL+ GIC+PRL+PP Q P A     RL+      S+V+GGASS PT FSASKWAD
Sbjct  1    MEALTHLSFGICTPRLSPPFQLPAAGKKPLRLNAVTGGASSVTGGASSVPTNFSASKWAD  60

Query  215  RLFADFQFLPSTSTP--------DPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEP  370
            RL ADFQFLPST+T         +     +T  TL P     +R++S+PIDFYRVLGAE 
Sbjct  61   RLLADFQFLPSTTTSTSDSPDFLNSTSSTATATTLPPLSPPPDRHISMPIDFYRVLGAES  120

Query  371  HFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEF  550
            HFLGDGIRRAY+ARI+KPPQYGY+ EALI RRQILQAACETLAD +SRR+YNQGLA HEF
Sbjct  121  HFLGDGIRRAYDARITKPPQYGYTQEALIGRRQILQAACETLADSTSRREYNQGLAQHEF  180

Query  551  DTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            DT++T VPWDKVPGALCVLQE+G+TE+VLQI
Sbjct  181  DTIVTPVPWDKVPGALCVLQEAGETEVVLQI  211



>ref|NP_001265966.1| Hop-interacting protein THI044 [Solanum lycopersicum]
 gb|AEW69805.1| Hop-interacting protein THI044 [Solanum lycopersicum]
Length=819

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 162/213 (76%), Gaps = 21/213 (10%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ--------PPNARRLHRF----SAVSGGASSAPTTFSAS  202
            M+ALTHL+ GIC+ RL+PP Q        PP   RL+      S+V+GG SS PT FSAS
Sbjct  1    MEALTHLSFGICTARLSPPYQLAGGVGKKPP---RLNAVTGGASSVTGGTSSVPTNFSAS  57

Query  203  KWADRLFADFQFLPSTSTP------DPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGA  364
            KWADRL ADFQFLPST+T             ++  T+ PP+   +R++S+PIDFYRVLGA
Sbjct  58   KWADRLLADFQFLPSTTTTSDSSDFQNSTSTTSVTTIPPPVAPSDRHISMPIDFYRVLGA  117

Query  365  EPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANH  544
            E HFLGDGIRR Y+ARI+KPPQYGYS EALI RRQILQAACETLAD +SRR+YNQGLA H
Sbjct  118  EAHFLGDGIRRCYDARITKPPQYGYSQEALIGRRQILQAACETLADSTSRREYNQGLAQH  177

Query  545  EFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            EFDT+LT VPWDKVPGALCVLQE+G+T +VLQI
Sbjct  178  EFDTILTPVPWDKVPGALCVLQEAGETGVVLQI  210



>ref|XP_010320044.1| PREDICTED: hop-interacting protein THI044 isoform X1 [Solanum 
lycopersicum]
Length=826

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 162/213 (76%), Gaps = 21/213 (10%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ--------PPNARRLHRF----SAVSGGASSAPTTFSAS  202
            M+ALTHL+ GIC+ RL+PP Q        PP   RL+      S+V+GG SS PT FSAS
Sbjct  1    MEALTHLSFGICTARLSPPYQLAGGVGKKPP---RLNAVTGGASSVTGGTSSVPTNFSAS  57

Query  203  KWADRLFADFQFLPSTSTP------DPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGA  364
            KWADRL ADFQFLPST+T             ++  T+ PP+   +R++S+PIDFYRVLGA
Sbjct  58   KWADRLLADFQFLPSTTTTSDSSDFQNSTSTTSVTTIPPPVAPSDRHISMPIDFYRVLGA  117

Query  365  EPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANH  544
            E HFLGDGIRR Y+ARI+KPPQYGYS EALI RRQILQAACETLAD +SRR+YNQGLA H
Sbjct  118  EAHFLGDGIRRCYDARITKPPQYGYSQEALIGRRQILQAACETLADSTSRREYNQGLAQH  177

Query  545  EFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            EFDT+LT VPWDKVPGALCVLQE+G+T +VLQI
Sbjct  178  EFDTILTPVPWDKVPGALCVLQEAGETGVVLQI  210



>ref|XP_009587872.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Nicotiana tomentosiformis]
Length=817

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 163/212 (77%), Gaps = 17/212 (8%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNAR----RLHRF----SAVSGGASSAPTTFSASKWAD  214
            M+ALTHL+ GIC PRL+PP Q P A     RL+      S+V+GGASS PT FSASKWAD
Sbjct  1    MEALTHLSFGICIPRLSPPFQLPAAGKKPPRLNAVTGGASSVTGGASSVPTNFSASKWAD  60

Query  215  RLFADFQFLPSTST---------PDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAE  367
            RL ADFQFLPST+T          +     +T  TL P     +R++S+PIDFYRVL AE
Sbjct  61   RLLADFQFLPSTTTTTTSDSPDFQNSTSSTATATTLPPLSPPPDRHISMPIDFYRVLRAE  120

Query  368  PHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHE  547
             HFLGDGIRRAY+ARI+KPPQYGY+ EALI RRQILQAACETLAD +SRR+YNQGLA HE
Sbjct  121  SHFLGDGIRRAYDARITKPPQYGYTQEALIGRRQILQAACETLADSTSRREYNQGLAQHE  180

Query  548  FDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            FDT++T VPWDKVPGALCVLQE+G+TE+VLQI
Sbjct  181  FDTIVTPVPWDKVPGALCVLQEAGETEVVLQI  212



>gb|EYU38854.1| hypothetical protein MIMGU_mgv1a001581mg [Erythranthe guttata]
Length=790

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 159/198 (80%), Gaps = 15/198 (8%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARR--LHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            M+ALT L++GI +PRL   L PP A+R  +   +AVSGG     +T + SKWADRL ADF
Sbjct  1    MEALTQLSIGIYNPRL---LSPPPAKRPFIRTHAAVSGG-----STTTTSKWADRLLADF  52

Query  233  QFLPSTSTPDPPDHKSTTATLTPPL-DILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEA  409
            QFLPSTS  DP D   T+A   PPL    ER+VS+P+DFYRVLGAE HFLGDGIRRAY+A
Sbjct  53   QFLPSTS--DPSDF--TSAAAPPPLPSFPERHVSMPLDFYRVLGAESHFLGDGIRRAYDA  108

Query  410  RISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVP  589
            R+SK PQYGYS + LISRRQILQAACETLA+PSSRR+YNQGLA  EFDT+LTQVPWDKVP
Sbjct  109  RVSKQPQYGYSDDVLISRRQILQAACETLANPSSRREYNQGLAEDEFDTILTQVPWDKVP  168

Query  590  GALCVLQESGDTELVLQI  643
            GALCVLQE+G+TELVL+I
Sbjct  169  GALCVLQETGETELVLRI  186



>gb|KJB58154.1| hypothetical protein B456_009G196600 [Gossypium raimondii]
Length=655

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 151/206 (73%), Gaps = 25/206 (12%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M++L H+++G+C+P L P   PP   RLH          S     SASKWA+RL ADFQF
Sbjct  1    MESLRHISIGLCTPTLTPLFHPPKPSRLHH--------RSTTVVCSASKWAERLLADFQF  52

Query  239  LPSTSTPDPPDHKST-----TATLTPPLDIL------ERNVSLPIDFYRVLGAEPHFLGD  385
            LP+      PD+  +     TATL+PP   L      ER+VS+P+DFY+VLGAE HFLGD
Sbjct  53   LPA------PDNSVSSSSSSTATLSPPYPPLLAPSPPERHVSIPLDFYKVLGAETHFLGD  106

Query  386  GIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLT  565
            GIRRAYEAR+SKPPQYG+S + +ISRRQIL AACETL++P SRR+YNQGL + E DT++T
Sbjct  107  GIRRAYEARVSKPPQYGFSQDTIISRRQILLAACETLSNPGSRRNYNQGLVDDERDTIIT  166

Query  566  QVPWDKVPGALCVLQESGDTELVLQI  643
            QVPWDKVPGALCVLQE+G+TE+VLQI
Sbjct  167  QVPWDKVPGALCVLQEAGETEVVLQI  192



>gb|KJB58153.1| hypothetical protein B456_009G196600 [Gossypium raimondii]
Length=795

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 151/206 (73%), Gaps = 25/206 (12%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M++L H+++G+C+P L P   PP   RLH          S     SASKWA+RL ADFQF
Sbjct  1    MESLRHISIGLCTPTLTPLFHPPKPSRLHH--------RSTTVVCSASKWAERLLADFQF  52

Query  239  LPSTSTPDPPDHKST-----TATLTPPLDIL------ERNVSLPIDFYRVLGAEPHFLGD  385
            LP+      PD+  +     TATL+PP   L      ER+VS+P+DFY+VLGAE HFLGD
Sbjct  53   LPA------PDNSVSSSSSSTATLSPPYPPLLAPSPPERHVSIPLDFYKVLGAETHFLGD  106

Query  386  GIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLT  565
            GIRRAYEAR+SKPPQYG+S + +ISRRQIL AACETL++P SRR+YNQGL + E DT++T
Sbjct  107  GIRRAYEARVSKPPQYGFSQDTIISRRQILLAACETLSNPGSRRNYNQGLVDDERDTIIT  166

Query  566  QVPWDKVPGALCVLQESGDTELVLQI  643
            QVPWDKVPGALCVLQE+G+TE+VLQI
Sbjct  167  QVPWDKVPGALCVLQEAGETEVVLQI  192



>ref|XP_002307697.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
 gb|EEE94693.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
Length=768

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 152/201 (76%), Gaps = 19/201 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+AL H+ +G+C+P+L PP + P+               S   T SASKWADRL +DFQF
Sbjct  1    MEALRHVGIGLCTPKLFPPFKKPSK-------------VSTTITCSASKWADRLLSDFQF  47

Query  239  LPST--STPDPPDH--KSTTATLTPPLDIL--ERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
              ST  S+ D   H   S+TATL PP  +   ER VS+P+ FY+VLGAE HFLGDGI+RA
Sbjct  48   FTSTDTSSSDLLHHPLSSSTATLAPPPPLSPPERYVSIPLHFYQVLGAETHFLGDGIKRA  107

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            YEAR+SKPPQYG+S +AL+SRRQILQAACETLADP+SRRDYNQGL + E DT++TQVPWD
Sbjct  108  YEARVSKPPQYGFSQDALVSRRQILQAACETLADPASRRDYNQGLIDDETDTIVTQVPWD  167

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE+G+TE+VLQI
Sbjct  168  KVPGALCVLQEAGETEVVLQI  188



>ref|XP_006383730.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
 ref|XP_006383731.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
 gb|ERP61527.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
 gb|ERP61528.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
Length=785

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 152/201 (76%), Gaps = 19/201 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+AL H+ +G+C+P+L PP + P+               S   T SASKWADRL +DFQF
Sbjct  1    MEALRHVGIGLCTPKLFPPFKKPSK-------------VSTTITCSASKWADRLLSDFQF  47

Query  239  LPST--STPDPPDH--KSTTATLTPPLDIL--ERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
              ST  S+ D   H   S+TATL PP  +   ER VS+P+ FY+VLGAE HFLGDGI+RA
Sbjct  48   FTSTDTSSSDLLHHPLSSSTATLAPPPPLSPPERYVSIPLHFYQVLGAETHFLGDGIKRA  107

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            YEAR+SKPPQYG+S +AL+SRRQILQAACETLADP+SRRDYNQGL + E DT++TQVPWD
Sbjct  108  YEARVSKPPQYGFSQDALVSRRQILQAACETLADPASRRDYNQGLIDDETDTIVTQVPWD  167

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE+G+TE+VLQI
Sbjct  168  KVPGALCVLQEAGETEVVLQI  188



>ref|XP_007017698.1| Chaperone DnaJ-domain superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY14923.1| Chaperone DnaJ-domain superfamily protein isoform 3 [Theobroma 
cacao]
Length=660

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 147/200 (74%), Gaps = 12/200 (6%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M++L H+++G+C+P L P   P    RLHR SA +       T  SASKWADRL ADFQF
Sbjct  1    MESLRHISIGLCTPALTPLPHPGKPSRLHRPSATT-------TVCSASKWADRLIADFQF  53

Query  239  LPSTSTPDPPDHKSTTATLTPPLDIL-----ERNVSLPIDFYRVLGAEPHFLGDGIRRAY  403
            LP T         ST     P    L     ER VS+P+DFY+VLGAE HFLGDGI+RAY
Sbjct  54   LPPTDNSFSSSSSSTATLSPPFPPPLSPSPPERQVSIPLDFYKVLGAETHFLGDGIKRAY  113

Query  404  EARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDK  583
            EAR+SKPPQYG+S ++L+SRRQILQAACETLA+P SRR+YNQGL + E DT++TQVPWDK
Sbjct  114  EARVSKPPQYGFSQDSLLSRRQILQAACETLANPGSRRNYNQGLVDDERDTIITQVPWDK  173

Query  584  VPGALCVLQESGDTELVLQI  643
            VPGALCVLQE+G+TE+VL+I
Sbjct  174  VPGALCVLQEAGETEVVLRI  193



>ref|XP_002262674.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Vitis vinifera]
 emb|CBI37371.3| unnamed protein product [Vitis vinifera]
Length=800

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 148/200 (74%), Gaps = 7/200 (4%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAP---TTFSASKWADRLFAD  229
            M ++ HL L + +PRL PP  P N RR  +  +  G  +  P   T FSASKWADRL +D
Sbjct  1    MASMAHLRLALYTPRLVPP--PRNLRRPSKIKSQGGAPADTPGTATAFSASKWADRLLSD  58

Query  230  FQFLPSTSTPDPPDHKST--TATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAY  403
            FQFLP          +ST  T+   PPL   ER+VS+P+ FY+VLGAE HFLGDGIRRAY
Sbjct  59   FQFLPPPPATTAASDRSTELTSLPPPPLAPPERDVSIPLHFYQVLGAEAHFLGDGIRRAY  118

Query  404  EARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDK  583
            EAR+SKPPQYGYS EALISRRQILQAACETLA+P S+R+Y+QGLA  E +T++TQVPWDK
Sbjct  119  EARVSKPPQYGYSQEALISRRQILQAACETLANPRSKREYSQGLAEDEVETIITQVPWDK  178

Query  584  VPGALCVLQESGDTELVLQI  643
            VPGALCVLQE+G+ E+VL I
Sbjct  179  VPGALCVLQEAGENEIVLHI  198



>ref|XP_011045148.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Populus euphratica]
 ref|XP_011045149.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X2 [Populus euphratica]
Length=785

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 151/201 (75%), Gaps = 19/201 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+AL H+ +G+C+P+L  PL+ P+               S   T SASKWADRL +DFQF
Sbjct  1    MEALRHVGIGLCTPKLCSPLKKPSK-------------VSTKITCSASKWADRLLSDFQF  47

Query  239  LPST--STPDPPDH--KSTTATLTPPLDIL--ERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
              ST  S+ D   H   S+TATL PP  +   ER VS+P+ FY+VLGAE HFLGDGI+RA
Sbjct  48   FTSTDTSSSDVLHHPLSSSTATLAPPPPLSPPERYVSIPLHFYQVLGAETHFLGDGIKRA  107

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            YEAR+SKPPQYG+S +AL+SRRQILQAACETLADP+SRRDYNQGL + E DT++TQVPWD
Sbjct  108  YEARVSKPPQYGFSQDALVSRRQILQAACETLADPASRRDYNQGLIDDETDTIITQVPWD  167

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE+G+T +VLQI
Sbjct  168  KVPGALCVLQEAGETGVVLQI  188



>ref|XP_007017697.1| Chaperone DnaJ-domain superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY14922.1| Chaperone DnaJ-domain superfamily protein isoform 2 [Theobroma 
cacao]
Length=797

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 147/200 (74%), Gaps = 12/200 (6%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M++L H+++G+C+P L P   P    RLHR SA +       T  SASKWADRL ADFQF
Sbjct  1    MESLRHISIGLCTPALTPLPHPGKPSRLHRPSATT-------TVCSASKWADRLIADFQF  53

Query  239  LPSTSTPDPPDHKSTTATLTPPLDIL-----ERNVSLPIDFYRVLGAEPHFLGDGIRRAY  403
            LP T         ST     P    L     ER VS+P+DFY+VLGAE HFLGDGI+RAY
Sbjct  54   LPPTDNSFSSSSSSTATLSPPFPPPLSPSPPERQVSIPLDFYKVLGAETHFLGDGIKRAY  113

Query  404  EARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDK  583
            EAR+SKPPQYG+S ++L+SRRQILQAACETLA+P SRR+YNQGL + E DT++TQVPWDK
Sbjct  114  EARVSKPPQYGFSQDSLLSRRQILQAACETLANPGSRRNYNQGLVDDERDTIITQVPWDK  173

Query  584  VPGALCVLQESGDTELVLQI  643
            VPGALCVLQE+G+TE+VL+I
Sbjct  174  VPGALCVLQEAGETEVVLRI  193



>ref|XP_007017696.1| Chaperone DnaJ-domain superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY14921.1| Chaperone DnaJ-domain superfamily protein isoform 1 [Theobroma 
cacao]
Length=813

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 147/200 (74%), Gaps = 12/200 (6%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M++L H+++G+C+P L P   P    RLHR SA +       T  SASKWADRL ADFQF
Sbjct  1    MESLRHISIGLCTPALTPLPHPGKPSRLHRPSATT-------TVCSASKWADRLIADFQF  53

Query  239  LPSTSTPDPPDHKSTTATLTPPLDIL-----ERNVSLPIDFYRVLGAEPHFLGDGIRRAY  403
            LP T         ST     P    L     ER VS+P+DFY+VLGAE HFLGDGI+RAY
Sbjct  54   LPPTDNSFSSSSSSTATLSPPFPPPLSPSPPERQVSIPLDFYKVLGAETHFLGDGIKRAY  113

Query  404  EARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDK  583
            EAR+SKPPQYG+S ++L+SRRQILQAACETLA+P SRR+YNQGL + E DT++TQVPWDK
Sbjct  114  EARVSKPPQYGFSQDSLLSRRQILQAACETLANPGSRRNYNQGLVDDERDTIITQVPWDK  173

Query  584  VPGALCVLQESGDTELVLQI  643
            VPGALCVLQE+G+TE+VL+I
Sbjct  174  VPGALCVLQEAGETEVVLRI  193



>emb|CDP07437.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 158/210 (75%), Gaps = 15/210 (7%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPN-----ARRLHRFSAVSGGASSAPTTF----SASKWA  211
            M+ L HLN+GIC+P L  P  PP       R+L + +AVSG ASS+        + SKWA
Sbjct  1    MEVLRHLNIGICTPSLLSPPPPPLPPLLITRKLPKLNAVSGSASSSSIPNSFSSATSKWA  60

Query  212  DRLFADFQFLPSTS-TPDPPDHKSTTATLTPPLDI-----LERNVSLPIDFYRVLGAEPH  373
            +RLFADFQFLPST+ T D  D  S TATL PP         ER+V +PIDFYR+LGAE H
Sbjct  61   ERLFADFQFLPSTNVTADHSDDNSATATLAPPFTTPTLAPTERSVEVPIDFYRILGAEAH  120

Query  374  FLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFD  553
            FLGDGIRRAY+ ++S+PPQYGYS +AL+SRR ILQAACETLA+ SSRR+YNQGLA+ EF 
Sbjct  121  FLGDGIRRAYQVKVSRPPQYGYSQDALVSRRMILQAACETLANASSRREYNQGLADDEFG  180

Query  554  TLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            T++TQVPWDKVPGAL VLQE+G+TE+VL+I
Sbjct  181  TIITQVPWDKVPGALSVLQEAGETEVVLKI  210



>gb|KHG01462.1| accumulation and replication of chloroplasts 6, chloroplastic 
-like protein [Gossypium arboreum]
Length=795

 Score =   233 bits (595),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 149/206 (72%), Gaps = 25/206 (12%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M++L  +++G+C+P L P   PP   RLH          S     SASKWA+RL ADFQF
Sbjct  1    MESLRRISIGLCTPTLTPLFHPPKPSRLHH--------PSTTVVCSASKWAERLLADFQF  52

Query  239  LPSTSTPDPPDHKST-----TATLTPPLDIL------ERNVSLPIDFYRVLGAEPHFLGD  385
            LP+      PD+  +     TATL+PP   L      ER+VS+P+DFY+VLGAE HFLGD
Sbjct  53   LPA------PDNSVSSSSSSTATLSPPYPPLLAPSPPERHVSIPLDFYKVLGAETHFLGD  106

Query  386  GIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLT  565
            GI+RAYEAR+SKPPQYG+S + ++SRRQIL AACETL++P SRR+YNQGL + E DT++T
Sbjct  107  GIKRAYEARVSKPPQYGFSQDTIVSRRQILLAACETLSNPGSRRNYNQGLVDDERDTIIT  166

Query  566  QVPWDKVPGALCVLQESGDTELVLQI  643
             VPW+KVPGALCVLQE+G+TE+VLQI
Sbjct  167  HVPWNKVPGALCVLQEAGETEVVLQI  192



>ref|XP_011083887.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic, partial [Sesamum indicum]
Length=747

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 5/149 (3%)
 Frame = +2

Query  200  SKWADRLFADFQFLPSTSTPDPPDHKSTTATLTPPL-DILERNVSLPIDFYRVLGAEPHF  376
            SKWADRL  DFQFLPSTS  D PD    T+T  PPL    ER+VS+P+DFYRVLGAE HF
Sbjct  2    SKWADRLLPDFQFLPSTS--DSPDL--ATSTSPPPLPSFPERHVSVPLDFYRVLGAESHF  57

Query  377  LGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDT  556
            LGDGIRRAY+AR+SKPPQYGYS +ALISRRQILQAACETLA+PSSR +YNQGLA  EFDT
Sbjct  58   LGDGIRRAYDARVSKPPQYGYSDDALISRRQILQAACETLANPSSRGEYNQGLAEDEFDT  117

Query  557  LLTQVPWDKVPGALCVLQESGDTELVLQI  643
            +LTQVPWDKVPGALCVLQE+G+TELVLQI
Sbjct  118  ILTQVPWDKVPGALCVLQEAGETELVLQI  146



>ref|XP_006435106.1| hypothetical protein CICLE_v100003721mg, partial [Citrus clementina]
 gb|ESR48346.1| hypothetical protein CICLE_v100003721mg, partial [Citrus clementina]
Length=271

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 142/197 (72%), Gaps = 5/197 (3%)
 Frame = +2

Query  53   IKMDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            ++M AL H++ G+ SP L P  QP  + +    S ++       T  SASKWA RL ADF
Sbjct  1    MQMQALGHIDFGLRSPLLVPAPQPRTSSKRPSISKLN-----TTTVSSASKWAHRLLADF  55

Query  233  QFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            QF  + ++       +T     PP     R+VS+PIDFY+ LGAE HFLGDGIRRAYEAR
Sbjct  56   QFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEAR  115

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            ISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+YNQGLA+   DT+LT+VPWDKVPG
Sbjct  116  ISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPG  175

Query  593  ALCVLQESGDTELVLQI  643
            AL VLQE+G+TE+VL+I
Sbjct  176  ALLVLQEAGETEVVLRI  192



>ref|XP_007227000.1| hypothetical protein PRUPE_ppa001578mg [Prunus persica]
 gb|EMJ28199.1| hypothetical protein PRUPE_ppa001578mg [Prunus persica]
Length=799

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 141/202 (70%), Gaps = 20/202 (10%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+ L H  +G  +P L P       ++L+            PT F ASKWA+RL ADFQF
Sbjct  1    METLKHFGIGFSTPSLVPFRHQRRPQKLN------------PTCF-ASKWAERLLADFQF  47

Query  239  LPSTSTPDPPDHK--STTATLTPP-----LDILERNVSLPIDFYRVLGAEPHFLGDGIRR  397
            L  +S+     H   S TATL PP     +   ER+VS+PIDFY+VLGA+ HFLGDGIRR
Sbjct  48   LGDSSSDHQNHHSLTSATATLAPPHLPPHIASPERHVSIPIDFYQVLGAQQHFLGDGIRR  107

Query  398  AYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPW  577
            AYEAR SKPPQYG++ EAL SRRQIL AACETLADP SRR+YNQGLA  E  T+LTQVPW
Sbjct  108  AYEARASKPPQYGFTQEALFSRRQILLAACETLADPRSRREYNQGLAEDEDGTILTQVPW  167

Query  578  DKVPGALCVLQESGDTELVLQI  643
            DKVPGALCVLQE+G TELVLQI
Sbjct  168  DKVPGALCVLQEAGKTELVLQI  189



>ref|XP_010271467.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Nelumbo nucifera]
Length=803

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 150/210 (71%), Gaps = 21/210 (10%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGA----SSAPTTFSASKWADRLFA  226
            M+ L HL LG+CSPRL P       RRL +   + G      +S+P T   SKWADRL  
Sbjct  1    METLNHLGLGLCSPRLVPK------RRLKKLCTIGGSGPNTTNSSPITCYTSKWADRLLG  54

Query  227  DFQFLPSTSTPDPPD-----------HKSTTATLTPPLDILERNVSLPIDFYRVLGAEPH  373
            DFQF+PST++    D           + + T+ L PP  + ER++ LP+DFY++LGAE H
Sbjct  55   DFQFIPSTTSTTTSDPSDYYSSSSTSNVALTSLLPPPPAVPERHIPLPLDFYQILGAETH  114

Query  374  FLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFD  553
            +LGDGIRRAY++RISKPPQYG+S +ALISRRQILQAACETLA+P +R DYNQGL   +  
Sbjct  115  YLGDGIRRAYDSRISKPPQYGFSQDALISRRQILQAACETLANPRTRGDYNQGLLEDQDG  174

Query  554  TLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            TL+TQVPWDKVPGALCVLQE+G+TE+VL+I
Sbjct  175  TLITQVPWDKVPGALCVLQEAGETEVVLRI  204



>ref|XP_004173365.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like, partial [Cucumis sativus]
Length=333

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 143/198 (72%), Gaps = 14/198 (7%)
 Frame = +2

Query  68   LTHLNLGICSPRLA--PPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFL  241
            L+H   G+ S  L   P ++P   RRL+       G  +A    +ASKWA+RL  DFQFL
Sbjct  2    LSHTTTGLHSRSLFTFPRIKP---RRLNH-----SGGGNASVKCAASKWAERLLGDFQFL  53

Query  242  PSTSTPDPPDHKSTTATLTP----PLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEA  409
              +S+       ST  TL+P    P+   +R V++PIDFYRVLGAE HFLGDGIRRAYEA
Sbjct  54   SDSSSDHSHSLSSTAVTLSPSFPPPIASTDRQVTIPIDFYRVLGAETHFLGDGIRRAYEA  113

Query  410  RISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVP  589
            R+SKPPQYG+S E LISRRQILQAACETLAD +SRR+YNQGL++ E  T+LTQVP+DKVP
Sbjct  114  RVSKPPQYGFSQETLISRRQILQAACETLADHTSRREYNQGLSDDEDGTILTQVPFDKVP  173

Query  590  GALCVLQESGDTELVLQI  643
            GALCVLQE+G+T LVL+I
Sbjct  174  GALCVLQEAGETALVLEI  191



>gb|EPS66110.1| hypothetical protein M569_08664 [Genlisea aurea]
Length=792

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 154/200 (77%), Gaps = 18/200 (9%)
 Frame = +2

Query  59   MDALTH-LNLG--ICSPRLAPPLQPPNA-RRLHRFSA-VSGGASSAPTTFSASKWADRLF  223
            M+ +T  L++G  I S RL   L+PP A RRL + SA V+GGA++        KWADRL 
Sbjct  1    MEVVTQRLSIGFVINSRRL---LKPPVANRRLVKPSAAVNGGATT-------RKWADRLL  50

Query  224  ADFQFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAY  403
            ADFQFLPSTS  D  D  S  +   P   + ER VS+P+DFYRVLGAE H LGDGIRRAY
Sbjct  51   ADFQFLPSTS--DSGD-VSMFSPPRPLPSLPERYVSMPLDFYRVLGAESHVLGDGIRRAY  107

Query  404  EARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDK  583
             AR+SKPPQYG+S +AL+SRRQILQAACETLA+PSSRR+YNQGLA+ EF T+LTQ+PW+K
Sbjct  108  NARVSKPPQYGFSDDALVSRRQILQAACETLANPSSRREYNQGLADDEFGTVLTQMPWEK  167

Query  584  VPGALCVLQESGDTELVLQI  643
            VPGALCVLQE+G+++LV++I
Sbjct  168  VPGALCVLQEAGESDLVIKI  187



>ref|XP_008221317.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Prunus mume]
Length=799

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 144/205 (70%), Gaps = 23/205 (11%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+ L H  +G  +P L P       ++L+            PT F ASKWA+RL ADFQF
Sbjct  1    METLKHFGIGFSTPSLVPFRHQRRPQKLN------------PTCF-ASKWAERLLADFQF  47

Query  239  L--PSTSTPDPPDHKS---TTATLTPP-----LDILERNVSLPIDFYRVLGAEPHFLGDG  388
            L   S+S+ D  +H S    TAT+ PP     +   ER+VS+PIDFY+VLGA+ HFLGDG
Sbjct  48   LGDSSSSSSDHQNHHSLYSATATVAPPHLPPHIAYPERHVSIPIDFYQVLGAQQHFLGDG  107

Query  389  IRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQ  568
            IRRAYEAR SKPPQYG++ EAL SRRQIL AACETLADP SRR+YNQGLA  E  T+LTQ
Sbjct  108  IRRAYEARASKPPQYGFTQEALFSRRQILLAACETLADPRSRREYNQGLAEDEDGTILTQ  167

Query  569  VPWDKVPGALCVLQESGDTELVLQI  643
            VPWDKVPGALCVLQE+G T+LVLQI
Sbjct  168  VPWDKVPGALCVLQEAGKTQLVLQI  192



>emb|CDP18569.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 128/184 (70%), Gaps = 22/184 (12%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSAS--KWADRLFADF  232
            M+ L H N+GIC P L  P               S   SS P +FS++  KWA+RLFADF
Sbjct  1    MEVLRHRNMGICIPSLLSP--------------GSTNTSSIPNSFSSATNKWAERLFADF  46

Query  233  QFLPST-STPDPPDHKSTTATLTPPLDI-----LERNVSLPIDFYRVLGAEPHFLGDGIR  394
            QFL ST  T D  D  S TATLTPP  I      ER+V +PIDFYR+LG E HFLGDGIR
Sbjct  47   QFLLSTIVTADHSDDNSATATLTPPFTIPTLAPTERSVKMPIDFYRILGIEAHFLGDGIR  106

Query  395  RAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVP  574
            RAYEA++S+PP YGYS +AL+SRR ILQ AC+TLA+ SS+R+YNQGLA+ EF T++TQVP
Sbjct  107  RAYEAKVSRPPHYGYSQDALVSRRMILQVACQTLANASSQREYNQGLADDEFGTIITQVP  166

Query  575  WDKV  586
            WDKV
Sbjct  167  WDKV  170



>ref|XP_010535306.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X2 [Tarenaya hassleriana]
Length=801

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 145/201 (72%), Gaps = 18/201 (9%)
 Frame = +2

Query  59   MDALTHLNLGICS---PRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFAD  229
            M+AL H+ +G+CS   PR  PP+ P   RR H          SA T  SASKWADRL +D
Sbjct  1    MEALGHVAVGLCSLRKPRQRPPMSPAKLRRRH----------SATTLCSASKWADRLLSD  50

Query  230  FQFLPSTSTPDPPDHKSTTATLTPPLDIL---ERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
            F F  +T +         TATL  P   L   +R++ +PIDFY+VLGAE HFL DGIRRA
Sbjct  51   FNF--TTDSSSSSSSSVATATLAAPPPSLAPPDRHIPIPIDFYQVLGAEMHFLTDGIRRA  108

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            YE+R+SKPPQ+G+S +ALISRRQ LQAACETL++P SRR+YNQGL + E DT++T+VPWD
Sbjct  109  YESRVSKPPQFGFSDDALISRRQFLQAACETLSNPRSRREYNQGLLDDEEDTIITEVPWD  168

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE+G+TE+VL+I
Sbjct  169  KVPGALCVLQEAGETEVVLRI  189



>gb|KDO84753.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
 gb|KDO84754.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=670

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 142/197 (72%), Gaps = 5/197 (3%)
 Frame = +2

Query  53   IKMDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            ++M AL H++ G+ SP L P  QP  + +    S ++       T  SASKWA RL ADF
Sbjct  1    MQMQALGHIDFGLRSPLLVPAPQPRTSSKRPSISKLN-----TTTVSSASKWAHRLLADF  55

Query  233  QFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            QF  + ++       +T     PP     R+VS+PIDFY+ LGAE HFLGDGIRRAYEAR
Sbjct  56   QFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEAR  115

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            ISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+YNQGLA+   DT+LT+VPWDKVPG
Sbjct  116  ISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPG  175

Query  593  ALCVLQESGDTELVLQI  643
            AL VLQE+G+TE+VL+I
Sbjct  176  ALLVLQEAGETEVVLRI  192



>ref|XP_010535302.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010535303.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010535304.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010535305.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Tarenaya hassleriana]
Length=804

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 145/201 (72%), Gaps = 18/201 (9%)
 Frame = +2

Query  59   MDALTHLNLGICS---PRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFAD  229
            M+AL H+ +G+CS   PR  PP+ P   RR H          SA T  SASKWADRL +D
Sbjct  1    MEALGHVAVGLCSLRKPRQRPPMSPAKLRRRH----------SATTLCSASKWADRLLSD  50

Query  230  FQFLPSTSTPDPPDHKSTTATLTPPLDIL---ERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
            F F  +T +         TATL  P   L   +R++ +PIDFY+VLGAE HFL DGIRRA
Sbjct  51   FNF--TTDSSSSSSSSVATATLAAPPPSLAPPDRHIPIPIDFYQVLGAEMHFLTDGIRRA  108

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            YE+R+SKPPQ+G+S +ALISRRQ LQAACETL++P SRR+YNQGL + E DT++T+VPWD
Sbjct  109  YESRVSKPPQFGFSDDALISRRQFLQAACETLSNPRSRREYNQGLLDDEEDTIITEVPWD  168

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE+G+TE+VL+I
Sbjct  169  KVPGALCVLQEAGETEVVLRI  189



>ref|XP_006473599.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X3 [Citrus sinensis]
Length=701

 Score =   218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 143/197 (73%), Gaps = 5/197 (3%)
 Frame = +2

Query  53   IKMDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            ++M AL H++ G+ SP L P  QP  + +    S ++     + T  SASKWA RL ADF
Sbjct  1    MQMQALGHVDFGLRSPLLVPAPQPRTSSKRPSISKLN-----STTVSSASKWAHRLLADF  55

Query  233  QFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            QF  + ++       +T     PP     R+VS+PIDFY+ LGAE HFLGDGIRRAYEAR
Sbjct  56   QFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEAR  115

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            ISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+YNQGLA+   DT+LT+VPWDKVPG
Sbjct  116  ISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPG  175

Query  593  ALCVLQESGDTELVLQI  643
            AL VLQE+G+TE+VL+I
Sbjct  176  ALLVLQEAGETEVVLRI  192



>ref|XP_006473598.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X2 [Citrus sinensis]
Length=712

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 143/197 (73%), Gaps = 5/197 (3%)
 Frame = +2

Query  53   IKMDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            ++M AL H++ G+ SP L P  QP  + +    S ++     + T  SASKWA RL ADF
Sbjct  1    MQMQALGHVDFGLRSPLLVPAPQPRTSSKRPSISKLN-----STTVSSASKWAHRLLADF  55

Query  233  QFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            QF  + ++       +T     PP     R+VS+PIDFY+ LGAE HFLGDGIRRAYEAR
Sbjct  56   QFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEAR  115

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            ISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+YNQGLA+   DT+LT+VPWDKVPG
Sbjct  116  ISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPG  175

Query  593  ALCVLQESGDTELVLQI  643
            AL VLQE+G+TE+VL+I
Sbjct  176  ALLVLQEAGETEVVLRI  192



>gb|KDO84752.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=712

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 142/197 (72%), Gaps = 5/197 (3%)
 Frame = +2

Query  53   IKMDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            ++M AL H++ G+ SP L P  QP  + +    S ++       T  SASKWA RL ADF
Sbjct  1    MQMQALGHIDFGLRSPLLVPAPQPRTSSKRPSISKLN-----TTTVSSASKWAHRLLADF  55

Query  233  QFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            QF  + ++       +T     PP     R+VS+PIDFY+ LGAE HFLGDGIRRAYEAR
Sbjct  56   QFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEAR  115

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            ISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+YNQGLA+   DT+LT+VPWDKVPG
Sbjct  116  ISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPG  175

Query  593  ALCVLQESGDTELVLQI  643
            AL VLQE+G+TE+VL+I
Sbjct  176  ALLVLQEAGETEVVLRI  192



>gb|KDO84751.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=701

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 142/197 (72%), Gaps = 5/197 (3%)
 Frame = +2

Query  53   IKMDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            ++M AL H++ G+ SP L P  QP  + +    S ++       T  SASKWA RL ADF
Sbjct  1    MQMQALGHIDFGLRSPLLVPAPQPRTSSKRPSISKLN-----TTTVSSASKWAHRLLADF  55

Query  233  QFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            QF  + ++       +T     PP     R+VS+PIDFY+ LGAE HFLGDGIRRAYEAR
Sbjct  56   QFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEAR  115

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            ISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+YNQGLA+   DT+LT+VPWDKVPG
Sbjct  116  ISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPG  175

Query  593  ALCVLQESGDTELVLQI  643
            AL VLQE+G+TE+VL+I
Sbjct  176  ALLVLQEAGETEVVLRI  192



>ref|XP_006473597.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X1 [Citrus sinensis]
Length=798

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 143/197 (73%), Gaps = 5/197 (3%)
 Frame = +2

Query  53   IKMDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            ++M AL H++ G+ SP L P  QP  + +    S ++     + T  SASKWA RL ADF
Sbjct  1    MQMQALGHVDFGLRSPLLVPAPQPRTSSKRPSISKLN-----STTVSSASKWAHRLLADF  55

Query  233  QFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            QF  + ++       +T     PP     R+VS+PIDFY+ LGAE HFLGDGIRRAYEAR
Sbjct  56   QFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEAR  115

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            ISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+YNQGLA+   DT+LT+VPWDKVPG
Sbjct  116  ISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPG  175

Query  593  ALCVLQESGDTELVLQI  643
            AL VLQE+G+TE+VL+I
Sbjct  176  ALLVLQEAGETEVVLRI  192



>gb|KDO84749.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=798

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 142/197 (72%), Gaps = 5/197 (3%)
 Frame = +2

Query  53   IKMDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADF  232
            ++M AL H++ G+ SP L P  QP  + +    S ++       T  SASKWA RL ADF
Sbjct  1    MQMQALGHIDFGLRSPLLVPAPQPRTSSKRPSISKLN-----TTTVSSASKWAHRLLADF  55

Query  233  QFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            QF  + ++       +T     PP     R+VS+PIDFY+ LGAE HFLGDGIRRAYEAR
Sbjct  56   QFTTADNSSLSSSSNTTVTLTPPPPTPTNRHVSIPIDFYQALGAETHFLGDGIRRAYEAR  115

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            ISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+YNQGLA+   DT+LT+VPWDKVPG
Sbjct  116  ISKPPQYGFSPDALISRRQILQAACETLANASSRREYNQGLADDHADTILTEVPWDKVPG  175

Query  593  ALCVLQESGDTELVLQI  643
            AL VLQE+G+TE+VL+I
Sbjct  176  ALLVLQEAGETEVVLRI  192



>ref|XP_008444775.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Cucumis melo]
Length=789

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 143/198 (72%), Gaps = 14/198 (7%)
 Frame = +2

Query  68   LTHLNLGICSPRLA--PPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFL  241
            L+H   G+ S  L   P ++P   RRL+       G  +A    +ASKWA+RL  DFQFL
Sbjct  2    LSHSTTGLHSRSLFTFPSIKP---RRLNH-----SGGGNASVKCAASKWAERLLGDFQFL  53

Query  242  PSTSTPDPPDHKSTTATLTP----PLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEA  409
              +S+       ST  TL+P    P+   ER V++PIDFYRVLGAE HFLGDGIRRAYEA
Sbjct  54   SDSSSDHSHSLSSTAVTLSPSFPPPIASTERQVTIPIDFYRVLGAEAHFLGDGIRRAYEA  113

Query  410  RISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVP  589
            R+SKPPQYG+S E LISRRQILQAACETLAD +SRR+YNQGL++ E  T+LTQVP+DKVP
Sbjct  114  RVSKPPQYGFSQETLISRRQILQAACETLADHTSRREYNQGLSDDEDGTILTQVPFDKVP  173

Query  590  GALCVLQESGDTELVLQI  643
            GALCVLQE+G+T LVL+I
Sbjct  174  GALCVLQEAGETALVLEI  191



>ref|XP_004152763.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Cucumis sativus]
Length=786

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 143/198 (72%), Gaps = 14/198 (7%)
 Frame = +2

Query  68   LTHLNLGICSPRLA--PPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFL  241
            L+H   G+ S  L   P ++P   RRL+       G  +A    +ASKWA+RL  DFQFL
Sbjct  2    LSHTTTGLHSRSLFTFPRIKP---RRLNH-----SGGGNASVKCAASKWAERLLGDFQFL  53

Query  242  PSTSTPDPPDHKSTTATLTP----PLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEA  409
              +S+       ST  TL+P    P+   ER V++PIDFYRVLGAE HFLGDGIRRAYEA
Sbjct  54   SDSSSDHSHSLSSTAVTLSPSFPPPIASTERQVTIPIDFYRVLGAETHFLGDGIRRAYEA  113

Query  410  RISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVP  589
            R+SKPPQYG+S E LISRRQILQAACETLAD +SRR+YNQGL++ E  T+LTQVP+DKVP
Sbjct  114  RVSKPPQYGFSQETLISRRQILQAACETLADHTSRREYNQGLSDDEDGTILTQVPFDKVP  173

Query  590  GALCVLQESGDTELVLQI  643
            GALCVLQE+G+T LVL+I
Sbjct  174  GALCVLQEAGETALVLEI  191



>ref|XP_002510483.1| heat shock protein binding protein, putative [Ricinus communis]
 gb|EEF52670.1| heat shock protein binding protein, putative [Ricinus communis]
Length=781

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 140/191 (73%), Gaps = 14/191 (7%)
 Frame = +2

Query  83   LGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPSTSTPD  262
            +GI +PR+  P  PP  R  H          +  TT SASKWADRL +DFQF   T+  D
Sbjct  7    IGIAAPRVIFPYSPPPRRFSH-------SKLTPSTTCSASKWADRL-SDFQFF--TTATD  56

Query  263  PPD----HKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQ  430
              D      ST AT+  P+   ER+VS+P++FY+VLGAE HFLGDGI+RAY AR+SKPPQ
Sbjct  57   TSDLHCLSSSTAATIVAPVAPPERHVSIPLNFYQVLGAETHFLGDGIKRAYSARLSKPPQ  116

Query  431  YGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQ  610
             G+S E LISRRQI+QAACETLA+P SRR+YNQGL + E DT++TQVPWDKVPGALCVL+
Sbjct  117  SGFSEETLISRRQIIQAACETLANPQSRREYNQGLLDDELDTIITQVPWDKVPGALCVLE  176

Query  611  ESGDTELVLQI  643
            E+G+TE+VL+I
Sbjct  177  EAGETEVVLEI  187



>ref|XP_010095543.1| hypothetical protein L484_016017 [Morus notabilis]
 gb|EXB60663.1| hypothetical protein L484_016017 [Morus notabilis]
Length=791

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 139/195 (71%), Gaps = 8/195 (4%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+ L  L++G  + R++P L     ++LH     +  A S   T SASKWADRL ADF F
Sbjct  1    METLRQLSIGFPTLRISPFLSHRTFQKLH---PSAAAAVSRAVTCSASKWADRLLADFNF  57

Query  239  LPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARIS  418
            +      DP    S TATL PPL   ER VS+P+DFY+VLGAE HFLGDGIRRAYEAR+S
Sbjct  58   VG-----DPSSSSSATATLAPPLAPTERKVSIPLDFYQVLGAETHFLGDGIRRAYEARVS  112

Query  419  KPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGAL  598
            KPPQYG+S +AL+SRRQIL AACETL   S RR+YNQ L   E  T+LTQVPWDKVPGAL
Sbjct  113  KPPQYGFSQDALLSRRQILMAACETLVSASLRREYNQSLVEDEEGTVLTQVPWDKVPGAL  172

Query  599  CVLQESGDTELVLQI  643
            CVLQE+G TE+VLQI
Sbjct  173  CVLQEAGKTEVVLQI  187



>ref|XP_009335546.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Pyrus x bretschneideri]
Length=790

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 141/202 (70%), Gaps = 19/202 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+ L H  +G  +PRL P       ++L             PT   ASKWA+RL ADFQF
Sbjct  1    METLKHFGIGFSTPRLLPFRHHRKPQKL------------PPTICFASKWAERLLADFQF  48

Query  239  L--PSTSTPDPPDHKSTTATLTPP-----LDILERNVSLPIDFYRVLGAEPHFLGDGIRR  397
            L   S+S+ D     S T+TL PP     +   ER+VS+PIDFY+VLGA+ HFLGDGIRR
Sbjct  49   LGDSSSSSSDHHSLSSATSTLAPPHLPPAISSPERHVSIPIDFYQVLGAQQHFLGDGIRR  108

Query  398  AYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPW  577
            AYEAR SKPPQYG++ EAL SRRQIL AACETLADP+SRR+YNQ L+  E  T++TQVPW
Sbjct  109  AYEARASKPPQYGFTQEALFSRRQILLAACETLADPASRREYNQSLSEDEDGTIITQVPW  168

Query  578  DKVPGALCVLQESGDTELVLQI  643
            DKVPGALCVLQE+G TELVLQI
Sbjct  169  DKVPGALCVLQEAGQTELVLQI  190



>ref|XP_004499214.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Cicer arietinum]
Length=793

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = +2

Query  134  RRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTPPLDI  313
            RRL RFS       S+  + + SKWA+RL +DFQFL  T++P      + T +  P LD 
Sbjct  20   RRLSRFSRKPNRLHSSAIS-ATSKWAERLISDFQFLGDTNSPPSSSSATLTPSFPPQLDT  78

Query  314  --LERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAAC  487
              +ER+VS+P+DFYR+LGAE HFLGDGIRRAYE++ SKPPQY +S+EALISRRQILQAAC
Sbjct  79   PPIERHVSIPLDFYRILGAETHFLGDGIRRAYESKFSKPPQYAFSNEALISRRQILQAAC  138

Query  488  ETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            ETLADP+SRR+YNQ   + E  ++LT++P+DKVPGALCVLQE+G+TELVLQI
Sbjct  139  ETLADPASRREYNQSFFDDEDSSILTEIPFDKVPGALCVLQEAGETELVLQI  190



>gb|KGN62655.1| hypothetical protein Csa_2G365130 [Cucumis sativus]
Length=957

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 136/186 (73%), Gaps = 16/186 (9%)
 Frame = +2

Query  98   PRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPSTSTPDPPDHK  277
            PR+ P       RRL+       G  +A    +ASKWA+RL  DFQFL  +S+       
Sbjct  186  PRIKP-------RRLNH-----SGGGNASVKCAASKWAERLLGDFQFLSDSSSDHSHSLS  233

Query  278  STTATLTP----PLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSH  445
            ST  TL+P    P+   ER V++PIDFYRVLGAE HFLGDGIRRAYEAR+SKPPQYG+S 
Sbjct  234  STAVTLSPSFPPPIASTERQVTIPIDFYRVLGAETHFLGDGIRRAYEARVSKPPQYGFSQ  293

Query  446  EALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDT  625
            E LISRRQILQAACETLAD +SRR+YNQGL++ E  T+LTQVP+DKVPGALCVLQE+G+T
Sbjct  294  ETLISRRQILQAACETLADHTSRREYNQGLSDDEDGTILTQVPFDKVPGALCVLQEAGET  353

Query  626  ELVLQI  643
             LVL+I
Sbjct  354  ALVLEI  359



>ref|XP_004291818.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Fragaria vesca subsp. vesca]
Length=783

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 135/197 (69%), Gaps = 17/197 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+ LTH  +   SPRL+ P +P   +RL             PT FSASKWADRL +DFQF
Sbjct  1    METLTHFGIAFFSPRLSAPRKP---QRLK------------PTLFSASKWADRLLSDFQF  45

Query  239  L--PSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
            L   S+S        +            ER VS+P+DFY++LG + HFL DGIRRAYEAR
Sbjct  46   LGDSSSSDHHHSSTATLAPPPPLAPPPPERYVSVPLDFYQLLGTQSHFLADGIRRAYEAR  105

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
             SK PQYG+S +AL+SRRQILQAACETLADPSSRR+YN+ LA+ E  T+LT VPWDKVPG
Sbjct  106  ASKRPQYGFSQDALVSRRQILQAACETLADPSSRREYNRSLADDEDGTILTDVPWDKVPG  165

Query  593  ALCVLQESGDTELVLQI  643
            ALCVLQE+G TELVL+I
Sbjct  166  ALCVLQEAGKTELVLRI  182



>gb|KDP38591.1| hypothetical protein JCGZ_04516 [Jatropha curcas]
Length=789

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 146/204 (72%), Gaps = 24/204 (12%)
 Frame = +2

Query  59   MDALTHLNLGICSPRL-APPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQ  235
            M+A+ ++  GI +PRL APP+ P  + +L              TT SAS+WADRL  DFQ
Sbjct  1    MEAMRYI--GIGAPRLVAPPIIPRKSSKL-----------ITTTTCSASRWADRLLGDFQ  47

Query  236  FLPSTSTPDPPD-HKS---TTATLTPPLDIL----ERNVSLPIDFYRVLGAEPHFLGDGI  391
            F    +T D  D H S   +TATL PP   L    ER VS+P+ FY+VLGAE HFLGDGI
Sbjct  48   FF--NTTADASDLHNSLSSSTATLAPPSPPLISPPERYVSIPLHFYQVLGAETHFLGDGI  105

Query  392  RRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQV  571
            +RAYEA++SKPPQYG+S +  ISRRQILQAACETLADP SRR+YNQGL + E DT++TQV
Sbjct  106  KRAYEAKVSKPPQYGFSQDVFISRRQILQAACETLADPESRREYNQGLIDDEHDTIITQV  165

Query  572  PWDKVPGALCVLQESGDTELVLQI  643
            PW+KVPGALC+LQESG+ E+V +I
Sbjct  166  PWEKVPGALCLLQESGENEVVNKI  189



>ref|XP_010672203.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=814

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 150/216 (69%), Gaps = 25/216 (12%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARR---LHRF---------------SAVSGGASSAP  184
            M+ LTH    +  P L PPL   ++ +   +HR                S VS   S A 
Sbjct  1    MEGLTHSGFNLWYPTLRPPLPSTSSSKKDFIHRIPITTTITTTTNAATNSGVSTSFSGAS  60

Query  185  TTFSASKWADRLFADFQFLPSTSTPDPPDHKSTTA---TLTPPLDILERNVSLPIDFYRV  355
            T+FS SKWADRL +DFQFLP++++       + T+   +L+PP    +R++S+P++FY+V
Sbjct  61   TSFSGSKWADRLLSDFQFLPTSTSDTSSSSSALTSVPPSLSPP----DRHISIPLNFYQV  116

Query  356  LGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGL  535
            LGAE HFLGDGI+RAYE R+SKPPQYG++ + LI+RRQILQ ACETL+DP+SRRDYN GL
Sbjct  117  LGAETHFLGDGIKRAYEGRVSKPPQYGFTQDVLIARRQILQGACETLSDPNSRRDYNLGL  176

Query  536  ANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            ++   +T+L +VP+DKVPGALCVLQE+G+ ELVLQI
Sbjct  177  SDAFEETILFEVPFDKVPGALCVLQEAGEYELVLQI  212



>ref|XP_006601331.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X4 [Glycine max]
Length=715

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 142/197 (72%), Gaps = 24/197 (12%)
 Frame = +2

Query  80   NLGICSPRLAPPLQ---PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPST  250
             L  C+P     LQ    PN  +L R S+  GGAS + T    SKWA+RL ADFQFL   
Sbjct  9    GLAFCTPHPTTTLQRFTKPN--KLLR-SSSRGGASLSAT----SKWAERLIADFQFLG--  59

Query  251  STPDPPDHKSTTATLTPP-----LDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARI  415
                  D  ++T TL+P      LD  ER VS+P+D YRVLGAE HFLGDGIRRAYEA+ 
Sbjct  60   ------DAATSTVTLSPSSVPPSLDPPERYVSIPLDLYRVLGAELHFLGDGIRRAYEAKF  113

Query  416  SKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLA-NHEFDTLLTQVPWDKVPG  592
            SKPPQY +S++ALISRRQILQAACETLADP+SRR+YNQGL  +HE   +LTQ+P+DKVPG
Sbjct  114  SKPPQYAFSNDALISRRQILQAACETLADPASRREYNQGLVDDHEDAAILTQIPFDKVPG  173

Query  593  ALCVLQESGDTELVLQI  643
            ALCVLQE+G+TELVL+I
Sbjct  174  ALCVLQEAGETELVLEI  190



>ref|XP_006601329.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X2 [Glycine max]
Length=744

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 142/197 (72%), Gaps = 24/197 (12%)
 Frame = +2

Query  80   NLGICSPRLAPPLQ---PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPST  250
             L  C+P     LQ    PN  +L R S+  GGAS + T    SKWA+RL ADFQFL   
Sbjct  9    GLAFCTPHPTTTLQRFTKPN--KLLR-SSSRGGASLSAT----SKWAERLIADFQFLG--  59

Query  251  STPDPPDHKSTTATLTPP-----LDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARI  415
                  D  ++T TL+P      LD  ER VS+P+D YRVLGAE HFLGDGIRRAYEA+ 
Sbjct  60   ------DAATSTVTLSPSSVPPSLDPPERYVSIPLDLYRVLGAELHFLGDGIRRAYEAKF  113

Query  416  SKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLA-NHEFDTLLTQVPWDKVPG  592
            SKPPQY +S++ALISRRQILQAACETLADP+SRR+YNQGL  +HE   +LTQ+P+DKVPG
Sbjct  114  SKPPQYAFSNDALISRRQILQAACETLADPASRREYNQGLVDDHEDAAILTQIPFDKVPG  173

Query  593  ALCVLQESGDTELVLQI  643
            ALCVLQE+G+TELVL+I
Sbjct  174  ALCVLQEAGETELVLEI  190



>ref|XP_006601330.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X3 [Glycine max]
Length=721

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 142/197 (72%), Gaps = 24/197 (12%)
 Frame = +2

Query  80   NLGICSPRLAPPLQ---PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPST  250
             L  C+P     LQ    PN  +L R S+  GGAS + T    SKWA+RL ADFQFL   
Sbjct  9    GLAFCTPHPTTTLQRFTKPN--KLLR-SSSRGGASLSAT----SKWAERLIADFQFLG--  59

Query  251  STPDPPDHKSTTATLTPP-----LDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARI  415
                  D  ++T TL+P      LD  ER VS+P+D YRVLGAE HFLGDGIRRAYEA+ 
Sbjct  60   ------DAATSTVTLSPSSVPPSLDPPERYVSIPLDLYRVLGAELHFLGDGIRRAYEAKF  113

Query  416  SKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLA-NHEFDTLLTQVPWDKVPG  592
            SKPPQY +S++ALISRRQILQAACETLADP+SRR+YNQGL  +HE   +LTQ+P+DKVPG
Sbjct  114  SKPPQYAFSNDALISRRQILQAACETLADPASRREYNQGLVDDHEDAAILTQIPFDKVPG  173

Query  593  ALCVLQESGDTELVLQI  643
            ALCVLQE+G+TELVL+I
Sbjct  174  ALCVLQEAGETELVLEI  190



>ref|XP_003549451.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X1 [Glycine max]
Length=793

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 142/197 (72%), Gaps = 24/197 (12%)
 Frame = +2

Query  80   NLGICSPRLAPPLQ---PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPST  250
             L  C+P     LQ    PN  +L R S+  GGAS + T    SKWA+RL ADFQFL   
Sbjct  9    GLAFCTPHPTTTLQRFTKPN--KLLR-SSSRGGASLSAT----SKWAERLIADFQFLG--  59

Query  251  STPDPPDHKSTTATLTPP-----LDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARI  415
                  D  ++T TL+P      LD  ER VS+P+D YRVLGAE HFLGDGIRRAYEA+ 
Sbjct  60   ------DAATSTVTLSPSSVPPSLDPPERYVSIPLDLYRVLGAELHFLGDGIRRAYEAKF  113

Query  416  SKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLA-NHEFDTLLTQVPWDKVPG  592
            SKPPQY +S++ALISRRQILQAACETLADP+SRR+YNQGL  +HE   +LTQ+P+DKVPG
Sbjct  114  SKPPQYAFSNDALISRRQILQAACETLADPASRREYNQGLVDDHEDAAILTQIPFDKVPG  173

Query  593  ALCVLQESGDTELVLQI  643
            ALCVLQE+G+TELVL+I
Sbjct  174  ALCVLQEAGETELVLEI  190



>ref|XP_007160698.1| hypothetical protein PHAVU_001G009500g [Phaseolus vulgaris]
 gb|ESW32692.1| hypothetical protein PHAVU_001G009500g [Phaseolus vulgaris]
Length=797

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 134/179 (75%), Gaps = 15/179 (8%)
 Frame = +2

Query  125  PNARRLHRFSAVSG-GASSAPTTFSASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTP  301
            PN  +L   S+V+G G  S   T + S+WA+RL ADFQFL   S+       S TATL+P
Sbjct  25   PN--KLRSSSSVTGRGGGSLSATCATSRWAERLIADFQFLGDASS-------SATATLSP  75

Query  302  P-----LDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRR  466
                  LD  ER VS+P+D YRVLGAE HFLGDGIRRAYE + SKPPQY +S++ALISRR
Sbjct  76   SSVPPLLDPPERYVSIPLDLYRVLGAESHFLGDGIRRAYETKFSKPPQYAFSNDALISRR  135

Query  467  QILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            QILQAACETLADP+SRR+YNQGL + E   +LTQ+P+DKVPGALCVLQE+G+ ELVL+I
Sbjct  136  QILQAACETLADPTSRREYNQGLVDDEDAAILTQIPFDKVPGALCVLQEAGEQELVLEI  194



>ref|XP_010484901.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Camelina sativa]
Length=346

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 141/195 (72%), Gaps = 9/195 (5%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+AL+H+ +G+   +L     PP   +L R    S   S+  T  SASKWADRL +DF F
Sbjct  1    MEALSHVGIGLFPFQLCR--LPPATTKLRR----SHNTSNTTTICSASKWADRLLSDFNF  54

Query  239  LPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARIS  418
               TS        +T  +  P +D   R++ +PIDFY+VLGA+ HFL DGIRRA+EAR+S
Sbjct  55   ---TSDSSSSVSTATLVSPPPSIDRPGRHIPIPIDFYQVLGAQTHFLTDGIRRAFEARVS  111

Query  419  KPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGAL  598
            KPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E  T++T+VPW+KVPGAL
Sbjct  112  KPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLVDDEEATVITEVPWEKVPGAL  171

Query  599  CVLQESGDTELVLQI  643
            CVLQE+G+TE+VL++
Sbjct  172  CVLQEAGETEVVLRV  186



>ref|XP_008388150.1| PREDICTED: LOW QUALITY PROTEIN: protein ACCUMULATION AND REPLICATION 
OF CHLOROPLASTS 6, chloroplastic-like [Malus domestica]
Length=815

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 129/173 (75%), Gaps = 8/173 (5%)
 Frame = +2

Query  149  FSAVSGGASSAPTTFS-ASKWADRLFADFQFL--PSTSTPDPPDHKSTTATLTPP-----  304
             SA +G     P T   ASKWA+RL ADFQFL   S+S        S TATL PP     
Sbjct  43   LSATTGNPQKLPPTICFASKWAERLLADFQFLGDSSSSLLRHHSLSSATATLAPPHLPPA  102

Query  305  LDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAA  484
            +   ER+VS+PIDFY+VLGA+ HFLGDGIRRAYEAR SKPPQYG++ EAL SRRQIL AA
Sbjct  103  ISPPERHVSVPIDFYQVLGAQQHFLGDGIRRAYEARASKPPQYGFTQEALFSRRQILLAA  162

Query  485  CETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            CETLADP+SRR+YNQ LA  E  T++TQVPWDKVPGALCVLQE+G TELVLQI
Sbjct  163  CETLADPASRREYNQSLAEDEDGTIITQVPWDKVPGALCVLQEAGKTELVLQI  215



>emb|CAN78894.1| hypothetical protein VITISV_009566 [Vitis vinifera]
Length=789

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 138/200 (69%), Gaps = 18/200 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAP---TTFSASKWADRLFAD  229
            M ++ HL L + +PRL PP  P N RR  +  +  G  +  P   T FSASKWADRL +D
Sbjct  1    MASMAHLRLALYTPRLVPP--PRNLRRPSKIKSQGGAPADTPGTATAFSASKWADRLLSD  58

Query  230  FQFLPSTSTPDPPDHKST--TATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAY  403
            FQFLP          +ST  T+   PPL   ER+VS+P+ FY+VLGAE HFLGDGIRRAY
Sbjct  59   FQFLPPPPATTAASDRSTELTSLPPPPLAPPERDVSIPLHFYQVLGAEAHFLGDGIRRAY  118

Query  404  EARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDK  583
            EAR           EALISRRQILQAACETLA+P S+R+Y+QGLA  E +T++TQVPWDK
Sbjct  119  EAR-----------EALISRRQILQAACETLANPRSKREYSQGLAEDEVETIITQVPWDK  167

Query  584  VPGALCVLQESGDTELVLQI  643
            VPGALCVLQE+G+ E+VL I
Sbjct  168  VPGALCVLQEAGENEIVLXI  187



>ref|XP_003545049.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X1 [Glycine max]
Length=794

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 137/189 (72%), Gaps = 9/189 (5%)
 Frame = +2

Query  83   LGICSPR--LAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPSTST  256
            L +C+P      P   PN  +L R S   G AS + T    SKWA+RL ADFQFL   + 
Sbjct  10   LVLCTPHPTTTHPFTKPN--KLLRSSLSRGAASLSAT----SKWAERLIADFQFLGDAAA  63

Query  257  PDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYG  436
                    + +++ P LD  ER VS+P+D YR+LGAEPHFLGDGIRRAYEA+ SKPPQY 
Sbjct  64   STST-STLSPSSVPPRLDPPERYVSIPLDLYRILGAEPHFLGDGIRRAYEAKFSKPPQYA  122

Query  437  YSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQES  616
            +S++ALISRRQILQAACETLADP+SRR+YNQ L + E   +LTQ+P+DKVPGALCVLQE+
Sbjct  123  FSNDALISRRQILQAACETLADPTSRREYNQSLVDDEEAAILTQIPFDKVPGALCVLQEA  182

Query  617  GDTELVLQI  643
            G+TELVL+I
Sbjct  183  GETELVLEI  191



>ref|XP_006596571.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X2 [Glycine max]
Length=730

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 140/189 (74%), Gaps = 9/189 (5%)
 Frame = +2

Query  83   LGICSPR--LAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPSTST  256
            L +C+P      P   PN  +L R S++S GA+S   T   SKWA+RL ADFQFL   + 
Sbjct  10   LVLCTPHPTTTHPFTKPN--KLLR-SSLSRGAASLSAT---SKWAERLIADFQFL-GDAA  62

Query  257  PDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYG  436
                    + +++ P LD  ER VS+P+D YR+LGAEPHFLGDGIRRAYEA+ SKPPQY 
Sbjct  63   ASTSTSTLSPSSVPPRLDPPERYVSIPLDLYRILGAEPHFLGDGIRRAYEAKFSKPPQYA  122

Query  437  YSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQES  616
            +S++ALISRRQILQAACETLADP+SRR+YNQ L + E   +LTQ+P+DKVPGALCVLQE+
Sbjct  123  FSNDALISRRQILQAACETLADPTSRREYNQSLVDDEEAAILTQIPFDKVPGALCVLQEA  182

Query  617  GDTELVLQI  643
            G+TELVL+I
Sbjct  183  GETELVLEI  191



>gb|AAQ18644.1| truncated division protein [Arabidopsis thaliana]
Length=324

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 142/197 (72%), Gaps = 10/197 (5%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+AL+H+ +G+   +L     PP   +L R        +++ T  SASKWADRL +DF F
Sbjct  1    MEALSHVGIGLSPFQLCR--LPPATTKLRR------SHNTSTTICSASKWADRLLSDFNF  52

Query  239  LPSTSTPDPPDHKSTT--ATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEAR  412
               +S+       +T    +L P +D  ER+V +PIDFY+VLGA+ HFL DGIRRA+EAR
Sbjct  53   TSDSSSSSFATATTTATLVSLPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRAFEAR  112

Query  413  ISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPG  592
            +SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E  T++T VPWDKVPG
Sbjct  113  VSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLLDDEEATVITDVPWDKVPG  172

Query  593  ALCVLQESGDTELVLQI  643
            ALCVLQE G+TE+VL++
Sbjct  173  ALCVLQEGGETEIVLRV  189



>gb|KCW67921.1| hypothetical protein EUGRSUZ_F01622 [Eucalyptus grandis]
Length=728

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 123/167 (74%), Gaps = 12/167 (7%)
 Frame = +2

Query  170  ASSAPTTFSASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTPPLDIL---------ER  322
            A++     SASKWADRL ADFQF   T+T       S+ ++    L            ER
Sbjct  38   AAAPSVACSASKWADRLLADFQF---TTTDYSAASSSSASSAAATLSPPLAPPQLAPPER  94

Query  323  NVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLAD  502
             V +PIDFYRVLGAEPHFLGDGIRRAYEAR SKPP YG+S EALISRRQILQAACETLA 
Sbjct  95   YVPVPIDFYRVLGAEPHFLGDGIRRAYEARASKPPPYGFSSEALISRRQILQAACETLAK  154

Query  503  PSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            PSSRRDYNQGLA    +T+LTQVPWDKVPGALCVLQESG+ ELVL+I
Sbjct  155  PSSRRDYNQGLAEDTQETILTQVPWDKVPGALCVLQESGEAELVLRI  201



>ref|XP_010061021.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Eucalyptus grandis]
 gb|KCW67920.1| hypothetical protein EUGRSUZ_F01622 [Eucalyptus grandis]
Length=804

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 125/164 (76%), Gaps = 6/164 (4%)
 Frame = +2

Query  170  ASSAPTTFSASKWADRLFADFQFLPST-STPDPPDHKSTTATLTPPLDIL-----ERNVS  331
            A++     SASKWADRL ADFQF  +  S        S  ATL+PPL        ER V 
Sbjct  38   AAAPSVACSASKWADRLLADFQFTTTDYSAASSSSASSAAATLSPPLAPPQLAPPERYVP  97

Query  332  LPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSS  511
            +PIDFYRVLGAEPHFLGDGIRRAYEAR SKPP YG+S EALISRRQILQAACETLA PSS
Sbjct  98   VPIDFYRVLGAEPHFLGDGIRRAYEARASKPPPYGFSSEALISRRQILQAACETLAKPSS  157

Query  512  RRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            RRDYNQGLA    +T+LTQVPWDKVPGALCVLQESG+ ELVL+I
Sbjct  158  RRDYNQGLAEDTQETILTQVPWDKVPGALCVLQESGEAELVLRI  201



>ref|NP_199063.1| protein accumulation and replication of chloroplasts 6 [Arabidopsis 
thaliana]
 sp|Q9FIG9.1|ARC6_ARATH RecName: Full=Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10489.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13895.1| unknown protein [Arabidopsis thaliana]
 gb|AAN12907.1| unknown protein [Arabidopsis thaliana]
 gb|AED94815.1| protein accumulation and replication of chloroplasts 6 [Arabidopsis 
thaliana]
Length=801

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 143/201 (71%), Gaps = 18/201 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ----PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFA  226
            M+AL+H+ +G+       P Q    PP   +L R        +++ T  SASKWADRL +
Sbjct  1    MEALSHVGIGLS------PFQLCRLPPATTKLRR------SHNTSTTICSASKWADRLLS  48

Query  227  DFQFLPSTSTPDPPDHKSTTATLTPP--LDILERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
            DF F   +S+       +T   ++PP  +D  ER+V +PIDFY+VLGA+ HFL DGIRRA
Sbjct  49   DFNFTSDSSSSSFATATTTATLVSPPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRA  108

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            +EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E  T++T VPWD
Sbjct  109  FEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLLDDEEATVITDVPWD  168

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE G+TE+VL++
Sbjct  169  KVPGALCVLQEGGETEIVLRV  189



>emb|CDY61131.1| BnaCnng37370D [Brassica napus]
Length=782

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (72%), Gaps = 16/199 (8%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTF-SASKWADRLFADFQ  235
            M+AL HL + +   ++    + P A +L R    S  +S   TT  SAS+WADRL +DF 
Sbjct  1    MEALGHLGIALFPFQIC---RLPPATKLRR----SLPSSPVITTVCSASRWADRLLSDFN  53

Query  236  FLPSTSTPDPPDHKSTTATL-TPPLDIL--ERNVSLPIDFYRVLGAEPHFLGDGIRRAYE  406
            F     T D     + TATL +PPL I   ER+V +PIDFY+VLGAE HFL DGIRRA+E
Sbjct  54   F-----TTDSSSVATATATLASPPLSIDRPERHVPIPIDFYQVLGAETHFLTDGIRRAFE  108

Query  407  ARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKV  586
            AR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR YN+ L + E  T++T VPWDKV
Sbjct  109  ARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRRGYNESLLDDEEATVITDVPWDKV  168

Query  587  PGALCVLQESGDTELVLQI  643
            PGALCVLQE+G+TE+VL++
Sbjct  169  PGALCVLQEAGETEVVLRV  187



>gb|KFK32921.1| hypothetical protein AALP_AA6G306600 [Arabis alpina]
Length=794

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 140/198 (71%), Gaps = 17/198 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQF  238
            M+AL H+ +G+   +L    + P A +L R +          T  SAS+WADRL +DF F
Sbjct  1    MEALGHVGIGLLPFQLH---RIPPATKLRRSN------HHTTTICSASRWADRLLSDFNF  51

Query  239  LPSTSTPDPPDHKSTTATLTPP---LDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEA  409
                 T D      +TATL  P   +D  ERNV +PIDFY+VLGA+ HFL DGIRRA+EA
Sbjct  52   -----TSDSSSSSLSTATLISPPPTIDRPERNVPIPIDFYQVLGAQTHFLTDGIRRAFEA  106

Query  410  RISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVP  589
            ++SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E  T+ T VPW+KVP
Sbjct  107  KVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLVDDEEATVFTDVPWEKVP  166

Query  590  GALCVLQESGDTELVLQI  643
            GALCVLQE+G+TE+VL++
Sbjct  167  GALCVLQEAGETEVVLRV  184



>gb|AAQ18646.1| division protein [Arabidopsis thaliana]
Length=801

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 142/201 (71%), Gaps = 18/201 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ----PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFA  226
            M+AL+H+ +G+       P Q    PP   +L R        +++ T  SASKWADRL +
Sbjct  1    MEALSHVGIGLS------PFQLCRLPPATTKLRR------SHNTSTTICSASKWADRLLS  48

Query  227  DFQFLPSTSTPDPPDHKSTT--ATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
            DF F   +S+       +T    +L P +D  ER+V +PIDFY+VLGA+ HFL DGIRRA
Sbjct  49   DFNFTSDSSSSSFATATTTATLVSLPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRA  108

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            +EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E  T++T VPWD
Sbjct  109  FEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLLDDEGATVITDVPWD  168

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE G+TE+VL++
Sbjct  169  KVPGALCVLQEGGETEIVLRV  189



>gb|AAQ18645.1| division protein [Arabidopsis thaliana]
Length=801

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 142/201 (71%), Gaps = 18/201 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ----PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFA  226
            M+AL+H+ +G+       P Q    PP   +L R        +++ T  SASKWADRL +
Sbjct  1    MEALSHVGIGLS------PFQLCRLPPATTKLRR------SHNTSTTICSASKWADRLLS  48

Query  227  DFQFLPSTSTPDPPDHKSTT--ATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
            DF F   +S+       +T    +L P +D  ER+V +PIDFY+VLGA+ HFL DGIRRA
Sbjct  49   DFNFTSDSSSSSFATATTTATLVSLPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRA  108

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            +EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E  T++T VPWD
Sbjct  109  FEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLLDDEEATVITDVPWD  168

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE G+TE+VL++
Sbjct  169  KVPGALCVLQEGGETEIVLRV  189



>ref|XP_006854866.1| hypothetical protein AMTR_s00182p00037730 [Amborella trichopoda]
 gb|ERN16333.1| hypothetical protein AMTR_s00182p00037730 [Amborella trichopoda]
Length=795

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 137/202 (68%), Gaps = 15/202 (7%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGG------ASSAPTTFSASKWADRL  220
            M+  +H   G+ SP   PP   P      +F    GG       S +P T  +SKWA+RL
Sbjct  1    MEVYSH---GLYSPHFPPPKSRPKTLIDPKF----GGNFAQRLQSRSPITCFSSKWAERL  53

Query  221  FADFQFLPSTSTPDPPDHKSTTATLTPPLDIL-ERNVSLPIDFYRVLGAEPHFLGDGIRR  397
              DF   PS  T +      T ++L PP  I+ ER VSLP+DFY++LGAE HFLGDGIRR
Sbjct  54   LGDFHVQPS-ETSETGSSTLTLSSLLPPASIIPERKVSLPLDFYQILGAETHFLGDGIRR  112

Query  398  AYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPW  577
            AY++R+S+PPQ G+S EAL+ RRQIL+AACETLA+P SR +YNQGL   E  TL+T+VPW
Sbjct  113  AYDSRVSRPPQDGFSQEALMGRRQILEAACETLANPMSRGEYNQGLLVDENATLMTEVPW  172

Query  578  DKVPGALCVLQESGDTELVLQI  643
            DKVPGALCVLQE G+TE+VL++
Sbjct  173  DKVPGALCVLQEVGETEVVLEV  194



>ref|XP_006403373.1| hypothetical protein EUTSA_v10003151mg [Eutrema salsugineum]
 gb|ESQ44826.1| hypothetical protein EUTSA_v10003151mg [Eutrema salsugineum]
Length=799

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 141/200 (71%), Gaps = 17/200 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQP---PNARRLHRFSAVSGGASSAPTTF--SASKWADRLF  223
            M+AL H+++ +       P Q    P A +L R        +S PTT   SAS+WADRL 
Sbjct  1    MEALGHVSISLF------PFQKCRIPPATKLSR------SQTSVPTTTICSASRWADRLL  48

Query  224  ADFQFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAY  403
            +DF F   +S+       +T  +  P +D  ER+V +PIDFY+VLGAE HFL DGIRRA+
Sbjct  49   SDFNFTSDSSSSSVATATATLVSPPPSIDRPERHVPIPIDFYQVLGAETHFLTDGIRRAF  108

Query  404  EARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDK  583
            EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E   ++T VPW+K
Sbjct  109  EARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLLDAEEAIVITDVPWEK  168

Query  584  VPGALCVLQESGDTELVLQI  643
            VPGALCVLQE+G+TE+VL++
Sbjct  169  VPGALCVLQEAGETEVVLRV  188



>ref|XP_006403374.1| hypothetical protein EUTSA_v10003151mg [Eutrema salsugineum]
 gb|ESQ44827.1| hypothetical protein EUTSA_v10003151mg [Eutrema salsugineum]
Length=801

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 141/200 (71%), Gaps = 17/200 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQP---PNARRLHRFSAVSGGASSAPTTF--SASKWADRLF  223
            M+AL H+++ +       P Q    P A +L R        +S PTT   SAS+WADRL 
Sbjct  1    MEALGHVSISLF------PFQKCRIPPATKLSR------SQTSVPTTTICSASRWADRLL  48

Query  224  ADFQFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAY  403
            +DF F   +S+       +T  +  P +D  ER+V +PIDFY+VLGAE HFL DGIRRA+
Sbjct  49   SDFNFTSDSSSSSVATATATLVSPPPSIDRPERHVPIPIDFYQVLGAETHFLTDGIRRAF  108

Query  404  EARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDK  583
            EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E   ++T VPW+K
Sbjct  109  EARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLLDAEEAIVITDVPWEK  168

Query  584  VPGALCVLQESGDTELVLQI  643
            VPGALCVLQE+G+TE+VL++
Sbjct  169  VPGALCVLQEAGETEVVLRV  188



>ref|XP_006280025.1| hypothetical protein CARUB_v10025901mg [Capsella rubella]
 gb|EOA12923.1| hypothetical protein CARUB_v10025901mg [Capsella rubella]
Length=770

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 147/201 (73%), Gaps = 15/201 (7%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ----PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFA  226
            M+AL+H+ +G+       P Q    PP+  +L R S  +   +S  TT SASKWADRL +
Sbjct  1    MEALSHVGIGLF------PFQLCRLPPSTTKLRRSSHHN---TSTTTTCSASKWADRLLS  51

Query  227  DFQFLPSTSTPDPPDHKSTTATLTPP--LDILERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
            DF F   +++       +T   ++PP  +D  ER++ +PIDFY+VLGA+ HFL DGIRRA
Sbjct  52   DFNFTSDSTSSSLTTATATATLVSPPPSIDRPERHIPIPIDFYQVLGAQTHFLTDGIRRA  111

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            +EAR+SKPPQ+G+S + LISRRQILQAACETL++P SRR+YN+GL + E  T++T+VPW+
Sbjct  112  FEARVSKPPQFGFSDDVLISRRQILQAACETLSNPRSRREYNEGLVDDEEATVITEVPWE  171

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE+G+TE+VL++
Sbjct  172  KVPGALCVLQEAGETEIVLRV  192



>ref|XP_006280026.1| hypothetical protein CARUB_v10025901mg [Capsella rubella]
 gb|EOA12924.1| hypothetical protein CARUB_v10025901mg [Capsella rubella]
Length=805

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 147/201 (73%), Gaps = 15/201 (7%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ----PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFA  226
            M+AL+H+ +G+       P Q    PP+  +L R S  +   +S  TT SASKWADRL +
Sbjct  1    MEALSHVGIGLF------PFQLCRLPPSTTKLRRSSHHN---TSTTTTCSASKWADRLLS  51

Query  227  DFQFLPSTSTPDPPDHKSTTATLTPP--LDILERNVSLPIDFYRVLGAEPHFLGDGIRRA  400
            DF F   +++       +T   ++PP  +D  ER++ +PIDFY+VLGA+ HFL DGIRRA
Sbjct  52   DFNFTSDSTSSSLTTATATATLVSPPPSIDRPERHIPIPIDFYQVLGAQTHFLTDGIRRA  111

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            +EAR+SKPPQ+G+S + LISRRQILQAACETL++P SRR+YN+GL + E  T++T+VPW+
Sbjct  112  FEARVSKPPQFGFSDDVLISRRQILQAACETLSNPRSRREYNEGLVDDEEATVITEVPWE  171

Query  581  KVPGALCVLQESGDTELVLQI  643
            KVPGALCVLQE+G+TE+VL++
Sbjct  172  KVPGALCVLQEAGETEIVLRV  192



>ref|XP_010907355.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Elaeis guineensis]
Length=814

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  185  TTFSASKWADRLFADFQFLPSTSTPDPPDHKS-TTATLTPPLDILERNVSLPIDFYRVLG  361
            T   ASKWADRL  DF FLP+ + P  P   +    +L PP    +R V+LP+DFY+VLG
Sbjct  56   TACRASKWADRLLGDFHFLPTATKPSRPSSPNPAVLSLLPPA-TADRTVALPLDFYKVLG  114

Query  362  AEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLAN  541
            AE HFLGDGIRRA+EAR+SKPPQYG+S E LI+RRQILQAAC+TL++P+SR DYN GL +
Sbjct  115  AESHFLGDGIRRAFEARVSKPPQYGFSTETLIARRQILQAACDTLSNPTSRGDYNLGLDD  174

Query  542  HEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
                T  T VPWDK+PGALC+LQE+G+TE+VL++
Sbjct  175  DPNSTPTTHVPWDKIPGALCLLQEAGETEVVLRV  208



>ref|XP_010907356.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X2 [Elaeis guineensis]
Length=786

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  185  TTFSASKWADRLFADFQFLPSTSTPDPPDHKS-TTATLTPPLDILERNVSLPIDFYRVLG  361
            T   ASKWADRL  DF FLP+ + P  P   +    +L PP    +R V+LP+DFY+VLG
Sbjct  56   TACRASKWADRLLGDFHFLPTATKPSRPSSPNPAVLSLLPPA-TADRTVALPLDFYKVLG  114

Query  362  AEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLAN  541
            AE HFLGDGIRRA+EAR+SKPPQYG+S E LI+RRQILQAAC+TL++P+SR DYN GL +
Sbjct  115  AESHFLGDGIRRAFEARVSKPPQYGFSTETLIARRQILQAACDTLSNPTSRGDYNLGLDD  174

Query  542  HEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
                T  T VPWDK+PGALC+LQE+G+TE+VL++
Sbjct  175  DPNSTPTTHVPWDKIPGALCLLQEAGETEVVLRV  208



>ref|XP_008777706.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Phoenix dactylifera]
Length=722

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +2

Query  197  ASKWADRLFADFQFLPSTSTPDPPDHKS-TTATLTPPLDILERNVSLPIDFYRVLGAEPH  373
            ASKWADRL  DF FLP+ + P  P   +    +L PP    +R V LP+DFY+VLGAE H
Sbjct  61   ASKWADRLLGDFHFLPTATEPSRPSSPNPAVLSLLPPA-AADRTVPLPLDFYKVLGAETH  119

Query  374  FLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFD  553
            FLGDGIRR +EAR+SKPPQYG+S EA I+RRQILQAAC+TL++ +SR DYN GLA+    
Sbjct  120  FLGDGIRRTFEARVSKPPQYGFSTEARIARRQILQAACDTLSNTTSRGDYNLGLADDPDS  179

Query  554  TLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            TL T VPWDKVPGALCVLQE+G+TE+VL++
Sbjct  180  TLTTHVPWDKVPGALCVLQEAGETEVVLRV  209



>ref|XP_002865514.1| hypothetical protein ARALYDRAFT_494787 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41773.1| hypothetical protein ARALYDRAFT_494787 [Arabidopsis lyrata subsp. 
lyrata]
Length=800

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 142/199 (71%), Gaps = 16/199 (8%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ----PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFA  226
            M++L+H+ +G+       P Q    PP   +L R        +++ T  SASKWADRL +
Sbjct  1    MESLSHVGIGLF------PFQLCRLPPATTKLRR------SHNTSTTICSASKWADRLLS  48

Query  227  DFQFLPSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYE  406
            DF F   +S+       +T  +  P +D  ER++ +PIDFY+VLGA+ HFL DGIRR++E
Sbjct  49   DFNFTSDSSSSSFATATATLVSPPPSIDRPERHIPIPIDFYQVLGAQTHFLTDGIRRSFE  108

Query  407  ARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKV  586
            AR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E  T++T VPW+KV
Sbjct  109  ARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLVDDEEATVITDVPWEKV  168

Query  587  PGALCVLQESGDTELVLQI  643
            PGALCVLQE+G+TE+VL++
Sbjct  169  PGALCVLQEAGETEVVLRV  187



>ref|XP_003589356.1| hypothetical protein MTR_1g023310 [Medicago truncatula]
 gb|AES59607.1| protein accumulation AND replication OFs protein [Medicago truncatula]
Length=796

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 132/178 (74%), Gaps = 11/178 (6%)
 Frame = +2

Query  131  ARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPSTSTPDPPDHKSTTA---TLTP  301
            +RRL RFS       S+  + + SKWA+RL +DFQFL  TS+       +T     +  P
Sbjct  18   SRRLTRFSKKPNRLHSSAVS-ATSKWAERLISDFQFLGDTSSSSSTTTSATVTLTPSYPP  76

Query  302  PLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQA  481
            P+   ER+VSLP+D Y++LGAE HFLGDGIRRAYEA+ SKPPQY +S+EALISRRQILQA
Sbjct  77   PI---ERHVSLPLDLYKILGAETHFLGDGIRRAYEAKFSKPPQYAFSNEALISRRQILQA  133

Query  482  ACETLADPSSRRDYNQGLA----NHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            ACETLADP+SRR+YNQ L       E  ++LT++P+DKVPGALCVLQE+G+TELVL+I
Sbjct  134  ACETLADPASRREYNQSLVDDEDEDEESSILTEIPFDKVPGALCVLQEAGETELVLRI  191



>ref|XP_010494186.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Camelina sativa]
Length=800

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 139/202 (69%), Gaps = 22/202 (11%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQ----PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFA  226
            M+AL+H+ +G+       P Q    PP   +L R       +++  T  SASKWADRL  
Sbjct  1    MEALSHVGIGLF------PFQLCRLPPATTKLRR---SHNTSTTTTTICSASKWADRL--  49

Query  227  DFQFLPSTSTPDPPDHKSTTATLTPP---LDILERNVSLPIDFYRVLGAEPHFLGDGIRR  397
                L   +          TATL  P   +D  ER+V +PIDFY+VLGA+ HFL DGIRR
Sbjct  50   ----LSDFNFSSDSSSSVATATLVSPPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRR  105

Query  398  AYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPW  577
            A+EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+YN+GL + E  T++T+VPW
Sbjct  106  AFEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLVDDEEATVITEVPW  165

Query  578  DKVPGALCVLQESGDTELVLQI  643
            +KVPGALCVLQE+G+TE+VL++
Sbjct  166  EKVPGALCVLQEAGETEVVLRV  187



>ref|XP_009101846.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Brassica rapa]
 emb|CDY22390.1| BnaA06g37120D [Brassica napus]
Length=783

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 121/155 (78%), Gaps = 5/155 (3%)
 Frame = +2

Query  185  TTFSASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTPP--LDILERNVSLPIDFYRVL  358
            T  SAS+WADRL  DF F   +S+       ST   ++PP  +D  ER+V++PIDFY VL
Sbjct  38   TVCSASRWADRLLPDFNFTTDSSSSS---SASTATLVSPPPSIDRPERHVAIPIDFYEVL  94

Query  359  GAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLA  538
            GAE HFL DGIRRA+EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+Y++ L 
Sbjct  95   GAETHFLTDGIRRAFEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYDESLV  154

Query  539  NHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            + E  T+ T VPWDKVPGALCVLQE+G+TE+VL++
Sbjct  155  DDEAATVFTDVPWDKVPGALCVLQEAGETEVVLRV  189



>ref|XP_009101847.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X2 [Brassica rapa]
Length=781

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 121/155 (78%), Gaps = 5/155 (3%)
 Frame = +2

Query  185  TTFSASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTPP--LDILERNVSLPIDFYRVL  358
            T  SAS+WADRL  DF F   +S+       ST   ++PP  +D  ER+V++PIDFY VL
Sbjct  38   TVCSASRWADRLLPDFNFTTDSSSSS---SASTATLVSPPPSIDRPERHVAIPIDFYEVL  94

Query  359  GAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLA  538
            GAE HFL DGIRRA+EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+Y++ L 
Sbjct  95   GAETHFLTDGIRRAFEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYDESLV  154

Query  539  NHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            + E  T+ T VPWDKVPGALCVLQE+G+TE+VL++
Sbjct  155  DDEAATVFTDVPWDKVPGALCVLQEAGETEVVLRV  189



>gb|KHN12665.1| Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic 
[Glycine soja]
Length=836

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 141/233 (61%), Gaps = 53/233 (23%)
 Frame = +2

Query  80   NLGICSPRLAPPLQ---PPNARRLHRFSAVSGGASSAPTTFSASKWADRLFADFQFLPST  250
             L  C+P     LQ    PN  +L R S+  GGAS + T    SKWA+RL ADFQFL   
Sbjct  9    GLAFCTPHPTTTLQRFTKPN--KLLR-SSSRGGASLSAT----SKWAERLIADFQFLGDA  61

Query  251  STPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQ  430
            +         + +++ P LD  ER VS+P+D YR+LGAEPHFLGDGIRRAYEA+ SKPPQ
Sbjct  62   AASTST-STLSPSSVPPRLDPPERYVSIPLDLYRILGAEPHFLGDGIRRAYEAKFSKPPQ  120

Query  431  YGYSHEALISRRQILQAACETLADPS----------------------------------  508
            Y +S++ALISRRQILQAACETLADP+                                  
Sbjct  121  YAFSNDALISRRQILQAACETLADPTSRREAYEAKFSKPPQYAFSNDALISRRQILQAAC  180

Query  509  -------SRRDYNQGLA-NHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
                   SRR+YNQGL  +HE   +LTQ+P+DKVPGALCVLQE+G+TELVL+I
Sbjct  181  ETLADPASRREYNQGLVDDHEDAAILTQIPFDKVPGALCVLQEAGETELVLEI  233



>gb|AIU49242.1| ARC6, partial [Eucalyptus grandis]
Length=544

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FYRVLGAEPHFLGDGIRRAYEAR SKPP YG+S EALISRRQILQAACETLA PSSRRDY
Sbjct  1    FYRVLGAEPHFLGDGIRRAYEARASKPPPYGFSSEALISRRQILQAACETLAKPSSRRDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGLA    DT+LTQVPWDKVPGALCVLQESG+ ELVL+I
Sbjct  61   NQGLAE---DTILTQVPWDKVPGALCVLQESGEAELVLRI  97



>gb|AIU49259.1| ARC6, partial [Populus trichocarpa]
Length=544

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 94/100 (94%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGI+RAYEAR+SKPPQYG+S +AL+SRRQILQAACETLADP+SRRDY
Sbjct  1    FYQVLGAETHFLGDGIKRAYEARVSKPPQYGFSQDALVSRRQILQAACETLADPASRRDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL +   DT++TQVPWDKVPGALCVLQE+G+TE+VLQI
Sbjct  61   NQGLID---DTIVTQVPWDKVPGALCVLQEAGETEVVLQI  97



>gb|AIU49256.1| ARC6, partial [Erythranthe guttata]
Length=544

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FYRVLGAE HFLGDGIRRAY+AR+SK PQYGYS + LISRRQILQAACETLA+PSSRR+Y
Sbjct  1    FYRVLGAESHFLGDGIRRAYDARVSKQPQYGYSDDVLISRRQILQAACETLANPSSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGLA    DT+LTQVPWDKVPGALCVLQE+G+TELVL+I
Sbjct  61   NQGLAE---DTILTQVPWDKVPGALCVLQETGETELVLRI  97



>gb|AIU49258.1| ARC6, partial [Solanum tuberosum]
Length=544

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FYRVLGAE HFLGDGIRR Y+ARI+KPPQYGYS EALI RRQILQAACETL D +SRR+Y
Sbjct  1    FYRVLGAEAHFLGDGIRRCYDARITKPPQYGYSQEALIGRRQILQAACETLVDSTSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGLA H   T+LT VPWDKVPGA+CVLQE+G+TE+VLQI
Sbjct  61   NQGLAQH---TILTPVPWDKVPGAMCVLQEAGETEVVLQI  97



>gb|AIU49260.1| ARC6, partial [Prunus persica]
Length=545

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGA+ HFLGDGIRRAYEAR SKPPQYG++ EAL SRRQIL AACETLADP SRR+Y
Sbjct  1    FYQVLGAQQHFLGDGIRRAYEARASKPPQYGFTQEALFSRRQILLAACETLADPRSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGLA    DT+LTQVPWDKVPGALCVLQE+G TELVLQI
Sbjct  61   NQGLAE---DTILTQVPWDKVPGALCVLQEAGKTELVLQI  97



>ref|XP_009393636.1| PREDICTED: LOW QUALITY PROTEIN: protein ACCUMULATION AND REPLICATION 
OF CHLOROPLASTS 6, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=797

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 125/205 (61%), Gaps = 19/205 (9%)
 Frame = +2

Query  59   MDALTHLNLGICSPRLAPPLQPPNARRLHRFSAVSGGASSAPTTFS-------ASKWADR  217
            M+ L +   G+   RL P L        HR  + S    SAP   S       +SKWADR
Sbjct  1    METLNYF--GVACLRLPPLL-------FHRSPSSSSSFKSAPFLRSKNTVVCRSSKWADR  51

Query  218  LFADFQFLPSTSTPDPP---DHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDG  388
            L  DF F  +T+  +P          A L P          LPIDFY+VLGAE H LGDG
Sbjct  52   LLGDFHFPTATAIENPSALSPDPXLLALLPPLPFPPPPAPPLPIDFYQVLGAETHLLGDG  111

Query  389  IRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQ  568
            IRRA+EAR+SKPPQYGYS +AL+ RRQILQAA +TL DPSSR DYN+ +      T+ T 
Sbjct  112  IRRAFEARVSKPPQYGYSQDALVGRRQILQAAFDTLFDPSSREDYNRSIVEDPDSTITTY  171

Query  569  VPWDKVPGALCVLQESGDTELVLQI  643
            VPWDKVPGALCVLQE+G+TELVLQ+
Sbjct  172  VPWDKVPGALCVLQEAGETELVLQV  196



>gb|AIU49271.1| ARC6, partial [Vitis vinifera]
Length=544

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRAYEAR+SKPPQYGYS EALISRRQILQAACETLA+P S+R+Y
Sbjct  1    FYQVLGAEAHFLGDGIRRAYEARVSKPPQYGYSQEALISRRQILQAACETLANPRSKREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            +QGLA    DT++TQVPWDKVPGALCVLQE+G+ E+VL I
Sbjct  61   SQGLAE---DTIITQVPWDKVPGALCVLQEAGENEIVLHI  97



>gb|AIU49268.1| ARC6, partial [Solanum lycopersicum]
Length=544

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FYRVLGAE HFLGDGIRR Y+ARI+KPPQYGYS EALI RRQILQAACETLAD +SRR+Y
Sbjct  1    FYRVLGAEAHFLGDGIRRCYDARITKPPQYGYSQEALIGRRQILQAACETLADSTSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGLA H   T+LT VPWDKVPGALCVLQE+G+T +VLQI
Sbjct  61   NQGLAQH---TILTPVPWDKVPGALCVLQEAGETGVVLQI  97



>gb|AIU49234.1| ARC6, partial [Theobroma cacao]
Length=544

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 93/100 (93%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGI+RAYEAR+SKPPQYG+S ++L+SRRQILQAACETLA+P SRR+Y
Sbjct  1    FYKVLGAETHFLGDGIKRAYEARVSKPPQYGFSQDSLLSRRQILQAACETLANPGSRRNY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL +   DT++TQVPWDKVPGALCVLQE+G+TE+VL+I
Sbjct  61   NQGLVD---DTIITQVPWDKVPGALCVLQEAGETEVVLRI  97



>gb|AIU49238.1| ARC6, partial [Gossypium raimondii]
Length=544

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRAYEAR+SKPPQYG+S + +ISRRQIL AACETL++P SRR+Y
Sbjct  1    FYKVLGAETHFLGDGIRRAYEARVSKPPQYGFSQDTIISRRQILLAACETLSNPGSRRNY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL +   DT++TQVPWDKVPGALCVLQE+G+TE+VLQI
Sbjct  61   NQGLVD---DTIITQVPWDKVPGALCVLQEAGETEVVLQI  97



>gb|AIU49237.1| ARC6, partial [Citrus clementina]
Length=512

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+ LGAE HFLGDGIRRAYEARISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+Y
Sbjct  1    FYQALGAETHFLGDGIRRAYEARISKPPQYGFSPDALISRRQILQAACETLANASSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGLA+   DT+LT+VPWDKVPGAL VLQE+G+TE+VL+I
Sbjct  61   NQGLAD---DTILTEVPWDKVPGALLVLQEAGETEVVLRI  97



>gb|AIU49243.1| ARC6, partial [Glycine max]
Length=544

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
             YR+LGAEPHFLGDGIRRAYEA+ SKPPQY +S++ALISRRQILQAACETLADP+SRR+Y
Sbjct  1    LYRILGAEPHFLGDGIRRAYEAKFSKPPQYAFSNDALISRRQILQAACETLADPTSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQ L +   D +LTQ+P+DKVPGALCVLQE+G+TELVL+I
Sbjct  61   NQSLVD---DAILTQIPFDKVPGALCVLQEAGETELVLEI  97



>gb|AIU49241.1| ARC6, partial [Citrus sinensis]
Length=544

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+ LGAE HFLGDGIRRAYEARISKPPQYG+S +ALISRRQILQAACETLA+ SSRR+Y
Sbjct  1    FYQALGAETHFLGDGIRRAYEARISKPPQYGFSPDALISRRQILQAACETLANASSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGLA+   DT+LT+VPWDKVPGAL VLQE+G+TE+VL+I
Sbjct  61   NQGLAD---DTILTEVPWDKVPGALLVLQEAGETEVVLRI  97



>gb|AIU49247.1| ARC6, partial [Chloranthus japonicus]
Length=544

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGI+RAY+AR+SKPPQ G+S EAL+SRRQILQAACETLA+P +R DY
Sbjct  1    FYQVLGAETHFLGDGIKRAYDARVSKPPQDGFSQEALMSRRQILQAACETLANPRTRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL     DTL+T+VPWDKVPGALCVLQE+G+TE+VLQI
Sbjct  61   NQGLVE---DTLITEVPWDKVPGALCVLQEAGETEVVLQI  97



>gb|AIU49236.1| ARC6, partial [Sarcandra glabra]
Length=544

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGI+RAY+AR+SKPPQ G+S EAL+SRRQILQAACETLA+P SR DY
Sbjct  1    FYQVLGAETHFLGDGIKRAYDARVSKPPQDGFSQEALVSRRQILQAACETLANPRSRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL     DTL+T+VPWDKVPG LCVLQE+G+TE+VLQI
Sbjct  61   NQGLVE---DTLITEVPWDKVPGVLCVLQEAGETEVVLQI  97



>ref|XP_004952074.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Setaria italica]
Length=762

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +2

Query  194  SASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTPPL--DILERNVSLPIDFYRVLGAE  367
            +AS+WADRLFADF  LP+ +  DPP   S++++   P+  D  +R + LP+DFY++LGAE
Sbjct  39   AASRWADRLFADFHLLPTAAAADPPAAASSSSSPFVPVFPDAADRALPLPVDFYKILGAE  98

Query  368  PHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHE  547
            PHFLGDGIRRA+EARI+KPPQYGYS EAL+ RRQ+LQ A +TL + SSR +Y++ L+   
Sbjct  99   PHFLGDGIRRAFEARIAKPPQYGYSTEALVGRRQMLQLAHDTLTNQSSRTEYDRALSEDR  158

Query  548  FDTLLTQVPWDKVPGALCVLQESGDTELVL  637
              TL   V WDKVPG LCVLQE+G+  LVL
Sbjct  159  DATLTMDVAWDKVPGVLCVLQEAGEAPLVL  188



>ref|XP_002453221.1| hypothetical protein SORBIDRAFT_04g001860 [Sorghum bicolor]
 gb|EES06197.1| hypothetical protein SORBIDRAFT_04g001860 [Sorghum bicolor]
Length=762

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +2

Query  194  SASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTPPL--DILERNVSLPIDFYRVLGAE  367
            +AS+WADRLFADF  LP+ +    P   + +++   PL  D  +R + LP+DFY++LGAE
Sbjct  39   AASRWADRLFADFHLLPTATAAADPPAAAPSSSPFVPLFPDAADRALPLPVDFYKILGAE  98

Query  368  PHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHE  547
            PHFLGDGIRRA+E+RI+KPPQYGYS EAL+ RRQ+LQ A +TL + SSR +Y++ L+   
Sbjct  99   PHFLGDGIRRAFESRIAKPPQYGYSTEALVGRRQMLQIAHDTLTNQSSRTEYDRALSEDR  158

Query  548  FDTLLTQVPWDKVPGALCVLQESGDTELVL  637
               L   V WDKVPG LCVLQE+G+ +LVL
Sbjct  159  DAALTMDVAWDKVPGVLCVLQEAGEAQLVL  188



>gb|AIU49272.1| ARC6, partial [Lactuca sativa]
Length=544

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FYRVLGAE HFLGDGIRR YEAR  KPPQYGYS +ALISRRQILQAACETLA+PSS+R+Y
Sbjct  1    FYRVLGAEAHFLGDGIRRCYEARALKPPQYGYSDDALISRRQILQAACETLANPSSKREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GLA+   +T+LT VPWD VPGALCVLQE+G+ ELVL+I
Sbjct  61   NKGLAD---ETILTDVPWDNVPGALCVLQEAGEDELVLEI  97



>gb|AIU49280.1| ARC6, partial [Trachycarpus fortunei]
Length=543

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRA+EAR+SKPPQYG+S EALI+RRQILQAAC+TL++P+SR DY
Sbjct  1    FYKVLGAETHFLGDGIRRAFEARVSKPPQYGFSTEALIARRQILQAACDTLSNPTSRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N GLA+   DTL T VPWDKVPGALCVLQE+G+TE+VL++
Sbjct  61   NLGLAD---DTLTTHVPWDKVPGALCVLQEAGETEVVLRV  97



>gb|AIU49264.1| ARC6, partial [Ricinus communis]
Length=544

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 90/100 (90%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGI+RAY AR+SKPPQ G+S E LISRRQI+QAACETLA+P SRR+Y
Sbjct  1    FYQVLGAETHFLGDGIKRAYSARLSKPPQSGFSEETLISRRQIIQAACETLANPQSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL +   DT++TQVPWDKVPGALCVL+E+G+TE+VL+I
Sbjct  61   NQGLLD---DTIITQVPWDKVPGALCVLEEAGETEVVLEI  97



>gb|AIU49245.1| ARC6, partial [Buxus sinica]
Length=544

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 90/99 (91%), Gaps = 3/99 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRAY+AR+SKPPQ+G+S E+L+SRRQILQAACETLA+P SR DY
Sbjct  1    FYQVLGAETHFLGDGIRRAYDARVSKPPQHGFSQESLMSRRQILQAACETLANPRSRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQ  640
            NQGL     DTLLTQVPWDKVPGALC+LQE+G+TE+V++
Sbjct  61   NQGLLE---DTLLTQVPWDKVPGALCLLQEAGETEVVIR  96



>ref|NP_001148117.1| LOC100281725 [Zea mays]
 gb|ACF86369.1| unknown [Zea mays]
 gb|ACG29776.1| division protein [Zea mays]
 gb|ACN27652.1| unknown [Zea mays]
 gb|AFW66594.1| division protein [Zea mays]
Length=761

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = +2

Query  185  TTFSASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTPPL-DILERNVSLPIDFYRVLG  361
            T  +AS+WADRLFADF  LP+ + P      S+++   P   +  +R + LP+DFY++LG
Sbjct  36   TCRAASRWADRLFADFHLLPAAADPPAAASSSSSSPFVPIFPEAADRALPLPVDFYKILG  95

Query  362  AEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLAN  541
            AEPHFLGDGIRRA+E+RI+KPPQYGYS EAL+ RRQ+LQ A +TL + SSR +Y++ L+ 
Sbjct  96   AEPHFLGDGIRRAFESRIAKPPQYGYSTEALVGRRQMLQIAHDTLTNQSSRTEYDRALSE  155

Query  542  HEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
                 L   V WDKVPG LCVLQE+G+ +LVL
Sbjct  156  DRDAALTMDVAWDKVPGVLCVLQEAGEAQLVL  187



>gb|AIU49239.1| ARC6, partial [Carica papaya]
Length=544

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRAYEAR+SKPPQYG+S +ALISRRQILQAAC+ L+D +SRR+Y
Sbjct  1    FYKVLGAETHFLGDGIRRAYEARVSKPPQYGFSSDALISRRQILQAACDILSDFTSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQ L     DT++T+VPWDKVPGALCVLQE+G+TE+VL I
Sbjct  61   NQNLVE---DTIVTEVPWDKVPGALCVLQEAGETEIVLHI  97



>gb|AIU49262.1| ARC6, partial [Phaseolus vulgaris]
Length=544

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
             YRVLGAE HFLGDGIRRAYE + SKPPQY +S++ALISRRQILQAACETLADP+SRR+Y
Sbjct  1    LYRVLGAESHFLGDGIRRAYETKFSKPPQYAFSNDALISRRQILQAACETLADPTSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL +   D +LTQ+P+DKVPGALCVLQE+G+ ELVL+I
Sbjct  61   NQGLVD---DAILTQIPFDKVPGALCVLQEAGEQELVLEI  97



>gb|AIU49277.1| ARC6, partial [Houttuynia cordata]
Length=544

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRAY+AR+ KPPQYG+S EAL+SRRQILQAACETLAD  +R +Y
Sbjct  1    FYQVLGAETHFLGDGIRRAYDARVGKPPQYGFSQEALVSRRQILQAACETLADHRTRGEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL     DTL+T VPWDKVPGALCVLQE+G++ELV+QI
Sbjct  61   NQGLLE---DTLVTDVPWDKVPGALCVLQEAGESELVIQI  97



>gb|AIU49253.1| ARC6, partial [Medicago truncatula]
Length=544

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
             Y++LGAE HFLGDGIRRAYEA+ SKPPQY +S+EALISRRQILQAACETLADP+SRR+Y
Sbjct  1    LYKILGAETHFLGDGIRRAYEAKFSKPPQYAFSNEALISRRQILQAACETLADPASRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQ L +   D++LT++P+DKVPGALCVLQE+G+TELVL+I
Sbjct  61   NQSLVD---DSILTEIPFDKVPGALCVLQEAGETELVLRI  97



>gb|AIU49275.1| ARC6, partial [Platanus x acerifolia]
Length=544

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRAY+AR+SK PQYG+S +ALISRRQILQAACETLA+P SR +Y
Sbjct  1    FYQVLGAETHFLGDGIRRAYDARVSKQPQYGFSDDALISRRQILQAACETLANPRSRGEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL     DTL+T+VPWDKVPGALCVLQE+G+T +V+Q+
Sbjct  61   NQGLVE---DTLVTEVPWDKVPGALCVLQEAGETVVVIQV  97



>gb|AIU49228.1| ARC6, partial [Arabidopsis thaliana]
Length=543

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 90/100 (90%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGA+ HFL DGIRRA+EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+Y
Sbjct  1    FYQVLGAQTHFLTDGIRRAFEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL +   DT++T VPWDKVPGALCVLQE G+TE+VL++
Sbjct  61   NEGLLD---DTVITDVPWDKVPGALCVLQEGGETEIVLRV  97



>gb|AIU49232.1| ARC6, partial [Pinellia ternata]
Length=153

 Score =   151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRA+EAR S PP  G+S++AL+SRRQILQAAC+TL+ P+ R DY
Sbjct  1    FYKVLGAETHFLGDGIRRAFEARCSTPPLDGFSNDALLSRRQILQAACDTLSSPALRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQ L +   D LLTQVPWDKVPGALC+LQESG+ E+VLQ+
Sbjct  61   NQALVD---DALLTQVPWDKVPGALCLLQESGEAEVVLQV  97



>gb|AIU49255.1| ARC6, partial [Manihot esculenta]
Length=544

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGI+RAYEAR+SK PQYG+S +ALISRRQILQAACETLAD  SR +Y
Sbjct  1    FYQVLGAETHFLGDGIKRAYEARVSKQPQYGFSQDALISRRQILQAACETLADSKSRIEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQ L +   DT++T+VPWDKVPGALCVLQE+G+ E+VL+I
Sbjct  61   NQRLID---DTIITEVPWDKVPGALCVLQEAGEIEVVLEI  97



>gb|AIU49240.1| ARC6, partial [Capsella rubella]
Length=544

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGA+ HFL DGIRRA+EAR+SKPPQ+G+S + LISRRQILQAACETL++P SRR+Y
Sbjct  1    FYQVLGAQTHFLTDGIRRAFEARVSKPPQFGFSDDVLISRRQILQAACETLSNPRSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL +   DT++T+VPW+KVPGALCVLQE+G+TE+VL++
Sbjct  61   NEGLVD---DTVITEVPWEKVPGALCVLQEAGETEIVLRV  97



>gb|AIU49230.1| ARC6, partial [Magnolia denudata]
Length=544

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            F +VLGAE HFLGDGIRRAYEA++SKPPQYG+S +AL+SRRQIL AACETL++P SR +Y
Sbjct  1    FLQVLGAETHFLGDGIRRAYEAKVSKPPQYGFSQDALMSRRQILLAACETLSNPLSRGEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL     DTL+T VPWDKVPGALCVLQE+G+T+LVL+I
Sbjct  61   NQGLVE---DTLITDVPWDKVPGALCVLQEAGETQLVLEI  97



>gb|AIU49226.1| ARC6, partial [Aquilegia coerulea]
Length=544

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 88/100 (88%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRR+Y++R+S+PPQYG++ E LI+RRQILQAACETLA+ +SR+DY
Sbjct  1    FYQVLGAETHFLGDGIRRSYDSRVSQPPQYGFTQETLINRRQILQAACETLANSNSRQDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+ L     DTL+TQVPWDKVPGALCVLQESG T+LVL +
Sbjct  61   NRSLLE---DTLITQVPWDKVPGALCVLQESGQTQLVLNV  97



>gb|AIU49227.1| ARC6, partial [Arabidopsis lyrata]
Length=544

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 91/100 (91%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGA+ HFL DGIRR++EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+Y
Sbjct  1    FYQVLGAQTHFLTDGIRRSFEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL +   DT++T VPW+KVPGALCVLQE+G+TE+VL++
Sbjct  61   NEGLVD---DTVITDVPWEKVPGALCVLQEAGETEVVLRV  97



>gb|AIU49244.1| ARC6, partial [Illicium henryi]
Length=544

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRAY+AR++KPPQ G+S EAL+ RRQILQAACETLA+P SR +Y
Sbjct  1    FYQVLGAETHFLGDGIRRAYDARVTKPPQDGFSQEALMGRRQILQAACETLANPRSRGEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL     DTL+T+VPW+KVPGALCVLQE G+T LVL+I
Sbjct  61   NQGLME---DTLMTEVPWNKVPGALCVLQEMGETLLVLRI  97



>gb|AIU49231.1| ARC6, partial [Musa acuminata]
Length=544

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE H LGDGIRRA+EAR+SKPPQYGYS +AL+ RRQILQAA +TL DPSSR DY
Sbjct  1    FYQVLGAETHLLGDGIRRAFEARVSKPPQYGYSQDALVGRRQILQAAFDTLFDPSSREDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+ +     DT+ T VPWDKVPGALCVLQE+G+TELVLQ+
Sbjct  61   NRSIVE---DTITTYVPWDKVPGALCVLQEAGETELVLQV  97



>ref|XP_003573630.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Brachypodium distachyon]
Length=761

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +2

Query  194  SASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTP----PL--DILERNVSLPIDFYRV  355
            +AS+WADRLFADF  LPS +        +  A  +     PL  D  +R++ L +DFY+V
Sbjct  36   AASRWADRLFADFHLLPSATPAATDPPAAAPAGASTAPFVPLFPDAADRSLPLQVDFYKV  95

Query  356  LGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGL  535
            LGAEPHFLGDG++RA+EAR++KP Q+GYS +ALISRRQ+LQ A +TL + SSR +Y++ L
Sbjct  96   LGAEPHFLGDGVKRAFEARVAKPLQFGYSTDALISRRQMLQIAHDTLTNQSSRTEYDRAL  155

Query  536  ANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            + +    L   V WDKVPG LC LQE+G+ + VL I
Sbjct  156  SENRDAALTLDVAWDKVPGVLCALQEAGEAQAVLAI  191



>gb|AIU49274.1| ARC6, partial [Cinnamomum camphora]
Length=544

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 87/99 (88%), Gaps = 3/99 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY++LGAE HFLGDGIRRAY+A++S+PPQYG+S +AL+ RRQILQ ACETLA+P SR DY
Sbjct  1    FYQILGAETHFLGDGIRRAYDAKVSRPPQYGFSEDALMVRRQILQGACETLANPRSRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQ  640
            NQGL     +TL T+VPW+KVPGALCVLQE+G+T++VLQ
Sbjct  61   NQGLVE---ETLTTEVPWEKVPGALCVLQEAGETQVVLQ  96



>gb|AIU49270.1| ARC6, partial [Schrenkiella parvula]
Length=544

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFL DGIRRA+EAR+SKPPQ+G+S +ALISRRQILQAACETL++P SRR+Y
Sbjct  1    FYQVLGAETHFLTDGIRRAFEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL +     ++T VPW+KVPGALCVLQE+G+TE+VL++
Sbjct  61   NEGLLDA---IVITDVPWEKVPGALCVLQEAGETEVVLRV  97



>gb|AIU49251.1| ARC6, partial [Asparagus officinalis]
Length=544

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRA+EA++SKPPQ G+S EAL+ RRQILQAAC+TL++PS R DY
Sbjct  1    FYQVLGAETHFLGDGIRRAFEAKVSKPPQLGFSQEALVGRRQILQAACDTLSNPSLRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL +   +T  T VPWDKVPGALCVLQE+G+TE+VLQ+
Sbjct  61   NRGLLD---ETRTTHVPWDKVPGALCVLQEAGETEVVLQV  97



>gb|AIU49254.1| ARC6, partial [Canna indica]
Length=544

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE H LGDGIRRAYEAR+SKPPQYGYS +ALI RRQILQAA +TL+DP SR +Y
Sbjct  1    FYQVLGAETHLLGDGIRRAYEARVSKPPQYGYSQDALIGRRQILQAAYDTLSDPRSRGEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL     DT+   VPWDKVPGALCVLQE+G+TELVL++
Sbjct  61   NRGLVE---DTITLYVPWDKVPGALCVLQEAGETELVLRV  97



>gb|EEC72377.1| hypothetical protein OsI_05646 [Oryza sativa Indica Group]
 gb|EEE56207.1| hypothetical protein OsJ_05178 [Oryza sativa Japonica Group]
Length=769

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 107/155 (69%), Gaps = 7/155 (5%)
 Frame = +2

Query  194  SASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTP-----PL--DILERNVSLPIDFYR  352
            +AS+WA+RLFADF  LP+ +  DPP      A         PL  D  ER++ L +DFY+
Sbjct  41   AASRWAERLFADFHLLPTAAPSDPPSPAPAPAAAPSASPFVPLFPDAAERSLPLQVDFYK  100

Query  353  VLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQG  532
            VLGAEPHFLGDGIRRA+EARI+KPPQYGYS +AL+ RRQ+LQ A +TL + +SR  Y++ 
Sbjct  101  VLGAEPHFLGDGIRRAFEARIAKPPQYGYSTDALVGRRQMLQIAHDTLMNQNSRTQYDRA  160

Query  533  LANHEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
            L+ +  + L   + WDKVPG LC LQE+G+   VL
Sbjct  161  LSENREEALTMDIAWDKVPGVLCALQEAGEALAVL  195



>gb|AIU49265.1| ARC6, partial [Dioscorea oppositifolia]
Length=539

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+V+GAE HFL DGIRRA+EARISKPPQ GYS EAL+ RRQILQAAC+TL+DPS+RRDY
Sbjct  1    FYKVVGAETHFLADGIRRAFEARISKPPQLGYSSEALLGRRQILQAACDTLSDPSARRDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            ++GL +   DTL TQ+PWDKVPG LC LQE G+ E VL +
Sbjct  61   DRGLLD---DTLTTQIPWDKVPGTLCALQECGEAETVLLV  97



>gb|AIU49252.1| ARC6, partial [Aristolochia tagala]
Length=408

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 3/99 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRRAYEAR+SKPP YG+S EAL+SRRQILQAACETLA+  +R +Y
Sbjct  1    FYQVLGAETHFLGDGIRRAYEARVSKPPPYGFSQEALLSRRQILQAACETLANHQNRGEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQ  640
            N GL     DT++T VPWDKV GALCVLQE+G++E+V+Q
Sbjct  61   NLGLIE---DTIMTDVPWDKVAGALCVLQEAGESEVVIQ  96



>gb|AIU49266.1| ARC6, partial [Yucca filamentosa]
Length=544

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFL DGIRRA+EA++SKPPQ G+S EAL+ RRQILQAAC+TL +PSSR DY
Sbjct  1    FYQVLGAETHFLVDGIRRAFEAKVSKPPQLGFSQEALVGRRQILQAACDTLTNPSSRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL +   DT  T VPWDKVPGALCVLQE+G+TE+VL +
Sbjct  61   NRGLLD---DTRTTHVPWDKVPGALCVLQEAGETEVVLHV  97



>dbj|BAJ84942.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = +2

Query  194  SASKWADRLFADFQFLPSTSTPDPPDHK-STTATLTPPL--DILERNVSLPIDFYRVLGA  364
            +AS+WADRLFADF  LP+ +   P       +A+   PL  D  +R+  L +D Y+VLGA
Sbjct  40   AASRWADRLFADFHLLPAAAPEPPAAAPAGVSASPFVPLFPDAADRSFPLQVDLYKVLGA  99

Query  365  EPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANH  544
            EPHFLGDG+RRA+EAR +KPPQYGYS +AL+ RRQ+LQ A +TL + SSR +Y++ L+  
Sbjct  100  EPHFLGDGVRRAFEARTAKPPQYGYSTDALVGRRQMLQIAHDTLTNQSSRTEYDRALSED  159

Query  545  EFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
                L   V WDKVPG LC LQE+G+ + VL I
Sbjct  160  RGAALTLDVAWDKVPGVLCALQEAGEAQAVLAI  192



>gb|AIU49279.1| ARC6, partial [Alisma plantago-aquatica]
Length=544

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGIRR  EAR+S PP YGYS EAL++RRQILQAAC TL DP +R DY
Sbjct  1    FYQVLGAETHFLGDGIRRVCEARLSNPPVYGYSQEALLARRQILQAACNTLVDPDTRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL     D L T VPWDKVPGALC+LQESG+TE+VL++
Sbjct  61   NRGLME---DILATDVPWDKVPGALCLLQESGETEVVLEV  97



>gb|AIU49249.1| ARC6, partial [Chimonanthus praecox]
Length=544

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 86/100 (86%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY++LGAE HFLGDGIRRAY++++ K PQYG+S EAL+SRRQIL AAC+TLA+  SR DY
Sbjct  1    FYQILGAETHFLGDGIRRAYDSKVCKSPQYGFSQEALMSRRQILLAACDTLANVHSRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL     DTL+T VPWDKVPGALC+LQE+G+TE+VL++
Sbjct  61   NQGLIQ---DTLITDVPWDKVPGALCLLQEAGETEVVLEV  97



>gb|AIU49246.1| ARC6, partial [Iris japonica]
Length=544

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFL DGIRRAYEAR+SKP QYG+S EALI RRQILQAAC+TL++PSSR DY
Sbjct  1    FYQVLGAETHFLADGIRRAYEARVSKPSQYGFSQEALIGRRQILQAACDTLSNPSSRSDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            N+GL     DTL   VP DKVPGALC+LQE+G+ E +L++
Sbjct  61   NRGLTG---DTLTIHVPLDKVPGALCLLQEAGEAETILEV  97



>gb|AIU49235.1| ARC6, partial [Acorus calamus]
Length=542

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FYRVLGAE HFL DGIRR+++ARIS+PP YGYS +AL++RRQILQAACETL+D  SR DY
Sbjct  1    FYRVLGAETHFLSDGIRRSHDARISRPPAYGYSQDALVARRQILQAACETLSDARSRADY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            +QGL +   DT+ T VPWDKV GALCVLQE+G+T +VL +
Sbjct  61   DQGLVD---DTVATDVPWDKVGGALCVLQEAGETNVVLGV  97



>gb|AIU49250.1| ARC6, partial [Pandanus utilis]
Length=532

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 3/93 (3%)
 Frame = +2

Query  365  EPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANH  544
            E HFLGDGIRRA+EARISKPPQYGYS EAL+ RRQILQAAC+TL++P+SR DYN+GL + 
Sbjct  1    EVHFLGDGIRRAFEARISKPPQYGYSTEALVGRRQILQAACDTLSNPASRGDYNRGLFD-  59

Query  545  EFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
              DTL T VPWDKVPGALCVLQE G+ E VL++
Sbjct  60   --DTLTTHVPWDKVPGALCVLQECGEAETVLRV  90



>gb|AIU49248.1| ARC6, partial [Ceratophyllum demersum]
Length=544

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE HFLGDGI+RAY+A+ISKP Q G+S E L+SRRQILQAA ETL  P SR +Y
Sbjct  1    FYQVLGAETHFLGDGIKRAYDAKISKPLQDGFSQETLMSRRQILQAAFETLVHPRSRGEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQGL     DT++T VPWDKVPGA CVLQE+G +E+V+Q+
Sbjct  61   NQGLLE---DTIMTDVPWDKVPGAFCVLQEAGMSEIVIQV  97



>gb|AIU49276.1| ARC6, partial [Ginkgo biloba]
Length=544

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 83/100 (83%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAE H+LGDGI+RAYEA++S+ P+ GYS +A++ R+QILQ ACETLA+P SR DY
Sbjct  1    FYQVLGAETHYLGDGIKRAYEAKVSRVPEDGYSEDAIMGRKQILQTACETLANPRSRGDY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            NQ L     DTL+ +VPW+KVPGALC+LQE G+ ++VLQ+
Sbjct  61   NQELLE---DTLMREVPWNKVPGALCLLQEMGEADVVLQV  97



>gb|AIU49261.1| ARC6, partial [Panicum virgatum]
Length=544

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 80/98 (82%), Gaps = 3/98 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY++LGAEPHFLGDGIRRA+EARI+KPPQYGYS EAL+ RRQ+LQ A +TL + SSR +Y
Sbjct  1    FYKILGAEPHFLGDGIRRAFEARIAKPPQYGYSTEALVGRRQMLQLAHDTLTNQSSRTEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
            ++ L+    DTL   V WDKVPG LCVLQE+G+ +LVL
Sbjct  61   DRSLSE---DTLTMDVAWDKVPGVLCVLQEAGEAQLVL  95



>gb|AIU49267.1| ARC6, partial [Setaria italica]
Length=544

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY++LGAEPHFLGDGIRRA+EARI+KPPQYGYS EAL+ RRQ+LQ A +TL + SSR +Y
Sbjct  1    FYKILGAEPHFLGDGIRRAFEARIAKPPQYGYSTEALVGRRQMLQLAHDTLTNQSSRTEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
            ++ L+    DTL   V WDKVPG LCVLQE+G+  LVL
Sbjct  61   DRALSE---DTLTMDVAWDKVPGVLCVLQEAGEAPLVL  95



>gb|AIU49269.1| ARC6, partial [Sorghum bicolor]
Length=544

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY++LGAEPHFLGDGIRRA+E+RI+KPPQYGYS EAL+ RRQ+LQ A +TL + SSR +Y
Sbjct  1    FYKILGAEPHFLGDGIRRAFESRIAKPPQYGYSTEALVGRRQMLQIAHDTLTNQSSRTEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
            ++ L+    D L   V WDKVPG LCVLQE+G+ +LVL
Sbjct  61   DRALSE---DALTMDVAWDKVPGVLCVLQEAGEAQLVL  95



>gb|AIU49278.1| ARC6, partial [Zea mays]
Length=544

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY++LGAEPHFLGDGIRRA+E+RI+KPPQYGYS EAL+ RRQ+LQ A +TL + SSR +Y
Sbjct  1    FYKILGAEPHFLGDGIRRAFESRIAKPPQYGYSTEALVGRRQMLQIAHDTLTNQSSRTEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
            ++ L+    D L   V WDKVPG LCVLQE+G+ +LVL
Sbjct  61   DRALSE---DALTMDVAWDKVPGVLCVLQEAGEAQLVL  95



>ref|XP_002993317.1| hypothetical protein SELMODRAFT_136906, partial [Selaginella 
moellendorffii]
 gb|EFJ05642.1| hypothetical protein SELMODRAFT_136906, partial [Selaginella 
moellendorffii]
Length=656

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +2

Query  317  ERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETL  496
            E+++ LPID+Y++LGAEPHF  D + RAYEAR+S PP  G+S E L +R+QIL+ AC+TL
Sbjct  9    EKSMQLPIDYYQILGAEPHFSTDAVMRAYEARVSNPPTEGFSVELLKARQQILKVACDTL  68

Query  497  ADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            AD   R +Y++GL   E  TL+ +VPW K+P ALC+LQE+G+ E+VLQ+
Sbjct  69   ADRDLRDEYDRGLKEDEAGTLVVEVPWSKIPAALCLLQEAGEAEVVLQV  117



>ref|XP_002970022.1| hypothetical protein SELMODRAFT_92361, partial [Selaginella moellendorffii]
 gb|EFJ29146.1| hypothetical protein SELMODRAFT_92361, partial [Selaginella moellendorffii]
Length=656

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +2

Query  317  ERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETL  496
            E+++ LPID+Y++LGAEPHF  D + RAYEAR+S PP  G+S E L +R+QIL+ AC+TL
Sbjct  9    EKSMQLPIDYYQILGAEPHFSTDAVMRAYEARVSNPPTEGFSVELLKARQQILKVACDTL  68

Query  497  ADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            AD   R +Y+ GL   E  TL+ +VPW K+P ALC+LQE+G+ E+VLQ+
Sbjct  69   ADRDLRDEYDHGLKEDEAGTLVVEVPWSKIPAALCLLQEAGEAEVVLQV  117



>tpg|DAA01472.1| TPA_exp: plastid division protein precursor [Oryza sativa (indica 
cultivar-group)]
 dbj|BAD07942.1| plastid division protein precursor [Oryza sativa Japonica Group]
Length=760

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 99/146 (68%), Gaps = 8/146 (5%)
 Frame = +2

Query  194  SASKWADRLFADFQFLPSTSTPDPPDHKSTTATLTP-----PL--DILERNVSLPIDFYR  352
            +AS+WA+RLFADF  LP+ +  DPP      A         PL  D  ER++ L +DFY+
Sbjct  41   AASRWAERLFADFHLLPTAAPSDPPSPAPAPAAAPSASPFVPLFPDAAERSLPLQVDFYK  100

Query  353  VLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQG  532
            VLGAEPHFLGDGIRRA+EARI+KPPQYGYS +AL+ RRQ+LQ A +TL + +SR  Y++ 
Sbjct  101  VLGAEPHFLGDGIRRAFEARIAKPPQYGYSTDALVGRRQMLQIAHDTLMNQNSRTQYDRA  160

Query  533  LANHEFDTLLTQVPWDKVPG-ALCVL  607
            L+ +  + L   + WDK  G AL VL
Sbjct  161  LSENREEALTMDIAWDKEAGEALAVL  186



>ref|XP_001778770.1| predicted protein [Physcomitrella patens]
 gb|EDQ56468.1| predicted protein [Physcomitrella patens]
Length=782

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +2

Query  281  TTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALIS  460
              A+  PP+   E+   LPID+Y++LGAEP +L D + RA+E+R++ PP+ G+S +AL++
Sbjct  42   VAASAYPPIAQTEKTFRLPIDYYQILGAEPQYLADAVMRAFESRVNNPPREGFSQQALLA  101

Query  461  RRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQ  640
            R +IL+ A ++L DP  R +YNQGLA  E DTL+  VPW KV GALC+L E  + E+VLQ
Sbjct  102  RLEILRGARDSLVDPEIRAEYNQGLAEDEADTLILDVPWTKVGGALCLLHEVREVEVVLQ  161



>gb|AIU49233.1| ARC6, partial [Brachypodium distachyon]
Length=544

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = +2

Query  344  FYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDY  523
            FY+VLGAEPHFLGDG++RA+EAR++KP Q+GYS +ALISRRQ+LQ A +TL + SSR +Y
Sbjct  1    FYKVLGAEPHFLGDGVKRAFEARVAKPLQFGYSTDALISRRQMLQIAHDTLTNQSSRTEY  60

Query  524  NQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            ++ L+ +    L   V WDKVPG LC LQE+G+ + VL I
Sbjct  61   DRALSEN---ALTLDVAWDKVPGVLCALQEAGEAQAVLAI  97



>gb|EMT09082.1| hypothetical protein F775_15576 [Aegilops tauschii]
Length=568

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +2

Query  335  PIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSR  514
            P     VLGAEPHFL DG+RRA+EAR +KPPQYGYS + L+ RRQILQ A +TL + SSR
Sbjct  30   PPSLEEVLGAEPHFLSDGVRRAFEARAAKPPQYGYSTDTLVGRRQILQLAHDTLTNQSSR  89

Query  515  RDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             +Y++ L+      L   V WDKVPG LC LQE+G+ + VL I
Sbjct  90   TEYDRALSEDRDAALTLDVAWDKVPGVLCALQEAGEAQAVLAI  132



>gb|AIU49229.1| ARC6, partial [Lilium brownii]
Length=540

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 5/96 (5%)
 Frame = +2

Query  350  RVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQ  529
            ++L AEPHFL D IRRA+++++S+PP   ++  AL++RRQILQAAC+TL+DP+SR DYN+
Sbjct  1    QILQAEPHFLADSIRRAFDSKLSRPPHPAFTPAALLARRQILQAACDTLSDPASRADYNR  60

Query  530  GLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
            GL     DTL   VP DKVPGALC+LQE+G  ELV+
Sbjct  61   GLVA---DTL--TVPLDKVPGALCLLQEAGQAELVI  91



>gb|AIU49281.1| ARC6, partial [Cabomba caroliniana]
Length=389

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 63/80 (79%), Gaps = 3/80 (4%)
 Frame = +2

Query  401  YEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWD  580
            Y+A+IS+PP  G+S +AL+ RR+ILQAACETL +P +R +YNQGL     D L  ++P +
Sbjct  1    YDAKISRPPLDGFSQDALVCRRKILQAACETLVNPRTREEYNQGLME---DALSVELPLE  57

Query  581  KVPGALCVLQESGDTELVLQ  640
            KVPGALC+LQESG+ E+V++
Sbjct  58   KVPGALCLLQESGENEMVIE  77



>gb|EMS50085.1| hypothetical protein TRIUR3_08207 [Triticum urartu]
Length=704

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 9/97 (9%)
 Frame = +2

Query  353  VLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQG  532
            VLGAEPHFL DG+RRA+EAR +KPPQYGY+ + L+ RRQILQ A +TL + SSR +Y++ 
Sbjct  41   VLGAEPHFLSDGVRRAFEARAAKPPQYGYNTDTLVGRRQILQLAHDTLTNQSSRTEYDRA  100

Query  533  LANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
            L+      L   V WDK         E+G+ + VL I
Sbjct  101  LSEDRDMALTLDVAWDK---------EAGEAQAVLAI  128



>ref|XP_001775455.1| predicted protein [Physcomitrella patens]
 gb|EDQ59784.1| predicted protein, partial [Physcomitrella patens]
Length=657

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  350  RVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSSRRDYNQ  529
            ++LGAEP +L D I RA+++RI   P+ G+S +AL++R +IL+ A ++L DP  R +YNQ
Sbjct  1    QILGAEPQYLADAIVRAFDSRIDNSPRLGFSQQALLARLEILRGARDSLVDPEIRAEYNQ  60

Query  530  GLANHEFDTLLTQVPWDKVPGALCVLQ  610
            GLA  E DTL+  VP  KV     VLQ
Sbjct  61   GLAEDEADTLILDVPLTKVGEVEVVLQ  87



>ref|XP_001690917.1| ARC6-like protein [Chlamydomonas reinhardtii]
 gb|EDP05363.1| ARC6-like protein, partial [Chlamydomonas reinhardtii]
Length=568

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 71/125 (57%), Gaps = 4/125 (3%)
 Frame = +2

Query  269  DHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHE  448
            D + T+A     ++  E +VS+ +D+YR+L        D IR+AYE  + +PP   YS +
Sbjct  44   DAEQTSANPRGSMNSAE-HVSVAVDYYRMLHVPRVSRPDAIRKAYENLVKQPPAAAYSAD  102

Query  449  ALISRRQILQAACETLADPSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTE  628
             L +R  +L+AA E+L DP  RR Y+  LA       ++Q     +PGAL VLQE G+ +
Sbjct  103  TLFARAVLLKAAAESLTDPDLRRSYDAKLAAGHTALRVSQ---QDLPGALVVLQEIGEHQ  159

Query  629  LVLQI  643
            LVL +
Sbjct  160  LVLDL  164



>ref|XP_002948207.1| molecular chaperone [Volvox carteri f. nagariensis]
 gb|EFJ50614.1| molecular chaperone [Volvox carteri f. nagariensis]
Length=681

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +2

Query  323  NVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLAD  502
            +VS+ +D+YR+L        D IR+AYE  + +PP   YS + L +R  +L+AA E+L D
Sbjct  6    HVSVAVDYYRLLQVPRVSRPDAIRKAYETLVKQPPATAYSADTLFARAVLLKAAAESLID  65

Query  503  PSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
            P  RR Y+  +A       ++Q     +PGAL VLQE G+ +LVL
Sbjct  66   PDLRRSYDAKVAAGHSALRVSQ---QDLPGALVVLQEIGEFQLVL  107



>ref|WP_015138840.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Nostoc sp. PCC 7524]
 gb|AFY48402.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Nostoc sp. PCC 7524]
Length=767

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            V +P+D+YR+LG       + +R+AY  RI + P+  YSH A+ SR+Q+++ A   L+DP
Sbjct  11   VRIPLDYYRILGLPLAASDEQLRQAYSDRIVQLPRREYSHAAIASRKQLIEEAYVVLSDP  70

Query  506  SSRRDYNQGLANHEF--DTLLTQVPWDK----------------------VPGALCVLQE  613
              R  YNQ    H +  DT  TQV  ++                      + GAL +LQE
Sbjct  71   KERSSYNQLYLAHAYDPDTTTTQVAVEQRSHGNNSHFDAQNLSIEIASEELVGALLILQE  130

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  131  LGEYELVLKL  140



>ref|WP_040934288.1| molecular chaperone DnaJ, partial [Prochloron didemni]
Length=300

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 68/115 (59%), Gaps = 9/115 (8%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG         + +AY  R  + P+  YS  AL +R+Q+L+ A + L++P
Sbjct  1    MRIPLDYYRILGVPIEATDGQLSQAYRDRSLQLPEQEYSSAALDARKQLLELAYQVLSNP  60

Query  506  SSRRDYNQGLAN--------HEFDTLLT-QVPWDKVPGALCVLQESGDTELVLQI  643
             +R  YN+ L+          E D + + ++P +++ GAL +LQE G+ ELVL++
Sbjct  61   ETRAAYNEQLSQWVAPGSGLEEMDAIPSLEIPQEQLMGALLILQELGEYELVLRL  115



>ref|XP_005850325.1| hypothetical protein CHLNCDRAFT_50630 [Chlorella variabilis]
 gb|EFN58223.1| hypothetical protein CHLNCDRAFT_50630 [Chlorella variabilis]
Length=848

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = +2

Query  323  NVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLAD  502
             +SLP+D+YR+LG       D + RA E  ++ P   GYS + L++R   L+ A E L D
Sbjct  32   TLSLPLDYYRMLGVSGVCSRDSLARALEKALTNPRGVGYSQQCLLARGSALKRAVEALLD  91

Query  503  PSSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVL  637
            P +RR Y+  L   +   +   VP + VPG L +L E+G+ + V+
Sbjct  92   PQARRAYDDALRTGQ---ITEDVPDEFVPGVLALLVEAGEAQTVV  133



>ref|WP_040934251.1| hypothetical protein [Prochloron didemni]
Length=773

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 68/115 (59%), Gaps = 9/115 (8%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG         + +AY  R  + P+  YS  AL +R+Q+L+ A + L++P
Sbjct  1    MRIPLDYYRILGVPIEATDGQLSQAYRDRSLQLPEQEYSSAALDARKQLLELAYQVLSNP  60

Query  506  SSRRDYNQGLAN--------HEFDTLLT-QVPWDKVPGALCVLQESGDTELVLQI  643
             +R  YN+ L+          E D + + ++P +++ GAL +LQE G+ ELVL++
Sbjct  61   ETRAAYNEQLSQWVAPGSGLEEMDAIPSLEIPQEQLMGALLILQELGEYELVLRL  115



>ref|WP_010996860.1| molecular chaperone DnaJ [Nostoc sp. PCC 7120]
 dbj|BAB74406.1| all2707 [Nostoc sp. PCC 7120]
Length=798

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            V +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  11   VRIPLDYYRILGLPLAASDEQLRQAYSDRIVQLPRREYSQAAIASRKQLIEEAYVVLSDP  70

Query  506  SSRRDYNQGLANHEFD-------------------------TLLTQVPWDKVPGALCVLQ  610
              R  Y+Q    H +D                         +L  +V  +++ GAL +LQ
Sbjct  71   KERSSYDQLYLAHAYDPDNAATTKVAVENRGDSNNGHFDVQSLSIEVSSEELIGALLILQ  130

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  131  ELGEYELVLKL  141



>ref|WP_012411828.1| molecular chaperone DnaJ [Nostoc punctiforme]
 gb|ACC83884.1| heat shock protein DnaJ domain protein [Nostoc punctiforme PCC 
73102]
Length=768

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRIVQLPRREYSQAAISSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANHEFD-------------------------TLLTQVPWDKVPGALCVLQ  610
              R  Y+Q    H +D                         +L  ++  D++ GAL +LQ
Sbjct  61   KQRSTYDQLYLAHAYDPDNLAAAAVAQENRTESTKRGSDTQSLGIEITQDELVGALLILQ  120

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  121  ELGEYELVLKL  131



>emb|CDN10095.1| Cell division protein ZipN/Ftn2/Arc6, specific for cyanobacteria 
and chloroplast [Richelia intracellularis]
Length=744

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 26/135 (19%)
 Frame = +2

Query  317  ERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETL  496
            E  V +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ +R+ I++ A   L
Sbjct  7    EVAVQIPLDYYRILGLPLAASEEQLRQAYSDRIVQLPRREYSQAAIGARKLIIEKAYVIL  66

Query  497  ADPSSRRDYNQGLANHEFD--------------------------TLLTQVPWDKVPGAL  598
            +DP  R+ Y Q   +H ++                           L  ++P ++V GAL
Sbjct  67   SDPRERKVYEQACLSHTYEPENSVKSASVVVEGRQSPHNIKSDTQNLGIEIPQEEVVGAL  126

Query  599  CVLQESGDTELVLQI  643
             +LQE G+ ELVL++
Sbjct  127  LILQELGEYELVLKL  141



>ref|WP_015111182.1| heat shock protein DnaJ domain-containing protein [Nostoc sp. 
PCC 7107]
 gb|AFY40940.1| heat shock protein DnaJ domain protein [Nostoc sp. PCC 7107]
Length=777

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 66/130 (51%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q ++ A   L++P
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRIVQLPRREYSQAAIASRKQFIETAYVVLSNP  60

Query  506  SSRRDYNQGLANHEFD------------------------TLLTQVPWDKVPGALCVLQE  613
              R  Y+Q   +H +D                         L  ++P  ++ GAL +LQE
Sbjct  61   KERSSYDQLYLSHAYDPDGTATATVTAGKRTEINRDLDNQGLSIEIPQQELVGALLILQE  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>ref|WP_011320955.1| molecular chaperone DnaJ [Anabaena variabilis]
 gb|ABA23874.1| Heat shock protein DnaJ-like protein [Anabaena variabilis ATCC 
29413]
Length=798

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            V +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  11   VRIPLDYYRILGLPLAASDEQLRQAYSDRIVQLPRREYSQAAIASRKQLIEEAYVVLSDP  70

Query  506  SSRRDYNQGLANHEFD-------------------------TLLTQVPWDKVPGALCVLQ  610
              R  Y+Q    H +D                         +L  ++  +++ GAL +LQ
Sbjct  71   KERSSYDQLYLAHAYDPDNAATTKVAVENRGDSNNGHFDVQSLSIEISSEELIGALLILQ  130

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  131  ELGEYELVLKL  141



>ref|WP_041035189.1| molecular chaperone DnaJ [Tolypothrix campylonemoides]
 gb|KIJ77532.1| molecular chaperone DnaJ [Tolypothrix campylonemoides VB511288]
Length=774

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 65/131 (50%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SRR +++ A   L DP
Sbjct  1    MRIPLDYYRILGIPMAASEEQLRQAYGDRIVQLPRREYSQAAITSRRNLIEEAYLVLCDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQ-------------------------VPWDKVPGALCVLQ  610
              R+ Y+Q    H + +  TQ                         +  D++ GAL +LQ
Sbjct  61   KERKSYDQLYLAHAYGSDSTQGGAVAVESREQGKLDRIDSQSLSIEISQDELVGALLILQ  120

Query  611  ESGDTELVLQI  643
            E G+ ELVLQ+
Sbjct  121  ELGEYELVLQL  131



>gb|KIE09218.1| molecular chaperone DnaJ [Tolypothrix bouteillei VB521301]
Length=771

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 69/133 (52%), Gaps = 30/133 (23%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YSH A+ SR+++++ A   L+DP
Sbjct  1    MRIPLDYYRILGIPMAASEEQLRQAYGDRIMQLPRREYSHAAITSRKKLIEKAYVVLSDP  60

Query  506  SSRRDYNQ-------GLANHE--------------------FDTLLTQVPWDKVPGALCV  604
              R+ Y++       G  NH+                    F   +TQ   D+  GAL +
Sbjct  61   RERKTYDKLYLAHAYGSENHQDKAVAVETAHQGSGDVESLNFSIEITQ---DEFVGALLI  117

Query  605  LQESGDTELVLQI  643
            LQE G+ ELVL++
Sbjct  118  LQELGEYELVLKL  130



>ref|WP_037216276.1| molecular chaperone DnaJ [Richelia intracellularis]
Length=735

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 67/132 (51%), Gaps = 26/132 (20%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ +R+ I++ A   L+DP
Sbjct  1    MQIPLDYYRILGLPLAASEEQLRQAYSDRIVQLPRREYSQAAIGARKLIIEKAYVILSDP  60

Query  506  SSRRDYNQGLANHEFD--------------------------TLLTQVPWDKVPGALCVL  607
              R+ Y Q   +H ++                           L  ++P ++V GAL +L
Sbjct  61   RERKVYEQACLSHTYEPENSVKSASVVVEGRQSPHNIKSDTQNLGIEIPQEEVVGALLIL  120

Query  608  QESGDTELVLQI  643
            QE G+ ELVL++
Sbjct  121  QELGEYELVLKL  132



>ref|WP_011132921.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 emb|CAE19746.1| conserved hypothetical protein [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
Length=702

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRRDY   L N      L+    ++    L +L ESG ++   +I
Sbjct  61   DSRRDYENLLLNGASGLDLSS---NREVAGLILLWESGSSKEAFKI  103



>ref|WP_026082540.1| molecular chaperone DnaJ [Mastigocladopsis repens]
Length=774

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 23/129 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+++++ A   L+DP
Sbjct  1    MRIPLDYYRILGIPMAASEEQLRQAYGDRIVQLPRREYSQAAITSRKKLIEEAYLVLSDP  60

Query  506  SSRRDYNQGLANHEF-----------------------DTLLTQVPWDKVPGALCVLQES  616
              R+ Y+Q    H +                        +L  ++  D+  GAL +LQE 
Sbjct  61   KERKTYDQHYLAHAYGDSTQGASVAVQNREQANPNDIAQSLSIEISQDEFIGALLILQEL  120

Query  617  GDTELVLQI  643
            G+ ELVL++
Sbjct  121  GEYELVLKL  129



>ref|WP_026148342.1| molecular chaperone DnaJ [Leptolyngbya boryana]
Length=695

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       D +++A+  R  + P+  YS  A+ +RR +L  A   L+DP
Sbjct  1    MRIPLDYYRILGLPMQATADQLKQAHRDRTLQLPRREYSEAAIATRRSLLDQAYAVLSDP  60

Query  506  SSRRDYNQGLANHEF----DTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
              R+  ++ L + ++    D +  ++   ++ G L +LQE G+ ELVL+I
Sbjct  61   EQRKQVDETLLSTQYESDSDAITIEIDDQQLIGGLLILQELGEYELVLKI  110



>ref|WP_015132095.1| heat shock protein DnaJ domain-containing protein [Calothrix 
sp. PCC 7507]
 gb|AFY36306.1| heat shock protein DnaJ domain protein [Calothrix sp. PCC 7507]
Length=770

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASYEQLRQAYSDRIVQMPRREYSQAAISSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANHEFD-------------------------TLLTQVPWDKVPGALCVLQ  610
              R  Y+Q    H +D                         +L  ++  D++ GAL +LQ
Sbjct  61   KERSSYDQLYLAHAYDPDGTASRTVAVDNRPENNNGGIDAQSLSIEITQDELVGALLILQ  120

Query  611  ESGDTELVLQI  643
            + G+ E+VL++
Sbjct  121  DLGEYEIVLKL  131



>gb|KIY95131.1| heat shock protein binding protein, putative [Monoraphidium neglectum]
Length=482

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 72/138 (52%), Gaps = 21/138 (15%)
 Frame = +2

Query  242  PSTSTPDPPDHKSTTATLTPPLDILERNVSLPIDFYRVLGAEPHFLGDGIRRAYEARISK  421
            PS++ P  P+  S               ++LP++FY VL        + ++RAYE  I+ 
Sbjct  41   PSSAAPAGPESAS------------HEPLTLPLNFYSVLHLNRASSREAVKRAYEKVINS  88

Query  422  PPQYGYSHEALISRRQILQAACETLADPSSRRDYNQGL----ANHEFDTLLTQVPWDKVP  589
            PP  GYS + L SR  +L++A E LAD  +RR Y+         H  D     V  D +P
Sbjct  89   PPDVGYSQDTLFSRAVLLKSAAECLADLDARRAYDAAAAAVGGEHTLD-----VSRDNLP  143

Query  590  GALCVLQESGDTELVLQI  643
            GAL +LQE+G++ LV+++
Sbjct  144  GALVLLQEAGESALVVEL  161



>ref|WP_017653142.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=777

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASSEQLRQAYSDRIVQKPRREYSPAAISSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANHEFD-------------------------TLLTQVPWDKVPGALCVLQ  610
              R  Y+Q    H +D                         +L  ++  D++ GAL +LQ
Sbjct  61   KERSTYDQLYLAHAYDPDSNTSATVANENRPEPNNRGLDTQSLSIEITQDELVGALLILQ  120

Query  611  ESGDTELVLQI  643
            + G+ E+VL++
Sbjct  121  DLGEYEIVLKL  131



>ref|WP_035153088.1| molecular chaperone DnaJ [Calothrix sp. 336/3]
 gb|KFB83482.1| molecular chaperone DnaJ [Calothrix sp. 336/3]
Length=748

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  R+ + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRVVQLPRREYSQAAIASRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANHEF-------------------DT------LLTQVPWDKVPGALCVLQ  610
              RR Y+Q    H +                   DT      L  ++  D++ GAL +LQ
Sbjct  61   KERRAYDQLYLAHAYGADGDRHAVVALEEPAEDRDTEYQQKNLSIEINDDELVGALLILQ  120

Query  611  ESGDTELVLQI  643
            E G+ ELVL +
Sbjct  121  ELGEYELVLNL  131



>ref|WP_032521687.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|KGF96627.1| hypothetical protein EU95_0512 [Prochlorococcus marinus str. 
MIT 9201]
Length=703

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSASSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR+Y   L N E     +    ++    L +L ESG ++   +I
Sbjct  61   ESRREYENLLLNGESGLEFSS---NREVAGLILLWESGSSKEAFKI  103



>ref|WP_017744790.1| hypothetical protein [Scytonema hofmanni]
Length=764

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 71/130 (55%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+++++ A   L+DP
Sbjct  1    MRIPLDYYRILGIPMAASEEQLRQAYGDRIMQLPRREYSPAAIASRKKLIEKAYVVLSDP  60

Query  506  SSRRDYNQ-------GLANHE---------------FDT--LLTQVPWDKVPGALCVLQE  613
              R+ Y++       G  NH+               FD+  L  ++  D++ GAL +LQE
Sbjct  61   RERKTYDKVYLAEAYGSDNHQDRTVAVETANRGNRDFDSLNLSIEIAQDELVGALLILQE  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>ref|WP_025951624.1| hypothetical protein [Prochlorococcus sp. scB243_495N4]
Length=146

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_039752682.1| molecular chaperone DnaJ [Hassallia byssoidea]
 gb|KIF29065.1| molecular chaperone DnaJ [Hassallia byssoidea VB512170]
Length=759

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 67/132 (51%), Gaps = 26/132 (20%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+L+ A   L++P
Sbjct  1    MRIPLDYYRILGLPLAASDEQLRQAYSDRIVQLPRREYSSSAITSRKQLLEEAIVVLSNP  60

Query  506  SSRRDYNQ------------------GLANHEFD--------TLLTQVPWDKVPGALCVL  607
              R  Y+Q                   + N  F+        +L   +  D++ GAL +L
Sbjct  61   KERSSYDQLYLANVYDPEGSTTTSAVAVENRSFENNGTTEAKSLGIDISQDELVGALLIL  120

Query  608  QESGDTELVLQI  643
            QE G+ ELV+++
Sbjct  121  QELGEYELVVKL  132



>ref|WP_025935350.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_518A17]
Length=701

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRRDY   L N
Sbjct  61   ESRRDYENLLLN  72



>ref|WP_015205679.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Cylindrospermum stagnale]
 gb|AFZ22420.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Cylindrospermum stagnale PCC 7417]
Length=774

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 67/130 (52%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L++P
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRIVQLPRREYSTAAISSRKQLIEEAFVVLSEP  60

Query  506  SSRRDYNQGLANHEFD------------------------TLLTQVPWDKVPGALCVLQE  613
              R  Y+Q    H +D                        +L  ++  +++ GAL +LQE
Sbjct  61   KDRSKYDQLYLAHAYDPDRSAATVATENHTESNHREHDAQSLSIEIAQEELVGALLILQE  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>emb|CCH66171.1| Cell division protein ZipN/Ftn2/Arc6, specific for cyanobacteria 
and chloroplast [Richelia intracellularis HH01]
Length=743

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 65/131 (50%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            V +P+D+YR+LG       + +R+AY  RI++ P+  YS  A+ +R+QI++ A   L DP
Sbjct  10   VHIPLDYYRILGLPLAASEEQLRQAYSDRIAQLPRREYSQVAIAARKQIIEEAYIVLFDP  69

Query  506  SSRRDYNQGLANH-------------------------EFDTLLTQVPWDKVPGALCVLQ  610
              RR+Y Q   +H                         +      ++   ++ GAL +LQ
Sbjct  70   LKRREYEQEYLSHSNKQNNNNISGVVVEDCQTPKNVNSDNQKSGIEISAQQIAGALLILQ  129

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  130  ELGEYELVLKL  140



>gb|EFA70078.1| Heat shock protein DnaJ-like protein [Cylindrospermopsis raciborskii 
CS-505]
Length=753

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 22/128 (17%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            V + +D+YR+LG       + +R+AY  RI + PQ  YS  A+ +R++IL+ A   L+DP
Sbjct  7    VQIALDYYRILGLPLAATEEQLRQAYNDRILQLPQREYSTLAIAARKRILEQAYMVLSDP  66

Query  506  SSRRDYNQ----------------------GLANHEFDTLLTQVPWDKVPGALCVLQESG  619
              R  Y+Q                      G  NH    L   V  + + GAL +LQE G
Sbjct  67   RERSKYDQAYLAYAYDQTKIEIASEDNGETGNQNHNPQPLTIDVAKENLVGALVLLQELG  126

Query  620  DTELVLQI  643
            + ELVL++
Sbjct  127  EYELVLRL  134



>ref|WP_016868967.1| molecular chaperone DnaJ [Fischerella muscicola]
Length=768

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 66/130 (51%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  R  + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRRQQLPRREYSQVAINSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANHEFDT------------------------LLTQVPWDKVPGALCVLQE  613
              RR Y+Q    H + +                        L  ++  D++ GAL +LQE
Sbjct  61   KERRAYDQIYLAHAYGSERENNPTVAVENRAADHDSIESQGLSIEINPDELAGALLILQE  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>ref|WP_026732158.1| molecular chaperone DnaJ [Fischerella sp. PCC 9605]
Length=778

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 66/131 (50%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+A+  RI + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAHGDRIVQLPRREYSQAAINSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANH-------------------------EFDTLLTQVPWDKVPGALCVLQ  610
              RR Y+Q    H                         E  +L   +  D++ GAL +LQ
Sbjct  61   KERRAYDQLYLAHAYGSEGNRNAAVALENRTGDRYDVLESHSLSIDISQDELVGALLILQ  120

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  121  ELGEYELVLKL  131



>ref|WP_016871253.1| molecular chaperone DnaJ [Fischerella thermalis]
Length=761

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 66/130 (51%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  R  + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRRQQLPRREYSQVAINSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANHEFDT------------------------LLTQVPWDKVPGALCVLQE  613
              RR Y+Q    H + +                        L  ++  D++ GAL +LQE
Sbjct  61   KERRAYDQLYLAHAYGSERENNPTVAVENRAADSDSIESQGLSIEINPDELAGALLILQE  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>ref|WP_015218233.1| heat shock protein DnaJ domain-containing protein [Cyanobacterium 
aponinum]
 gb|AFZ52502.1| heat shock protein DnaJ domain protein [Cyanobacterium aponinum 
PCC 10605]
Length=715

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 9/115 (8%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + + +D++R+LG       D I +AYE R+ + P  GYS   + SR+ +L+ A + L D 
Sbjct  1    MQISLDYFRILGVPLQADSDLINQAYEDRLLQLPHEGYSEYGITSRQNLLKVAYDVLKDE  60

Query  506  SSRRDYNQGLANHE---------FDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SR +Y   L   E          + +  ++  D + GAL +L + GD ELVL++
Sbjct  61   ESRLEYESSLFTKESQEDIFLETSEEVTVEITNDLLVGALIILYDLGDFELVLRL  115



>ref|WP_009756661.1| molecular chaperone DnaJ [Fischerella sp. JSC-11]
 gb|EHC16225.1| heat shock protein DnaJ domain protein [Fischerella sp. JSC-11]
Length=761

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 66/130 (51%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  R  + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRRQQLPRREYSQVAINSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANHEFDT------------------------LLTQVPWDKVPGALCVLQE  613
              RR Y+Q    H + +                        L  ++  D++ GAL +LQE
Sbjct  61   KERRAYDQLYLAHAYGSERENNPTVAVENRAADSDSIESQGLSIEINPDELAGALLILQE  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>ref|WP_025959118.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_527G5]
Length=701

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P+ G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPEEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_007098532.1| molecular chaperone DnaJ [Synechococcus sp. RS9916]
 gb|EAU74429.1| hypothetical protein RS9916_33017 [Synechococcus sp. RS9916]
Length=697

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LPID +R+LG  P    + + R  + RI +PP  G++HEAL  R ++L+ + + L DP
Sbjct  1    MELPIDHFRLLGVSPSAEAETMLRTLQLRIDRPPSQGFTHEALQQRAELLRLSADLLTDP  60

Query  506  SSRRDYNQGL  535
            + RRDY   L
Sbjct  61   ARRRDYEAAL  70



>ref|WP_032513087.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|KGF91677.1| hypothetical protein EU92_0421 [Prochlorococcus marinus str. 
MIT 9107]
 gb|KGF94269.1| hypothetical protein EU94_0858 [Prochlorococcus marinus str. 
MIT 9123]
Length=702

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESG  619
             SRR Y   L N        + P ++    L +L ESG
Sbjct  61   ESRRKYENLLLNGASG---LEFPSNREVAGLILLWESG  95



>gb|EAQ68061.1| hypothetical protein RS9917_01961 [Synechococcus sp. RS9917]
Length=687

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 53/101 (52%), Gaps = 4/101 (4%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            V LPID +R+LG  P    + I R  + RI + P  G++HE L  R  +L+ + + L DP
Sbjct  19   VDLPIDHFRLLGVSPSAESETILRTLQLRIDRSPDQGFTHEGLQQRADLLRLSADLLTDP  78

Query  506  SSRRDYNQGLA----NHEFDTLLTQVPWDKVPGALCVLQES  616
            S RRDY   L     +H  +T   +V   +  G L +L E+
Sbjct  79   SRRRDYEAALMELGRDHPGETAGLEVASSREVGGLILLWEA  119



>ref|WP_025922530.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_529D18]
Length=701

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L +P
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRQTADLLTEP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR+Y   L N        + P ++    L +L ESG  +   +I
Sbjct  61   DSRREYENLLLNGASG---LEFPSNREVAGLILLWESGSPKEAFKI  103



>ref|WP_012008175.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|ABV51128.1| Conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9215]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPNEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR+Y   L N +     +    ++    L +L ESG  +   +I
Sbjct  61   ESRREYENMLLNGKSGLEFSS---NREVAGLILLWESGSPKEAFKI  103



>ref|WP_012597992.1| molecular chaperone DnaJ [Cyanothece sp. PCC 7424]
 gb|ACK69045.1| heat shock protein DnaJ domain protein [Cyanothece sp. PCC 7424]
Length=763

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 63/130 (48%), Gaps = 25/130 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY+ R  + P+  YS  A+ +R+Q+L  A E L+DP
Sbjct  1    MRIPLDYYRILGIPIQVTDEQLRQAYQDRSLQLPRREYSQGAITARKQLLDEAYEILSDP  60

Query  506  SSRRDYNQGLANHEFDT--------------------LLTQVPW-----DKVPGALCVLQ  610
              +++YN       +                      L    PW     +++ G L +LQ
Sbjct  61   DKKKEYNAQFLEKTYTIDSESQLDPHSPQTGETQESFLDNHTPWLDIRPEQLIGGLLILQ  120

Query  611  ESGDTELVLQ  640
            E G+ ELV++
Sbjct  121  ELGEYELVIR  130



>ref|WP_002805815.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|EEE39718.1| DnaJ domain protein [Prochlorococcus marinus str. MIT 9202]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR+Y   L N +     +    ++    L +L ESG  +   +I
Sbjct  61   ESRREYENMLLNGKSGLEFSS---NREVAGLILLWESGSPKEAFKI  103



>ref|WP_025948023.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_529J15]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPNEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENVLLN  72



>ref|WP_029635770.1| molecular chaperone DnaJ [[Scytonema hofmanni] UTEX B 1581]
Length=762

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 67/132 (51%), Gaps = 26/132 (20%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+L+ A   L++P
Sbjct  1    MRIPLDYYRILGLPLAASDEQLRQAYSDRIVQLPRREYSSRAISSRKQLLEEAIVVLSNP  60

Query  506  SSRRDY-----------------------NQGLANH---EFDTLLTQVPWDKVPGALCVL  607
              R  Y                       N+ L N+   E  +L   +  D++ GAL +L
Sbjct  61   KERSSYDQLYLANVYDPEGSTTSVAIAVENRSLENNYTTEAKSLGIDISQDELVGALLIL  120

Query  608  QESGDTELVLQI  643
            QE G+ ELV+++
Sbjct  121  QELGEYELVVKL  132



>ref|WP_025900778.1| MULTISPECIES: molecular chaperone DnaJ [Prochlorococcus]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDVGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025963882.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_520F22]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDVGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025954818.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_498C16]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDVGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025882076.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_527E14]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDVGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025930738.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_528O2]
Length=703

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 54/106 (51%), Gaps = 3/106 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR Y   + N          P ++    L +L ESG  +   +I
Sbjct  61   ESRRKYENLILN---GASALDFPSNREVAGLMLLWESGSPKEAFKI  103



>ref|WP_011376929.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|ABB50443.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9312]
 gb|KGG01313.1| hypothetical protein EU97_0356 [Prochlorococcus marinus str. 
MIT 9311]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/110 (31%), Positives = 57/110 (52%), Gaps = 11/110 (10%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANH----EFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR+Y   L N     EF +       ++    L +L ESG  +   +I
Sbjct  61   ESRREYENLLLNGASGLEFSS-------NREVAGLILLWESGSPKEAFKI  103



>ref|WP_032520255.1| molecular chaperone DnaJ [Prochlorococcus marinus]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025964428.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_498M14]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025944153.1| MULTISPECIES: molecular chaperone DnaJ [Prochlorococcus]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025920840.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_521N3]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025891920.1| MULTISPECIES: molecular chaperone DnaJ [Prochlorococcus]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025973496.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_528P18]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025979959.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_498B23]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPNEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_011818905.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|ABM70769.1| conserved hypothetical protein [Prochlorococcus marinus str. 
AS9601]
Length=701

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_010873289.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_441990.1| hypothetical protein sll0169 [Synechocystis sp. PCC 6803]
 dbj|BAA10060.1| sll0169 [Synechocystis sp. PCC 6803]
 dbj|BAK50845.1| hypothetical protein SYNGTS_2097 [Synechocystis sp. PCC 6803]
 dbj|BAL29843.1| hypothetical protein SYNGTI_2096 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL33012.1| hypothetical protein SYNPCCN_2095 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL36181.1| hypothetical protein SYNPCCP_2095 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM54598.1| hypothetical protein BEST7613_5667 [Synechocystis sp. PCC 6803]
 gb|AGF52356.1| hypothetical protein MYO_121170 [Synechocystis sp. PCC 6803]
Length=714

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 61/112 (54%), Gaps = 9/112 (8%)
 Frame = +2

Query  332  LPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADPSS  511
            +P+DFYR+LG  P   G+ I +AY+ R+ + P+  +S  A+  R Q+L  A ETL DP  
Sbjct  3    IPLDFYRILGIPPQSGGETIEQAYQDRLLQLPRREFSDAAVTLRNQLLAIAYETLRDPEK  62

Query  512  RRDYNQGLANHEFDTLLTQVPW---------DKVPGALCVLQESGDTELVLQ  640
            R+ Y+Q       + L   +P          ++  GAL +L + G+ ELV++
Sbjct  63   RQAYDQEWWGAMDEALGEALPLTTPELECSPEQEIGALLILLDLGEYELVVK  114



>ref|WP_025913751.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_520D2]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025962584.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_521K15]
Length=702

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025945318.1| MULTISPECIES: molecular chaperone DnaJ [Prochlorococcus]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025914934.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_520K10]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSASSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR+Y   L N       +    ++    L +L+ESG  +   +I
Sbjct  61   ESRREYENLLLNGSSGLDFSS---NREVAGLILLRESGSPKEAFRI  103



>ref|WP_025968203.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_518I6]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPNEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025944857.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_529C4]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025937489.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_519O21]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025929470.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_496A2]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPNEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_032516397.1| molecular chaperone DnaJ [Prochlorococcus marinus]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025972416.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_527L22]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025957934.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_518J7]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_042850839.1| molecular chaperone DnaJ [Prochlorococcus sp. MIT 0604]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATPEEILRAFQLRLDKTPNVGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025924768.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_495L20]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPYEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANHEFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR+Y   L N +     +    ++    L +L ESG  +   +I
Sbjct  61   ESRREYENLLLNGKSGLEFSS---NREVAGLILLWESGSPKEAFKI  103



>ref|WP_025923403.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_495D8]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPNEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_040008779.1| molecular chaperone DnaJ [Cylindrospermopsis raciborskii]
Length=747

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 22/128 (17%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + + +D+YR+LG       + +R+AY  RI + PQ  YS  A+ +R++IL+ A   L+DP
Sbjct  1    MQIALDYYRILGLPLAATEEQLRQAYNDRILQLPQREYSTLAIAARKRILEQAYMVLSDP  60

Query  506  SSRRDYNQ----------------------GLANHEFDTLLTQVPWDKVPGALCVLQESG  619
              R  Y+Q                      G  NH    L   V  + + GAL +LQE G
Sbjct  61   RERSKYDQAYLAYAYDQTKIEIASEDNGETGNQNHNPQPLTIDVAKENLVGALVLLQELG  120

Query  620  DTELVLQI  643
            + ELVL++
Sbjct  121  EYELVLRL  128



>ref|WP_025975543.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_495K23]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025933866.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_498A3]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025925521.1| MULTISPECIES: molecular chaperone DnaJ [Prochlorococcus]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025980809.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_498F21]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025956921.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_498L10]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATAEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025952004.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_497I20]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_011863402.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|ABO18095.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9301]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025968806.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_519D13]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025964932.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_498P15]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025939675.1| molecular chaperone DnaJ [Prochlorococcus sp. scB245a_520B18]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_044304252.1| molecular chaperone DnaJ [Richelia intracellularis]
Length=734

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI++ P+  YS  A+ +R+QI++ A   L DP
Sbjct  1    MHIPLDYYRILGLPLAASEEQLRQAYSDRIAQLPRREYSQVAIAARKQIIEEAYIVLFDP  60

Query  506  SSRRDYNQGLANH-------------------------EFDTLLTQVPWDKVPGALCVLQ  610
              RR+Y Q   +H                         +      ++   ++ GAL +LQ
Sbjct  61   LKRREYEQEYLSHSNKQNNNNISGVVVEDCQTPKNVNSDNQKSGIEISAQQIAGALLILQ  120

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  121  ELGEYELVLKL  131



>ref|WP_025934504.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_498J20]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVNPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025957367.1| MULTISPECIES: molecular chaperone DnaJ [Prochlorococcus]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVNPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025894872.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_497J18]
Length=701

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025946263.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_528N17]
Length=701

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPNEGFTYEVLTQRSELLRFTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_038545715.1| molecular chaperone DnaJ [Synechococcus sp. KORDI-100]
 gb|AII44014.1| hypothetical protein KR100_11680 [Synechococcus sp. KORDI-100]
Length=665

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 4/102 (4%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LPID +R+LG  P    D I R  ++R   PP  G++HE LI R ++L+ + + L D 
Sbjct  1    MDLPIDHFRLLGVSPSAAADAILRKLQSRCDSPPDQGFTHEVLIQRDELLRQSADLLTDS  60

Query  506  SSRRDYNQGLAN----HEFDTLLTQVPWDKVPGALCVLQESG  619
              R +Y   L +    H  DT+   +P       L +L E+G
Sbjct  61   VRRSEYEAQLLDLSQHHPGDTVGLDLPSSSEAAGLLLLWEAG  102



>ref|WP_011820752.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|ABM72655.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9515]
Length=705

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDVGFTNEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   DSRREYENLLLN  72



>ref|WP_015199039.1| heat shock protein DnaJ domain-containing protein [Calothrix 
parietina]
 gb|AFZ02412.1| heat shock protein DnaJ domain protein [Calothrix sp. PCC 6303]
Length=737

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 65/132 (49%), Gaps = 26/132 (20%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  R  + P+  YSH A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYGDRRQQLPRREYSHAAITSRKQLIEEAYVILSDP  60

Query  506  SSRRDYNQGLANHEF--------------------------DTLLTQVPWDKVPGALCVL  607
              R+ Y+Q   +H +                            L   +  D++ GAL +L
Sbjct  61   QERKIYDQLYLSHAYAPDGDQDVAIAVEERLNESNGKIPDNQVLSIDINQDELVGALLLL  120

Query  608  QESGDTELVLQI  643
            QE G+ E VL++
Sbjct  121  QELGEYEQVLKL  132



>ref|WP_038001523.1| molecular chaperone DnaJ [Synechococcus sp. RS9917]
Length=669

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 4/101 (4%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LPID +R+LG  P    + I R  + RI + P  G++HE L  R  +L+ + + L DP
Sbjct  1    MDLPIDHFRLLGVSPSAESETILRTLQLRIDRSPDQGFTHEGLQQRADLLRLSADLLTDP  60

Query  506  SSRRDYNQGLA----NHEFDTLLTQVPWDKVPGALCVLQES  616
            S RRDY   L     +H  +T   +V   +  G L +L E+
Sbjct  61   SRRRDYEAALMELGRDHPGETAGLEVASSREVGGLILLWEA  101



>ref|WP_032527217.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 gb|KGF96968.1| hypothetical protein EU96_1608 [Prochlorococcus marinus str. 
MIT 9302]
Length=701

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/110 (31%), Positives = 57/110 (52%), Gaps = 11/110 (10%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVTPSASSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLANH----EFDTLLTQVPWDKVPGALCVLQESGDTELVLQI  643
             SRR+Y   L N     EF +       ++    L +L ESG  +   +I
Sbjct  61   ESRREYENLLINGASGLEFSS-------NREVAGLILLWESGSPKEAFKI  103



>ref|WP_015213299.1| heat shock protein DnaJ domain protein [Anabaena cylindrica]
 gb|AFZ56647.1| heat shock protein DnaJ domain protein [Anabaena cylindrica PCC 
7122]
Length=772

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 68/130 (52%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L+D 
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRIVQLPRREYSITAISSRKQLIEEAYVVLSDS  60

Query  506  SSRRDYNQ----------------GLA--------NHEFDTLLTQVPWDKVPGALCVLQE  613
              R  Y+Q                GL         NH+  +L  ++  +++ GAL +LQE
Sbjct  61   KERSRYDQIYLAHAYDPDRAAHTSGLENRAENNSRNHDVQSLSIEIAPEELVGALLLLQE  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>ref|WP_025979364.1| molecular chaperone DnaJ [Prochlorococcus sp. scB243_497E17]
Length=701

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSASSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_025926855.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_528J8]
Length=701

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSASSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             SRR+Y   L N
Sbjct  61   ESRREYENLLLN  72



>ref|WP_044452516.1| molecular chaperone DnaJ [Mastigocladus laminosus]
 gb|KIY10037.1| molecular chaperone DnaJ [Mastigocladus laminosus UU774]
Length=768

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  R  + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRRQQLPRREYSQIAINSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANH------------------------EFDTLLTQVPWDKVPGALCVLQE  613
              RR Y+Q    H                        E   L  ++  +++ GAL +LQ+
Sbjct  61   KERRAYDQSYLAHAYGPDREHNAGVTVENRSADNSLIESQGLSIEINSEELAGALLILQD  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>ref|WP_017312724.1| molecular chaperone DnaJ [Fischerella sp. PCC 9339]
Length=768

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  R  + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRRQQLPRREYSQIAINSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANH------------------------EFDTLLTQVPWDKVPGALCVLQE  613
              RR Y+Q    H                        E   L  ++  +++ GAL +LQ+
Sbjct  61   KERRAYDQSYLAHAYGPDREHNAGVTVENRSADNSLIESQGLSIEINSEELAGALLILQD  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



>ref|WP_027845444.1| molecular chaperone DnaJ [Mastigocoleus testarum]
Length=820

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 67/131 (51%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  R+   P+  YS  A+ SR+Q+++ A   L++P
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRMVGLPRREYSQAAIDSRKQLIEEAYVVLSNP  60

Query  506  SSRRDYNQ-------------------------GLANHEFDTLLTQVPWDKVPGALCVLQ  610
              R+ Y++                          + N E  +L  ++  D++ GAL +LQ
Sbjct  61   KDRKAYDRLYLSNSYYPDDTTDGTVAVEERLQNNIGNTEPQSLNIEIAEDELVGALLILQ  120

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  121  ELGEYELVLKL  131



>ref|WP_006197353.1| molecular chaperone DnaJ [Nodularia spumigena]
 gb|EAW44453.1| Heat shock protein DnaJ-like protein [Nodularia spumigena CCY9414]
 gb|AHJ26928.1| Cell division protein ZipN/Ftn2/Arc6, specific for cyanobacteria 
and chloroplast [Nodularia spumigena CCY9414]
Length=761

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 67/132 (51%), Gaps = 26/132 (20%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R++Y  RI + P+  YS  A+ SR+Q+++ A   L++P
Sbjct  1    MRIPLDYYRILGLPLAASDEQLRQSYSDRIVQLPRREYSQAAICSRKQLIEEAYVVLSNP  60

Query  506  SSRRDYNQ-----------------GLANH---------EFDTLLTQVPWDKVPGALCVL  607
              R  Y+Q                  + NH         +  +L   +  +++ GAL +L
Sbjct  61   KERSSYDQLYLAHAYGPDGNGNATVAVGNHTEEGNNADPDIQSLSIDISQEELVGALLIL  120

Query  608  QESGDTELVLQI  643
            QE G+ ELVL++
Sbjct  121  QELGEYELVLKL  132



>ref|WP_041226169.1| molecular chaperone DnaJ [Crinalium epipsammum]
Length=817

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 20/126 (16%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            V +P+D+YR+LG       + +++AY  R  + P+  YS  A+ +RRQ+L  A   LA+P
Sbjct  6    VRIPLDYYRILGLPIQATTEQLQQAYRDRALQLPRREYSEVAIAARRQLLDQAYAVLAEP  65

Query  506  SSRRDYNQGLANHEFDTLLT--------------------QVPWDKVPGALCVLQESGDT  625
              R  Y+    NH FD  L                     ++  ++  GA+ +L + G+ 
Sbjct  66   EQRAAYDGNFLNHAFDQPLEDLSDPTSSPNTEVDPFTPSLEITDEQFVGAMLILYDLGEY  125

Query  626  ELVLQI  643
            ELVL++
Sbjct  126  ELVLKL  131



>ref|WP_025974717.1| molecular chaperone DnaJ [Prochlorococcus sp. scB241_529J16]
Length=701

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + LP+D +R++G  P    + I RA++ R+ K P  G+++E L  R ++L+   + L DP
Sbjct  1    MELPLDHFRLIGVSPSATSEEILRAFQLRLDKTPDEGFTYEVLTQRSELLRLTADLLTDP  60

Query  506  SSRRDYNQGLAN  541
             +RR+Y   L N
Sbjct  61   ETRREYENLLLN  72



>gb|KIJ81316.1| molecular chaperone DnaJ [Scytonema tolypothrichoides VB-61278]
Length=775

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 64/131 (49%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+ +++ A   L++P
Sbjct  1    MRIPLDYYRILGIPMAASEEQLRQAYGDRIVQLPRREYSQAAITSRKNLIEEAYVVLSNP  60

Query  506  SSRRDYNQGLANHEFDT-------------------------LLTQVPWDKVPGALCVLQ  610
              R+ Y+Q    H + +                         L   +  D+  GAL +LQ
Sbjct  61   KERKTYDQLYLAHAYGSDSQKGGAVAVESRKQDHIGELDSQALSIDISQDEFVGALLILQ  120

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  121  ELGEYELVLKL  131



>ref|WP_016873793.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=781

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 25/131 (19%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L+DP
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRIVQLPRREYSQAAINSRKQLIEEAYVVLSDP  60

Query  506  SSRRDYNQGLANHEFDT-------------------------LLTQVPWDKVPGALCVLQ  610
              R+ Y+Q    H + +                         L  ++  ++  GAL +LQ
Sbjct  61   KERKAYDQIYLAHAYGSESDRNAAVATENRALNSNGSVDSQNLSIEINPEEFVGALLLLQ  120

Query  611  ESGDTELVLQI  643
            E G+ ELVL++
Sbjct  121  ELGEYELVLKL  131



>ref|WP_013191126.1| molecular chaperone DnaJ [Trichormus azollae]
 gb|ADI64109.1| heat shock protein DnaJ domain protein ['Nostoc azollae' 0708]
Length=783

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 67/130 (52%), Gaps = 24/130 (18%)
 Frame = +2

Query  326  VSLPIDFYRVLGAEPHFLGDGIRRAYEARISKPPQYGYSHEALISRRQILQAACETLADP  505
            + +P+D+YR+LG       + +R+AY  RI + P+  YS  A+ SR+Q+++ A   L+D 
Sbjct  1    MRIPLDYYRILGLPLAASEEQLRQAYSDRIVQLPRREYSIAAISSRKQLIEEAYVVLSDS  60

Query  506  SSRRDYNQGLANHEFD------------------------TLLTQVPWDKVPGALCVLQE  613
              R  Y+Q   +H +D                        +L  ++  +++ GAL +LQE
Sbjct  61   KERAIYDQLYLSHAYDPDRAGTKSLLENRVENNNRNHDVQSLSIEIAQEQLVGALLLLQE  120

Query  614  SGDTELVLQI  643
             G+ ELVL++
Sbjct  121  LGEYELVLKL  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375