BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038D18

Length=696
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    343   9e-114   Nicotiana sylvestris
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    343   1e-113   Nicotiana tomentosiformis
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             341   9e-113   Nicotiana benthamiana
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                338   1e-111   Arachis hypogaea [goober]
emb|CDP18560.1|  unnamed protein product                                334   3e-110   Coffea canephora [robusta coffee]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         332   3e-109   Morus notabilis
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    331   7e-109   Nelumbo nucifera [Indian lotus]
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    329   3e-108   Nicotiana tabacum [American tobacco]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    328   1e-107   Cucumis melo [Oriental melon]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    326   8e-107   Sesamum indicum [beniseed]
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    326   1e-106   Solanum lycopersicum
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    325   1e-106   Nelumbo nucifera [Indian lotus]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    325   1e-106   Solanum tuberosum [potatoes]
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    325   2e-106   Fragaria vesca subsp. vesca
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    325   2e-106   Solanum lycopersicum
gb|KJB70723.1|  hypothetical protein B456_011G088800                    323   7e-106   Gossypium raimondii
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             323   8e-106   Citrus clementina [clementine]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    323   8e-106   Eucalyptus grandis [rose gum]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    323   9e-106   Prunus mume [ume]
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    323   1e-105   Cucumis melo [Oriental melon]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    322   4e-105   Citrus sinensis [apfelsine]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   322   4e-105   Citrus sinensis [apfelsine]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             321   5e-105   Prunus persica
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   323   5e-105   Citrus sinensis [apfelsine]
tpg|DAA37468.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         315   7e-105   
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    321   8e-105   Theobroma cacao [chocolate]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              320   1e-104   Scoparia dulcis [escobilla]
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    320   1e-104   Pyrus x bretschneideri [bai li]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    320   1e-104   Ricinus communis
gb|ABK96233.1|  unknown                                                 320   2e-104   Populus trichocarpa x Populus deltoides
gb|KJB11771.1|  hypothetical protein B456_001G276400                    320   2e-104   Gossypium raimondii
gb|ABK96725.1|  unknown                                                 320   2e-104   Populus trichocarpa x Populus deltoides
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    319   3e-104   Populus euphratica
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    319   3e-104   Malus domestica [apple tree]
gb|EPS59235.1|  hypothetical protein M569_15573                         319   3e-104   Genlisea aurea
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    319   4e-104   Cicer arietinum [garbanzo]
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    318   5e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         318   6e-104   Medicago truncatula
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             318   7e-104   Cucumis sativus [cucumbers]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                318   7e-104   Mangifera indica
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    318   9e-104   
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   1e-103   Pyrus x bretschneideri [bai li]
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   2e-103   
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         317   2e-103   Jatropha curcas
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                317   2e-103   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             317   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   3e-103   Populus euphratica
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    316   5e-103   Malus domestica [apple tree]
gb|ABK94956.1|  unknown                                                 316   6e-103   Populus trichocarpa [western balsam poplar]
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             316   7e-103   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   8e-103   
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             315   8e-103   Eutrema salsugineum [saltwater cress]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    315   9e-103   Arabis alpina [alpine rockcress]
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    315   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         315   1e-102   
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    315   2e-102   Zea mays [maize]
emb|CAA30152.1|  GADPH (383 AA)                                         313   3e-102   Zea mays [maize]
dbj|BAJ34149.1|  unnamed protein product                                313   5e-102   Eutrema halophilum
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       313   7e-102   Medicago sativa [alfalfa]
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   8e-102   Setaria italica
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   1e-101   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   1e-101   Oryza brachyantha
ref|NP_001052984.1|  Os04g0459500                                       313   1e-101   
emb|CBI21236.3|  unnamed protein product                                308   2e-101   Vitis vinifera
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          311   4e-101   Amborella trichopoda
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             310   1e-100   Capsella rubella
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    310   2e-100   
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    309   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    309   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_002875330.1|  gapa                                               309   2e-100   Arabidopsis lyrata subsp. lyrata
gb|AGJ50596.1|  GAPDH                                                   309   3e-100   Pericallis cruenta
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    309   3e-100   Glycine soja [wild soybean]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    309   3e-100   
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    309   3e-100   Pisum sativum [garden pea]
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    309   4e-100   Vitis vinifera
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    310   4e-100   
emb|CAN78872.1|  hypothetical protein VITISV_021726                     308   5e-100   Vitis vinifera
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    308   5e-100   Camelina sativa [gold-of-pleasure]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                308   6e-100   Arabidopsis thaliana [mouse-ear cress]
gb|ACU21011.1|  unknown                                                 308   8e-100   Glycine max [soybeans]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    308   1e-99    Brassica rapa
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    308   1e-99    Glycine soja [wild soybean]
emb|CDY19412.1|  BnaC05g09210D                                          307   2e-99    Brassica napus [oilseed rape]
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               306   2e-99    Brassica rapa subsp. chinensis [bok-choy]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    306   3e-99    
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             306   4e-99    Eutrema salsugineum [saltwater cress]
emb|CAA33264.1|  unnamed protein product                                306   4e-99    Pisum sativum [garden pea]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   4e-99    Brassica rapa
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   5e-99    
emb|CDY26599.1|  BnaA09g46780D                                          305   8e-99    Brassica napus [oilseed rape]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   1e-98    Brassica rapa
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   2e-98    Tarenaya hassleriana [spider flower]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    303   5e-98    Arabis alpina [alpine rockcress]
emb|CDY16038.1|  BnaC08g40850D                                          303   8e-98    Brassica napus [oilseed rape]
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                305   1e-97    Erythranthe guttata [common monkey flower]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_002892719.1|  GAPA-2                                             301   3e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   3e-97    Camelina sativa [gold-of-pleasure]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             301   4e-97    Phaseolus vulgaris [French bean]
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             300   7e-97    
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        300   1e-96    Arabidopsis thaliana [mouse-ear cress]
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    300   1e-96    Spinacia oleracea
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   1e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   1e-96    Pyrus x bretschneideri [bai li]
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              298   4e-96    Phaseolus vulgaris [French bean]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   5e-96    Brachypodium distachyon [annual false brome]
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               295   8e-95    Marchantia polymorpha
dbj|BAJ90885.1|  predicted protein                                      295   9e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    294   9e-95    Triticum urartu
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      293   9e-95    Arabidopsis thaliana [mouse-ear cress]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    293   1e-94    Marchantia polymorpha
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             292   3e-94    
dbj|BAJ90530.1|  predicted protein                                      293   4e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    293   5e-94    
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             293   6e-94    Selaginella moellendorffii
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             293   6e-94    Selaginella moellendorffii
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    291   7e-94    
gb|ACN40000.1|  unknown                                                 291   5e-93    Picea sitchensis
gb|ABK24313.1|  unknown                                                 291   5e-93    Picea sitchensis
gb|ABK25233.1|  unknown                                                 291   6e-93    Picea sitchensis
gb|ACN40537.1|  unknown                                                 290   6e-93    Picea sitchensis
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                288   8e-93    Lilium regale
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               286   1e-92    Capsicum annuum
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    285   1e-92    Camelina sativa [gold-of-pleasure]
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               286   2e-92    Capsicum annuum
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     287   3e-92    Arabidopsis thaliana [mouse-ear cress]
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    286   4e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    287   1e-91    
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit         285   2e-91    Oryza sativa Indica Group [Indian rice]
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    286   2e-91    
dbj|BAH57068.1|  AT1G12900                                              284   4e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  285   1e-90    Pinus sylvestris [Scotch pine]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              281   5e-90    Brassica rapa subsp. chinensis [bok-choy]
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    280   2e-89    
ref|XP_001779769.1|  predicted protein                                  280   4e-89    
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    281   5e-89    Zea mays [maize]
ref|XP_001771209.1|  predicted protein                                  279   1e-88    
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    271   3e-86    Gossypium arboreum [tree cotton]
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    271   4e-86    Gossypium arboreum [tree cotton]
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    270   6e-86    Spinacia oleracea
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    270   7e-86    Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    270   8e-86    Spinacia oleracea
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               268   3e-85    Brassica rapa subsp. chinensis [bok-choy]
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    269   3e-85    Spinacia oleracea
ref|XP_001771246.1|  predicted protein                                  270   4e-85    
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    268   5e-85    Spinacia oleracea
ref|XP_001766703.1|  predicted protein                                  268   8e-85    
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase                265   1e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001779753.1|  predicted protein                                  267   7e-84    
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               261   9e-83    Spirogyra sp.
ref|XP_001753934.1|  predicted protein                                  263   3e-82    
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     262   4e-82    Physcomitrella patens
emb|CDX83635.1|  BnaC07g23750D                                          261   1e-81    
emb|CDY28536.1|  BnaC02g36240D                                          260   1e-81    Brassica napus [oilseed rape]
emb|CDY13649.1|  BnaA06g32740D                                          260   2e-81    Brassica napus [oilseed rape]
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      257   5e-81    Chara vulgaris
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               256   8e-81    Sphagnum cuspidatum
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                258   1e-80    Syntrichia caninervis
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    256   1e-80    Spinacia oleracea
gb|AGV54738.1|  glyceraldehyde-3-phosphate dehydrogenase A chloro...    254   6e-80    Phaseolus vulgaris [French bean]
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              252   2e-78    Volvox carteri f. nagariensis
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               249   3e-78    Klebsormidium flaccidum
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      248   2e-77    Coleochaete scutata
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                245   2e-76    Klebsormidium flaccidum
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                246   3e-76    Ulva linza
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      244   5e-76    Mesostigma viride
gb|ACN39951.1|  unknown                                                 244   5e-76    Picea sitchensis
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                243   2e-75    Mesostigma viride
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      242   7e-75    Chlorokybus atmophyticus
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           243   9e-75    Chlamydomonas reinhardtii
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    241   9e-75    Miscanthus sinensis
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                   240   1e-74    Citrus sinensis [apfelsine]
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg             241   1e-74    
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase           239   2e-74    
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                   241   2e-74    Citrus sinensis [apfelsine]
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                   238   2e-74    Citrus sinensis [apfelsine]
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    240   3e-74    Chlamydomonas incerta
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    241   3e-74    Chlamydomonas incerta
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   4e-74    
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   5e-74    Cucumis melo [Oriental melon]
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g             238   8e-74    
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    242   9e-74    Nicotiana tabacum [American tobacco]
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    240   1e-73    Dunaliella viridis
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    242   1e-73    Nicotiana tomentosiformis
gb|KJB57937.1|  hypothetical protein B456_009G186400                    236   2e-73    Gossypium raimondii
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                   236   2e-73    Citrus sinensis [apfelsine]
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   2e-73    Nicotiana sylvestris
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   2e-73    Nicotiana sylvestris
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    241   2e-73    Ricinus communis
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             241   3e-73    Prunus persica
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   3e-73    Nicotiana tomentosiformis
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   3e-73    
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   3e-73    Tarenaya hassleriana [spider flower]
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   3e-73    
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   3e-73    
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    239   3e-73    Micromonas commoda
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   4e-73    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB57939.1|  hypothetical protein B456_009G186400                    237   4e-73    Gossypium raimondii
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   4e-73    Solanum lycopersicum
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               241   4e-73    Chara vulgaris
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               240   5e-73    Solanum tuberosum [potatoes]
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                   234   5e-73    Citrus sinensis [apfelsine]
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   5e-73    Populus euphratica
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   6e-73    Solanum tuberosum [potatoes]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             240   6e-73    Phaseolus vulgaris [French bean]
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           238   6e-73    Coccomyxa subellipsoidea C-169
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             240   7e-73    Eutrema salsugineum [saltwater cress]
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   239   8e-73    Citrus sinensis [apfelsine]
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                   236   8e-73    Citrus sinensis [apfelsine]
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   8e-73    Prunus mume [ume]
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              240   9e-73    Scoparia dulcis [escobilla]
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   9e-73    Setaria italica
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                238   9e-73    Dunaliella salina
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   1e-72    Sesamum indicum [beniseed]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   1e-72    Brassica rapa
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   1e-72    
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              238   2e-72    Medicago truncatula
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    239   2e-72    Spinacia oleracea
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   2e-72    Citrus sinensis [apfelsine]
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             236   2e-72    Micromonas pusilla CCMP1545
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                236   3e-72    Vicia sativa [spring vetch]
emb|CAN69459.1|  hypothetical protein VITISV_021576                     239   3e-72    Vitis vinifera
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   3e-72    Vitis vinifera
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   4e-72    Cucumis sativus [cucumbers]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          237   4e-72    
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             238   4e-72    Citrus clementina [clementine]
emb|CDY69523.1|  BnaC08g46180D                                          236   5e-72    Brassica napus [oilseed rape]
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    238   5e-72    Arabis alpina [alpine rockcress]
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           238   6e-72    Medicago truncatula
gb|ACJ84309.1|  unknown                                                 238   6e-72    Medicago truncatula
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   6e-72    Populus euphratica
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   6e-72    Malus domestica [apple tree]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    238   7e-72    Pyrus x bretschneideri [bai li]
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    235   7e-72    Ostreococcus tauri
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    235   7e-72    
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   8e-72    Populus euphratica
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             237   8e-72    Selaginella moellendorffii
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         237   9e-72    Jatropha curcas
gb|EPS70760.1|  hypothetical protein M569_03997                         237   9e-72    Genlisea aurea
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    237   9e-72    Glycine max [soybeans]
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             236   1e-71    
ref|NP_001240080.1|  uncharacterized protein LOC100806482               237   1e-71    Glycine max [soybeans]
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   1e-71    
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    237   1e-71    Gossypium arboreum [tree cotton]
ref|NP_001048847.1|  Os03g0129300                                       237   1e-71    
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   1e-71    
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    237   1e-71    Populus trichocarpa [western balsam poplar]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             236   1e-71    
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    237   1e-71    Pisum sativum [garden pea]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    237   1e-71    Gossypium arboreum [tree cotton]
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             237   1e-71    
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           238   2e-71    
emb|CAA33262.1|  unnamed protein product                                236   2e-71    Pisum sativum [garden pea]
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           234   2e-71    Bathycoccus prasinos
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      235   2e-71    Mesostigma viride
dbj|BAJ86633.1|  predicted protein                                      236   2e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   2e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   2e-71    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    234   2e-71    Mesostigma viride
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    236   2e-71    
dbj|BAJ87214.1|  predicted protein                                      236   2e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    236   2e-71    
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   3e-71    
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    236   3e-71    Glycine soja [wild soybean]
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   3e-71    Cicer arietinum [garbanzo]
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   4e-71    Pyrus x bretschneideri [bai li]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    236   4e-71    Gossypium raimondii
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   4e-71    Camelina sativa [gold-of-pleasure]
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   4e-71    Elaeis guineensis
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   4e-71    
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      234   4e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KJB14201.1|  hypothetical protein B456_002G114000                    235   4e-71    Gossypium raimondii
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    235   4e-71    Triticum urartu
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   5e-71    Camelina sativa [gold-of-pleasure]
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    233   5e-71    Ostreococcus sp. 'lucimarinus'
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   5e-71    Eucalyptus grandis [rose gum]
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    235   5e-71    
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    235   5e-71    
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              235   5e-71    Pyrus x bretschneideri [bai li]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   6e-71    
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            235   6e-71    
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   6e-71    
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    234   7e-71    
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      233   8e-71    
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    231   2e-70    
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                229   2e-70    
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   2e-70    
emb|CDP07271.1|  unnamed protein product                                234   3e-70    
gb|ACU20783.1|  unknown                                                 233   5e-70    
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             233   5e-70    
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    232   8e-70    
ref|XP_001420043.1|  predicted protein                                  229   9e-70    
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    232   9e-70    
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              229   1e-69    
gb|ABK24645.1|  unknown                                                 232   1e-69    
gb|ACN40006.1|  unknown                                                 232   1e-69    
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               227   2e-69    
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269              227   2e-69    
gb|ACN40526.1|  unknown                                                 231   2e-69    
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    228   1e-68    
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      226   2e-68    
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         226   4e-68    
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      228   4e-68    
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    226   8e-68    
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    226   9e-68    
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     223   1e-67    
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             225   1e-67    
emb|CDY48981.1|  BnaA02g28150D                                          224   1e-67    
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         236   3e-67    
ref|XP_001415434.1|  predicted protein                                  223   6e-67    
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    221   6e-67    
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      221   7e-67    
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    222   1e-66    
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               224   2e-66    
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    222   5e-66    
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    220   1e-65    
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           220   1e-65    
gb|KHN13412.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    214   2e-65    
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      218   7e-65    
gb|ABR16095.1|  unknown                                                 213   7e-65    
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               214   2e-64    
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    217   2e-64    
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                214   2e-64    
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    214   2e-63    
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           214   3e-63    
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase                210   1e-62    
gb|ABK00066.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    206   9e-62    
gb|ADB81484.1|  glyceraldehyde-3-phosphate dehydrogenase                199   3e-59    
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           201   6e-59    
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      202   8e-59    
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    199   1e-58    
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           199   2e-58    
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         199   3e-58    
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           198   6e-58    
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase           198   7e-58    
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase           198   8e-58    
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    197   8e-58    
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    197   9e-58    
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           197   9e-58    
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           197   1e-57    
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...    197   1e-57    
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           197   2e-57    
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           196   2e-57    
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           196   3e-57    
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           196   4e-57    
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    196   4e-57    
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    196   5e-57    
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    195   8e-57    
gb|ADB81488.1|  glyceraldehyde-3-phosphate dehydrogenase                193   1e-56    
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             195   1e-56    
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           195   1e-56    
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           195   1e-56    
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           194   1e-56    
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         194   2e-56    
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               192   3e-56    
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    193   4e-56    
gb|ACN41006.1|  unknown                                                 197   4e-56    
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           193   5e-56    
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           192   7e-56    
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           192   9e-56    
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             193   1e-55    
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    192   1e-55    
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           192   1e-55    
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase           192   1e-55    
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             192   1e-55    
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    192   1e-55    
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             192   1e-55    
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          193   1e-55    
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    192   1e-55    
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           192   1e-55    
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    192   2e-55    
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           192   2e-55    
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    192   2e-55    
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           192   2e-55    
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    191   2e-55    
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    191   2e-55    
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    191   2e-55    
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...    192   2e-55    
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    191   2e-55    
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           191   3e-55    
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           191   3e-55    
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           191   3e-55    
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           191   3e-55    
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    191   4e-55    
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    190   8e-55    
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           189   2e-54    
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           189   2e-54    
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           189   2e-54    
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    188   3e-54    
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           188   5e-54    
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    188   5e-54    
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      187   7e-54    
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           187   1e-53    
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        187   1e-53    
ref|WP_011429234.1|  glyceraldehyde-3-phosphate dehydrogenase           187   1e-53    
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    187   1e-53    
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase           186   2e-53    
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               186   2e-53    
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           186   2e-53    
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           186   2e-53    
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           186   2e-53    
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    186   2e-53    
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           186   3e-53    
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           186   3e-53    
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        186   3e-53    
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    186   4e-53    
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           186   4e-53    
gb|KIY96104.1|  hypothetical protein MNEG_11860                         180   5e-53    
gb|ABR18416.1|  unknown                                                 188   6e-53    
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           185   7e-53    
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    185   7e-53    
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           185   8e-53    
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           185   9e-53    
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    185   9e-53    
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    184   1e-52    
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           184   1e-52    
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           184   1e-52    
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           184   2e-52    
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    183   2e-52    
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    183   3e-52    
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    183   4e-52    
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           183   5e-52    
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    183   5e-52    
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           182   6e-52    
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    181   7e-52    
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    182   8e-52    
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           182   9e-52    
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase                185   1e-51    
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    182   1e-51    
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           182   1e-51    
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    181   1e-51    
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           181   1e-51    
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           181   2e-51    
ref|WP_017327507.1|  glyceraldehyde-3-phosphate dehydrogenase           181   2e-51    
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           181   2e-51    
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           181   2e-51    
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           181   2e-51    
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    181   3e-51    
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        180   4e-51    
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    180   6e-51    
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           179   8e-51    
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           181   8e-51    
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           179   8e-51    
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           179   9e-51    
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    179   9e-51    
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                179   9e-51    
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                179   1e-50    
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        180   1e-50    
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    179   1e-50    
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    179   1e-50    
emb|CAB41845.1|  glyceraldehyde-3-phosphate dehydrogenase               178   2e-50    
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           179   2e-50    
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           179   2e-50    
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    178   2e-50    
gb|ADB81485.1|  glyceraldehyde-3-phosphate dehydrogenase                177   2e-50    
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase           178   2e-50    
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    178   3e-50    
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    178   3e-50    
ref|WP_010475353.1|  glyceraldehyde-3-phosphate dehydrogenase           178   3e-50    
ref|WP_012164673.1|  glyceraldehyde-3-phosphate dehydrogenase           178   3e-50    
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           178   4e-50    
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           177   4e-50    
gb|EYU41183.1|  hypothetical protein MIMGU_mgv1a025772mg                172   5e-50    
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           177   6e-50    
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           177   6e-50    
ref|WP_038650443.1|  glyceraldehyde-3-phosphate dehydrogenase           177   8e-50    
ref|WP_036906091.1|  glyceraldehyde-3-phosphate dehydrogenase           177   9e-50    
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                177   9e-50    
ref|WP_011293983.1|  glyceraldehyde-3-phosphate dehydrogenase           177   9e-50    
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           177   1e-49    
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    177   1e-49    
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase                176   1e-49    
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49    
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49    
ref|WP_011822824.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49    
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49    
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         176   2e-49    
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49    
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    176   2e-49    
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49    
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49    
gb|ADB81487.1|  glyceraldehyde-3-phosphate dehydrogenase                174   2e-49    
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    176   2e-49    
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49    
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    175   4e-49    
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           175   5e-49    
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           175   5e-49    
ref|WP_041384819.1|  glyceraldehyde-3-phosphate dehydrogenase           175   6e-49    
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           174   6e-49    
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           174   8e-49    
ref|YP_002049068.1|  Glyceraldehyde 3-phosphate dehydrogenase NAD...    174   8e-49    
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           174   9e-49    
emb|CAE20203.1|  Glyceraldehyde 3-phosphate dehydrogenase(NADP+; ...    175   1e-48    
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           174   1e-48    
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    174   1e-48    
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           174   2e-48    
ref|WP_036913110.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    174   2e-48    
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48    
emb|CAC80999.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    172   2e-48    
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48    



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   343 bits (881),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 193/220 (88%), Gaps = 4/220 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  216
            MASAALSVANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  217  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  396
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   SKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  397  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHI  576
            GIFDADVKPVG DGISVDGKVI+VVS RNP+NLPWG+LGIDLVIEGTGVFVDREGAGKHI
Sbjct  118  GIFDADVKPVGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHI  177

Query  577  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  178  QAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNAS  217



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 194/220 (88%), Gaps = 4/220 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  216
            MASAAL+VANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALTVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  217  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  396
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  397  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHI  576
            GIFDADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFVDREGAGKHI
Sbjct  118  GIFDADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHI  177

Query  577  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  178  QAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNAS  217



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   341 bits (874),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 192/220 (87%), Gaps = 4/220 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  216
            MASAALSVANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  217  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  396
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  397  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHI  576
            GIFDADVKPVG DGISVDGKVI+VVS RNP+NLPWG+LGIDLVIEGTGVFVDREGAGKHI
Sbjct  118  GIFDADVKPVGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHI  177

Query  577  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDE IISNAS
Sbjct  178  QAGAKKVLITAPGKGDIPTYVVGVNADLYNPDESIISNAS  217



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 191/221 (86%), Gaps = 2/221 (1%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA   L     KG S       SSSS LPF+R++ DD HS++SFQTS VG  G
Sbjct  1    MASATLSVAKPALQGNGGKGFSEFSGLRNSSSSYLPFSRKTSDDFHSIISFQTSAVGSSG  60

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  61   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  120

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKPVG+D ISVDGKVIKVVS+RNP NLPW ELG+DLVIEGTGVFVDREGAGKH
Sbjct  121  LGIFDADVKPVGEDAISVDGKVIKVVSNRNPANLPWKELGVDLVIEGTGVFVDREGAGKH  180

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS
Sbjct  181  IQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  221



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 192/220 (87%), Gaps = 6/220 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  216
            MASAALSVANS+L QVSNKG S       SS      A    DDL SVV+FQTSV+GG K
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFAGLRSSSLPFARKAS---DDLLSVVAFQTSVIGGGK  56

Query  217  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  396
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDSTL
Sbjct  57   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTL  116

Query  397  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHI  576
            GIF+ADVKP  D+GISVDGKVIKVV++RNP+NLPWGE+GIDLVIEGTGVFVDREGAGKHI
Sbjct  117  GIFEADVKP-ADEGISVDGKVIKVVTNRNPVNLPWGEMGIDLVIEGTGVFVDREGAGKHI  175

Query  577  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +AGAKKVLITAPGKGDIPTYV+GVNA+ Y+PDE IISNAS
Sbjct  176  QAGAKKVLITAPGKGDIPTYVIGVNAETYNPDETIISNAS  215



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 190/221 (86%), Gaps = 3/221 (1%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA  +L Q S KG S       S++S     + S DD  SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QASGKGFSEFSGLRSSTASLPFARKASSDDFLSVIAFQTSAVGSSG  59

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG+KQASHLLKYDST
Sbjct  60   GYKKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGIKQASHLLKYDST  119

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+ADVKPVG DGISVDGKVIKVVS+RNP+NLPW +LGIDLVIEGTGVFVDREGAGKH
Sbjct  120  LGIFNADVKPVGTDGISVDGKVIKVVSNRNPVNLPWKDLGIDLVIEGTGVFVDREGAGKH  179

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  180  IQAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  220



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   331 bits (848),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 190/220 (86%), Gaps = 3/220 (1%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  216
            MASA LSVANS L Q + KG S       SS+S     + S DDL SV++FQTSVVGG  
Sbjct  1    MASATLSVANSAL-QANGKGFSEFSGLRNSSASLPFARKAS-DDLLSVIAFQTSVVGGNG  58

Query  217  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  396
            Q+R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  59   QKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  118

Query  397  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHI  576
            GIF+ADVKP GD+ ISVDGK+IKVVS RNP+NLPW +LGIDLVIEGTGVFVDREGAGKHI
Sbjct  119  GIFEADVKPAGDNAISVDGKIIKVVSDRNPVNLPWKDLGIDLVIEGTGVFVDREGAGKHI  178

Query  577  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDE IISNAS
Sbjct  179  QAGAKKVLITAPGKGDIPTYVVGVNADTYNPDETIISNAS  218



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   329 bits (843),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 184/211 (87%), Gaps = 4/211 (2%)
 Frame = +1

Query  67   NSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRRAVVEAK  243
            NS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG   +R VVEAK
Sbjct  1    NSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGNSKRGVVEAK  57

Query  244  LKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKP  423
            LKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKP
Sbjct  58   LKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKP  117

Query  424  VGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLI  603
            VG DGISVDGKVI+VVS RNP+NLPWG+LGIDLVIEGTGVFVDREGAGKHI+AGAKKVLI
Sbjct  118  VGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLI  177

Query  604  TAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            TAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  178  TAPGKGDIPTYVVGVNADLYNPDEPIISNAS  208



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 186/221 (84%), Gaps = 3/221 (1%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MA+A LSVA  ++ Q + KG         SS+      R S DD  S+++FQTS VG  G
Sbjct  1    MATATLSVAKPSIQQANGKGFGEFSGLRNSSTCLPFARRTS-DDFLSIIAFQTSAVGSNG  59

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  60   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  119

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW +L IDLVIEGTGVFVDREGAGKH
Sbjct  120  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDLEIDLVIEGTGVFVDREGAGKH  179

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS
Sbjct  180  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  220



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   326 bits (835),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            DD  SV++FQTSVVGG K +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  38   DDFVSVIAFQTSVVGGGKNKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  97

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDSTLGIF+ADVKPVG+DGISVDGKVIKVVS RNP NLPW ++GIDL
Sbjct  98   DTGGVKQASHLLKYDSTLGIFEADVKPVGNDGISVDGKVIKVVSDRNPSNLPWKDMGIDL  157

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNAS
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYSPDEPIISNAS  215



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 193/225 (86%), Gaps = 6/225 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYD-DLHSVVSFQTSVVGG-  213
            MASAALSVANS++H   NKG  SEF+GLR+SS+         + DL S+V++QTSV+ G 
Sbjct  1    MASAALSVANSSVHVSKNKGSFSEFTGLRTSSAVPFGVGWKTNVDLLSLVAYQTSVISGA  60

Query  214  ----KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  381
                     VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND+GGVKQASHLLK
Sbjct  61   GKNNNNNSRVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDSGGVKQASHLLK  120

Query  382  YDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREG  561
            YDSTLGIFDADVKPVG DGISVDGK+IKVVS RNP+NLPW +LG+DLVIEGTGVFVDREG
Sbjct  121  YDSTLGIFDADVKPVGTDGISVDGKIIKVVSDRNPINLPWKDLGVDLVIEGTGVFVDREG  180

Query  562  AGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            AGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDE IISNAS
Sbjct  181  AGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYSPDESIISNAS  225



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 188/220 (85%), Gaps = 3/220 (1%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  216
            MAS  LSVAN +L Q + KG S       SS+S     + S DD  SV++FQTS VGG  
Sbjct  1    MASTTLSVANPSL-QANGKGFSDFSGLRISSASLPFARKTS-DDFLSVIAFQTSAVGGSG  58

Query  217  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  396
            Q+R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDSTL
Sbjct  59   QKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTL  118

Query  397  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHI  576
            GIF+ADVKP GDD ISVDGK+IKVVS+RNP NLPW +LGIDLVIEGTGVFVDREGAGKHI
Sbjct  119  GIFEADVKPAGDDAISVDGKIIKVVSNRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHI  178

Query  577  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +AGAKKVLITAPGKGDIPTYVVGVNAD+Y+P+EPIISNAS
Sbjct  179  QAGAKKVLITAPGKGDIPTYVVGVNADSYNPEEPIISNAS  218



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 186/217 (86%), Gaps = 4/217 (2%)
 Frame = +1

Query  49   AALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRR  225
            AALSVAN++L +VSNKG S       SS+          DDL SV   QTS +GG K +R
Sbjct  2    AALSVANTSL-KVSNKGFSEFSGLRTSSAVPFGRKTN--DDLFSVAGLQTSAIGGRKNKR  58

Query  226  AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  405
             V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF
Sbjct  59   IVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  118

Query  406  DADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAG  585
            DADVKPVG DGISVDGK+I+VVS+R+P+NLPWGELGIDLVIEGTGVFVDREGAGKHI+AG
Sbjct  119  DADVKPVGTDGISVDGKIIQVVSNRDPVNLPWGELGIDLVIEGTGVFVDREGAGKHIQAG  178

Query  586  AKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            AKKVLITAPGKGDIPTYVVGVNA+ Y+ DEPIISNAS
Sbjct  179  AKKVLITAPGKGDIPTYVVGVNAELYNHDEPIISNAS  215



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/221 (80%), Positives = 191/221 (86%), Gaps = 3/221 (1%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA  +  Q + KG +       SS++SL F RR+ DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPS-PQANGKGFAEFAGLRNSSAASLCFGRRTSDDLFSVIAFQTSAVGTNG  59

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              +R + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  60   GYKRGITEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  119

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDA+VKPVGDDGISVDGKVIKVVSSRNPLNLPW ++GIDLVIEGTGVFVDREGAGKH
Sbjct  120  LGIFDAEVKPVGDDGISVDGKVIKVVSSRNPLNLPWKDMGIDLVIEGTGVFVDREGAGKH  179

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEAGAKKVLITAPGKGDIPTYVVGVNA+ YS D+ IISNAS
Sbjct  180  IEAGAKKVLITAPGKGDIPTYVVGVNAELYSHDDTIISNAS  220



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 186/217 (86%), Gaps = 4/217 (2%)
 Frame = +1

Query  49   AALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRR  225
            AALSVAN++L +V+NKG S       SS+          DDL SV   QTS +GG K +R
Sbjct  2    AALSVANTSL-KVNNKGFSEFSGLRTSSAVPFGRKTN--DDLFSVAGLQTSAIGGRKNKR  58

Query  226  AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  405
             V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF
Sbjct  59   IVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  118

Query  406  DADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAG  585
            DADVKPVG DGISVDGKVI+VVS+R+P+NLPWGELG+DLVIEGTGVFVDREGAGKHI+AG
Sbjct  119  DADVKPVGTDGISVDGKVIQVVSNRDPVNLPWGELGVDLVIEGTGVFVDREGAGKHIQAG  178

Query  586  AKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            AKKVLITAPGKGDIPTYVVGVNA+ YS DEPIISNAS
Sbjct  179  AKKVLITAPGKGDIPTYVVGVNAELYSHDEPIISNAS  215



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   323 bits (829),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 188/224 (84%), Gaps = 5/224 (2%)
 Frame = +1

Query  40   MASAALSVANSTLH-QVSNKGlssefsglrssssslp-farrsYDDLHSVVSFQTSVVG-  210
            MASA +SVA   L  Q   KG+         +SS+   FAR++ DD HS+V+FQTS +G 
Sbjct  1    MASATVSVAKPNLQIQAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGS  60

Query  211  --GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  384
              G  R+ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY
Sbjct  61   NNGGYRKGMAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  120

Query  385  DSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGA  564
            DSTLGIF ADVKPVG DGISVDGKVIKVVS RNP NLPWG+LGIDLVIEGTGVFVDREGA
Sbjct  121  DSTLGIFAADVKPVGTDGISVDGKVIKVVSDRNPSNLPWGDLGIDLVIEGTGVFVDREGA  180

Query  565  GKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            GKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  181  GKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDEPIISNAS  224



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   323 bits (829),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 188/222 (85%), Gaps = 6/222 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  219
            MASA LSVA STL      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSTLQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  220  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF+ADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFVDREGAGK
Sbjct  118  TLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGK  177

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNAS
Sbjct  178  HIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNAS  219



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   323 bits (828),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 186/221 (84%), Gaps = 5/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASAALSVA  +L Q + KG +       S+S S        +D  SV++FQTS VG  G
Sbjct  1    MASAALSVAKPSL-QANGKGFAEFSGLRNSASVSFGRKNS--EDFLSVIAFQTSAVGSNG  57

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGG+KQASHLLKYDST
Sbjct  58   GYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGIKQASHLLKYDST  117

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+ADVKPVG DGISVDGKVIKVVS RNPLNLPW E+GIDLVIEGTGVFVDR+GAGKH
Sbjct  118  LGIFEADVKPVGTDGISVDGKVIKVVSDRNPLNLPWKEMGIDLVIEGTGVFVDRDGAGKH  177

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEAGAKKVLITAPGKGDIPTYVVGVNAD Y+P EPIISNAS
Sbjct  178  IEAGAKKVLITAPGKGDIPTYVVGVNADLYNPAEPIISNAS  218



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   323 bits (828),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 187/221 (85%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV+SFQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVISFQTSAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKPVGD+GISVDGKVIKVVSSRNPL+LPW +L IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFDADVKPVGDNGISVDGKVIKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ++AGAKKVLITAPGKGDIPTYVVGVNADAYSPDE IISNAS
Sbjct  179  LQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNAS  219



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 186/221 (84%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MA+A LSVA  ++ Q + KG         SS+      R S DD  S+++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFGEFSGLRNSSTCLPFARRTS-DDFLSIIAFQTSAVGSNG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW +L IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDLEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS
Sbjct  179  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  219



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 187/222 (84%), Gaps = 6/222 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  219
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  220  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF+ADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFVDREGAGK
Sbjct  118  TLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGK  177

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNAS
Sbjct  178  HIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNAS  219



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 187/222 (84%), Gaps = 6/222 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  219
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  220  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF+ADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFVDREGAGK
Sbjct  118  TLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGK  177

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNAS
Sbjct  178  HIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNAS  219



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 186/221 (84%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV+SFQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVISFQTSAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD+GISVDGKVIKVVSSRNPL+LPW +L IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFDADVKPAGDNGISVDGKVIKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ++AGAKKVLITAPGKGDIPTYVVGVNADAYSPDE IISNAS
Sbjct  179  LQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNAS  219



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 187/222 (84%), Gaps = 6/222 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  219
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  220  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF+ADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFVDREGAGK
Sbjct  118  TLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGK  177

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNAS
Sbjct  178  HIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNAS  219



>tpg|DAA37468.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=252

 Score =   315 bits (808),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  336
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  159

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  160  DLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNAS  219



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 187/222 (84%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA +SVA  TL Q + KG         SSSS     + S DD  SVV+FQTS +G   
Sbjct  1    MASATVSVAKPTL-QANGKGFGEFSGLRNSSSSLPFPRKTS-DDFLSVVAFQTSALGSNN  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKP GDD ISVDGK+IKVVS+RNP+NLPW +LGIDLVIEGTGVFVD +GAGK
Sbjct  119  TLGIFDADVKPAGDDAISVDGKIIKVVSNRNPVNLPWKDLGIDLVIEGTGVFVDSDGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNAD+Y+PDEPIISNAS
Sbjct  179  HIQAGAKKVLITAPGKGDIPTYVVGVNADSYNPDEPIISNAS  220



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  345
            +D  SV++FQTS +  K +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND
Sbjct  38   EDFLSVIAFQTSAIDSKNKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  97

Query  346  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  525
            TGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVI+VVS RNP NLPWG+LGIDLV
Sbjct  98   TGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIQVVSDRNPSNLPWGDLGIDLV  157

Query  526  IEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEGTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YS DEPIISNAS
Sbjct  158  IEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYSADEPIISNAS  214



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 187/221 (85%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVIAFQTSAVGSNG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKPVGD+G+SVDGK+IKVVSSRNP++LPW +L IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFDADVKPVGDNGLSVDGKIIKVVSSRNPIDLPWKDLEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            + AGAKKVLITAPGKGDIPTYVVGVNADAYSPDE IISNAS
Sbjct  179  LLAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNAS  219



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 182/222 (82%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA  SVA  +L Q + KG         SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATFSVAKPSL-QGNGKGFQEFSGLRNSSAFLPFSKKTS-DDFLSVVAFQTSAVGSSN  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKTVAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKPVG DGISVDGKVI+VVS RNP NLPW +LGIDLVIEGTGVFVDREGAGK
Sbjct  119  TLGIFDADVKPVGTDGISVDGKVIQVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNAD YS DEPIISNAS
Sbjct  179  HIQAGAKKVLITAPGKGDIPTYVVGVNADGYSADEPIISNAS  220



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 185/222 (83%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSAMGNSS  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFVDREGAGK
Sbjct  119  TLGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI AGAKKV+ITAPGKGDIPTYVVGVNADAYSPDEPIISNAS
Sbjct  179  HITAGAKKVIITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  220



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 184/222 (83%), Gaps = 6/222 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            M S  +SVA  TL Q + KG +       S+S +        DD  SV++FQTS +G   
Sbjct  1    MVSVTVSVAKPTL-QANAKGFAEFSGLRNSASLTFARKTS--DDFQSVIAFQTSALGINN  57

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  58   GGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  117

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF+ADVKPVGD+ ISVDGKVIKVVS RNP+NLPW +LGIDLVIEGTGVFVDR+GAGK
Sbjct  118  TLGIFEADVKPVGDNAISVDGKVIKVVSDRNPVNLPWKDLGIDLVIEGTGVFVDRDGAGK  177

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  178  HIQAGAKKVLITAPGKGDIPTYVVGVNADIYNPDEPIISNAS  219



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 185/222 (83%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSAMGNSS  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFVDREGAGK
Sbjct  119  TLGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  179  HITAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  220



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/222 (77%), Positives = 184/222 (83%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS  G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSATGNSS  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFVDREGAGK
Sbjct  119  TLGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  179  HITAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  220



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 187/221 (85%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVIAFQTSSVGSNG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKPVGD+G+SVDGK+IKVVSSRNP++LPW +L IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFDADVKPVGDNGLSVDGKIIKVVSSRNPIDLPWKDLEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            + AGAKKVLITAPGKGDIPTYVVGVNADAYSPDE IISNAS
Sbjct  179  LLAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNAS  219



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 164/178 (92%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            DD  SV++FQTS VGG K  R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  34   DDFFSVIAFQTSSVGGDKNSRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  93

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDSTLGIFDADVKPVG+D ISVDGKVIKVV+ RNP NLPW +LGIDL
Sbjct  94   DTGGVKQASHLLKYDSTLGIFDADVKPVGNDAISVDGKVIKVVTDRNPANLPWKDLGIDL  153

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y PDE IISNAS
Sbjct  154  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYKPDETIISNAS  211



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 195/223 (87%), Gaps = 6/223 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA  TL    N    SEFSGLR+S+  LPF+R++ DD HSVVSFQT+ VG  G
Sbjct  1    MASATLSVAKPTLK--GNGKGFSEFSGLRNSTGYLPFSRKTSDDFHSVVSFQTNAVGSNG  58

Query  214  KQRRA--VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
              +R   VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYD
Sbjct  59   GYKRGGVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYD  118

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            STLGIFDADVKPVG+D ISVDGKVI+VVS+RNP NLPW ELGIDLVIEGTGVFVDREGAG
Sbjct  119  STLGIFDADVKPVGNDAISVDGKVIQVVSNRNPSNLPWKELGIDLVIEGTGVFVDREGAG  178

Query  568  KHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            KHIEAGAKKVLITAPGKGDIPTYVVGVNADAY+ DE IISNAS
Sbjct  179  KHIEAGAKKVLITAPGKGDIPTYVVGVNADAYTHDEAIISNAS  221



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   318 bits (816),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 182/221 (82%), Gaps = 5/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA L+ AN+ L     KG S       +SSS       S DD  SVV+F+TS VG  G
Sbjct  1    MASATLTAANACLQ---GKGFSDFSGLRSASSSIPLRRINSSDDFLSVVAFRTSAVGSSG  57

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQASHLLKYDST
Sbjct  58   GYRKGAAEAKVKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQASHLLKYDST  117

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+A+VKP GD  ISVDGKVIKVVS+RNP NLPWGELGIDLVIEGTGVFVDREGAGKH
Sbjct  118  LGIFEANVKPEGDSAISVDGKVIKVVSNRNPANLPWGELGIDLVIEGTGVFVDREGAGKH  177

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVN DAY+PDEPIISNAS
Sbjct  178  IQAGAKKVLITAPGKGDIPTYVVGVNEDAYNPDEPIISNAS  218



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 181/222 (82%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  219
            MASA  SVAN  L +V+ KG S       SS       + S DD HSV+SFQT+ VG   
Sbjct  1    MASATFSVANPAL-KVNGKGFSEFSGLRNSSGYLPFSRKTS-DDFHSVISFQTNAVGSSG  58

Query  220  RR---AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            R     VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   RSKKGVVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKPVG DGISVDGKVIKVVS RNP NLPWGELGIDLVIEGTGVFVDREGAGK
Sbjct  119  TLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWGELGIDLVIEGTGVFVDREGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI AGAKKVLITAPGKGDIPTYVVGVNAD YS  + IISNAS
Sbjct  179  HITAGAKKVLITAPGKGDIPTYVVGVNADGYSHADDIISNAS  220



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 186/221 (84%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MA+A LSVA  ++ Q + KG +       SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFAEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW ++ IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEAGAKKVLITAPGKGDIPTYVVGVNADAYS DE IISNAS
Sbjct  179  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNAS  219



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   318 bits (815),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 184/220 (84%), Gaps = 4/220 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  216
            MASA  SVA  +L Q + KG +       S+S          +D  SV++FQTS VG   
Sbjct  1    MASATFSVAKPSL-QANGKGFTDFSGLRNSASLPFSRKTS--EDFLSVIAFQTSAVGNSG  57

Query  217  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  396
             R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   YRKGAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  397  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHI  576
            GIFDA+VKPVGD+ ISVDGKVIKVV++RNPL+LPWG+LG+DLVIEGTGVFVDR+GAGKHI
Sbjct  118  GIFDANVKPVGDNAISVDGKVIKVVTNRNPLDLPWGDLGVDLVIEGTGVFVDRDGAGKHI  177

Query  577  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  178  QAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  217



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   318 bits (815),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 186/221 (84%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MA+A LSVA  ++ Q + KG +       SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFAEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW ++ IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEAGAKKVLITAPGKGDIPTYVVGVNADAYS DE IISNAS
Sbjct  179  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNAS  219



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 188/221 (85%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            M+SA LSVA  +L Q + KGL+       SS+      + S DDL SV++FQTS +G  G
Sbjct  1    MSSAILSVAKPSL-QANGKGLAEFSGLRTSSACLPFGKKTS-DDLFSVITFQTSALGSNG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKPVGD+G+SVDGK++KVVSSRNPL+LPW +L IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFDADVKPVGDNGLSVDGKIVKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            + AGAKKVLITAPGKGDIPTYVVGVNADAY+PDE IISNAS
Sbjct  179  LLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNAS  219



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 185/221 (84%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MA+A LSVA  ++ Q + KG         SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFGEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW ++ IDLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEAGAKKVLITAPGKGDIPTYVVGVNADAYS DE IISNAS
Sbjct  179  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNAS  219



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 186/229 (81%), Gaps = 12/229 (5%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV-----  204
            MASA LSVA  +L Q + KG         SS+      + S DD  SVV+FQTS      
Sbjct  1    MASATLSVAKPSL-QGNGKGFQEFSGLRNSSAFLPFAKKTS-DDFLSVVAFQTSAKRILT  58

Query  205  --VG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  369
              VG   G  R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS
Sbjct  59   VKVGSNNGGYRKTAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  118

Query  370  HLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  549
            HLLKYDSTLGIF+ADVKPVGD+GISVDGKVIKVVS RNP+NLPWGELGIDLVIEGTGVFV
Sbjct  119  HLLKYDSTLGIFEADVKPVGDNGISVDGKVIKVVSDRNPVNLPWGELGIDLVIEGTGVFV  178

Query  550  DREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+P EPIISNAS
Sbjct  179  DRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPAEPIISNAS  227



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 180/222 (81%), Gaps = 4/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA LSVA  +  Q + KG +       SS+      + S DD  SVV+FQTS +    
Sbjct  1    MASATLSVAKPSHLQANGKGFTEFSGLRNSSAFLPFAKKTS-DDFLSVVAFQTSALASSS  59

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  RRA  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  60   GGYRRAAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  119

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF+ADVKP GD  ISVDGK+IKV S+RNP+NLPW E+ IDLVIEGTGVFVDREGAGK
Sbjct  120  TLGIFEADVKPAGDSAISVDGKIIKVASNRNPVNLPWKEMEIDLVIEGTGVFVDREGAGK  179

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI AGAK VLITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  180  HIHAGAKNVLITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  221



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 182/222 (82%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA  SVA  +L Q S KG +       SS+      + S DD  S VS QTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSAVSLQTSALGSSS  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R++  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF ADVKPVGD+GISVDGKVIKVVSSRNPL+LPW +L IDLVIEGTGVFVDREGAGK
Sbjct  119  TLGIFAADVKPVGDNGISVDGKVIKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI AGAKKVLITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  179  HITAGAKKVLITAPGKGDIPTYVVGVNADAYSSDEPIISNAS  220



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 182/222 (82%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA  SVA  +L Q S KG +       SS+      + S DD  S VS QTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSAVSLQTSALGSSS  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF+ADVKPVGD+GISVDGKVIKVVSSRNPL+LPW +L +DLVIEGTGVFVDREGAGK
Sbjct  119  TLGIFEADVKPVGDNGISVDGKVIKVVSSRNPLDLPWKDLEVDLVIEGTGVFVDREGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI AGAKKVLITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  179  HITAGAKKVLITAPGKGDIPTYVVGVNADAYSSDEPIISNAS  220



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   316 bits (810),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 186/221 (84%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA  +L Q + KG +       S +      + S DDL SV++FQTS +G  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSLACLPFGRKTS-DDLFSVIAFQTSALGSNG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   VYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKPVGD+G+SVDGK++KVVSSRNPL+LPW +L IDLVIEGTGVFVDR+GAGKH
Sbjct  119  LGIFDADVKPVGDNGLSVDGKIVKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDRDGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            + AGAKKVLITAPGKGDIPTYVVGVNADAY+PDE IISNAS
Sbjct  179  LLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNAS  219



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 184/221 (83%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  213
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS+    G
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSMGNSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I AGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  179  ITAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  219



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   316 bits (809),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 183/221 (83%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  213
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS+    G
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSMGNSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFVDREGAGKH
Sbjct  119  LGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I AGAKKV+ITAPGKGDIPTYVVGVNADAY PDEPIISNAS
Sbjct  179  ITAGAKKVIITAPGKGDIPTYVVGVNADAYKPDEPIISNAS  219



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 186/228 (82%), Gaps = 7/228 (3%)
 Frame = +1

Query  25   PVNPAMASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV  204
            P   AMASA L+VAN++L Q + KG S       SS           DD  SV++F+TS 
Sbjct  37   PDTKAMASATLAVANASL-QANGKGFSEFSGLRSSSLPLRKINTS--DDFLSVIAFKTSA  93

Query  205  VGGKQ----RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  372
            V G      R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGG+KQASH
Sbjct  94   VAGGGGGGYRKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGIKQASH  153

Query  373  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVD  552
            LLKYDSTLGIF+ADVKP GD GISVDGKVIKVV++RNP++LPW ELGIDLVIEGTGVFVD
Sbjct  154  LLKYDSTLGIFEADVKPAGDAGISVDGKVIKVVTNRNPVSLPWKELGIDLVIEGTGVFVD  213

Query  553  REGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            REGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  214  REGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  261



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   315 bits (808),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  SVV+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+I+VVS+RNP NLPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIQVVSNRNPSNLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  158  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  216



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   315 bits (808),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  SVV+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+I+VVS+RNP NLPW E+GID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKIIQVVSNRNPSNLPWKEMGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  158  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  216



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 180/221 (81%), Gaps = 3/221 (1%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  213
            MASA L+ AN+ L Q S KG S       +S S       S DD  S V+F+T+     G
Sbjct  1    MASATLTAANACL-QASGKGFSDFSGLRSASCSIPLRKIHSSDDFLSTVAFRTAAESSSG  59

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGG+KQASHLLKYDST
Sbjct  60   GYRKGAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGIKQASHLLKYDST  119

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIF+ADVKP G   ISVDGKVIKVVS+RNPL+LPWGELG+DLVIEGTGVFVDREGAGKH
Sbjct  120  LGIFEADVKPEGQSAISVDGKVIKVVSNRNPLDLPWGELGVDLVIEGTGVFVDREGAGKH  179

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  180  IQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDEPIISNAS  220



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  336
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  159

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  160  DLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNAS  219



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  336
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  159

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  160  DLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNAS  219



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   313 bits (803),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  336
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  20   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  79

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  80   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  139

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  140  DLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNAS  199



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  SVV+FQTS +G  G  R+ V EAKLKVAI+GFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAISGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+I+VVS+RNP NLPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIQVVSNRNPSNLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  158  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  216



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 182/222 (82%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVAN  L +V+ KG S       SS       + S DD HSV+S QT+ VG  G
Sbjct  1    MASATFSVANPAL-KVNGKGFSEFSGLRNSSGYLPFSRKTS-DDFHSVISVQTNAVGSSG  58

Query  214  KQRRAVV-EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            + R+ VV EAK+KVAINGFGR GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   RSRKGVVVEAKIKVAINGFGRTGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKPVG DGISVDGKVIKVVS RNP NLPWGELGIDLVIEGTGVFVDREGAGK
Sbjct  119  TLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWGELGIDLVIEGTGVFVDREGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI AGAKKVLITAPGKGDIPTYVVGVNAD Y+  + IISNAS
Sbjct  179  HITAGAKKVLITAPGKGDIPTYVVGVNADGYNHADDIISNAS  220



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   313 bits (802),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 162/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            DD  + VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DSPL+VIAI
Sbjct  39   DDFVNAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRDDSPLEVIAI  98

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+G+D
Sbjct  99   NDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGVD  158

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            LVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNAD Y+PDEPIISNAS
Sbjct  159  LVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNADQYNPDEPIISNAS  217



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  336
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  99

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  159

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNAS
Sbjct  160  DLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNAS  219



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  336
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  98   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  157

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNAS
Sbjct  158  DLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNAS  217



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  336
            DD  + VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PLDVIA
Sbjct  39   DDFMNAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVIA  98

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  99   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  158

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNAS
Sbjct  159  DLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNAS  218



>emb|CBI21236.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   308 bits (788),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 181/222 (82%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
             LG F+ADVK VGDD ISVDGKVIK+VSSRNPL+LPWG+L IDLVIEGTGVFVDR+GAGK
Sbjct  119  ILGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+ DE IISNAS
Sbjct  179  HIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDESIISNAS  220



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            +D  SVV+FQTSVV G   +R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  37   EDFLSVVAFQTSVVWGSGYKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  96

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDSTLGIFDADVK  G D ISVDGKVI+VVS+RNP+NLPW +LGIDL
Sbjct  97   DTGGVKQASHLLKYDSTLGIFDADVKVAGVDAISVDGKVIRVVSNRNPVNLPWKDLGIDL  156

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVD+EGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+P EPIISNAS
Sbjct  157  VIEGTGVFVDKEGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPSEPIISNAS  214



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  158  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  216



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  158  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  216



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  153

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  154  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  212



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  158  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  216



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  153

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  154  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  212



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 179/215 (83%), Gaps = 2/215 (1%)
 Frame = +1

Query  52   ALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQRRAV  231
            A ++ANS+L QV+ KG S       SS+S   F  +S DD  S+V+ QTS VG K  +  
Sbjct  2    AFTMANSSL-QVNGKGFSEFAGLRSSSASLPAFQMKSCDDFVSMVALQTSFVG-KNSKGP  59

Query  232  VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDA  411
            VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI INDTGGVKQASHLLKYDSTLGIFDA
Sbjct  60   VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSTLGIFDA  119

Query  412  DVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAK  591
            DVKP GD  ISVDGK+IKVVS RNP NLPWGE+GIDLVIEGTGVFVDR+GAGKHIEAGAK
Sbjct  120  DVKPSGDQAISVDGKIIKVVSDRNPSNLPWGEMGIDLVIEGTGVFVDRDGAGKHIEAGAK  179

Query  592  KVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            KVLITAPGKGDIPTYVVGVNAD Y+  E IISNAS
Sbjct  180  KVLITAPGKGDIPTYVVGVNADLYNHSENIISNAS  214



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDADVKPVG D ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFVDREGAGKH
Sbjct  119  LGTFDADVKPVGSDIISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNAS
Sbjct  179  IQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNAS  219



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDADVKPVG D ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFVDREGAGKH
Sbjct  119  LGTFDADVKPVGSDIISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNAS
Sbjct  179  IQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNAS  219



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 164/181 (91%), Gaps = 4/181 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG---GKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVI  333
            DD HS+V+FQT+ VG   G ++  VVEAK LKVAINGFGRIGRNFLRCWHGRKDSPLDVI
Sbjct  41   DDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVI  100

Query  334  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  513
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVG DGISVDGKVIKVVS RNP NLPW ELG
Sbjct  101  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWKELG  160

Query  514  IDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNA  693
            IDLVIEGTGVFVDREGAG+HI AGAKKVLITAPGKGDIPTYVVGVNADAY+  + IISNA
Sbjct  161  IDLVIEGTGVFVDREGAGRHITAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNA  220

Query  694  S  696
            S
Sbjct  221  S  221



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 181/222 (82%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
             LG F+ADVK VGDD ISVDGKVIK+VSSRNPL+LPWG+L IDLVIEGTGVFVDR+GAGK
Sbjct  119  ILGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+ DE IISNAS
Sbjct  179  HIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDESIISNAS  220



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 182/228 (80%), Gaps = 7/228 (3%)
 Frame = +1

Query  25   PVNPAMASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV  204
            P    MASA L+VAN++L Q + KG S       SS           DD  SV+SF+TS 
Sbjct  37   PETKTMASATLAVANASL-QANGKGFSEFSGLRSSSLPLRRINTS--DDFISVISFKTSA  93

Query  205  VGGKQ----RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  372
            V G      R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQASH
Sbjct  94   VAGGSGGGYRKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQASH  153

Query  373  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVD  552
            LLKYDSTLGIF+ADVKP G+  ISVDGKVIKVV++RNPL+LPW ELGIDLVIEGTGVFVD
Sbjct  154  LLKYDSTLGIFEADVKPAGNAAISVDGKVIKVVTNRNPLDLPWKELGIDLVIEGTGVFVD  213

Query  553  REGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            REGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN + Y+PDEPIISNAS
Sbjct  214  REGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNVETYNPDEPIISNAS  261



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 181/222 (82%), Gaps = 5/222 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
             LG F+ADVK VGDD ISVDGKVIK+VSSRNPL+LPWG+L IDLVIEGTGVFVDR+GAGK
Sbjct  119  ILGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGK  178

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+ DE IISNAS
Sbjct  179  HIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDEXIISNAS  220



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   308 bits (789),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 162/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSFVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  158  IVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  216



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  153

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGAGKH+EAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  154  IVIEGTGVFVDREGAGKHMEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  212



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   308 bits (789),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDADVKPVG + ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFVDREGAGKH
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNAS
Sbjct  179  IQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNAS  219



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S V+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IKVVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKVVSNRNPSLLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDREGA KHIEAGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  158  IVIEGTGVFVDREGAXKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNAS  216



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDADVKPVG + ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFVDREGAGKH
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNAS
Sbjct  179  IQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNAS  219



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 183/221 (83%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDREGAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  175  IQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  215



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 183/221 (83%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDREGAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  175  IQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  215



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 176/221 (80%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATFSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDADVKPVG + ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFVDREGAGKH
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNAS
Sbjct  179  IQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNAS  219



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   306 bits (784),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  96

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGID
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGID  156

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            LVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNAS
Sbjct  157  LVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNAS  215



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   306 bits (784),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 163/181 (90%), Gaps = 4/181 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG---GKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVI  333
            DD HS+V+FQT+ VG   G ++  VVEAK LKVAINGFGRIGRNFLRCWHGRKDSPLDVI
Sbjct  41   DDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVI  100

Query  334  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  513
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVG DGISVDGKVIKVVS RNP NLPW ELG
Sbjct  101  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWKELG  160

Query  514  IDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNA  693
            IDLVIEGTGVFVDREGAG+HI AGAKKVLITAP KGDIPTYVVGVNADAY+  + IISNA
Sbjct  161  IDLVIEGTGVFVDREGAGRHITAGAKKVLITAPRKGDIPTYVVGVNADAYTHADDIISNA  220

Query  694  S  696
            S
Sbjct  221  S  221



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  96

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGID
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGID  156

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            LVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNAS
Sbjct  157  LVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNAS  215



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   306 bits (783),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 180/221 (81%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  213
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTSV    G
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSVGSNSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS 
Sbjct  59   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG F+ADVK VGDD ISVDGKVIK+VSSRNPL+LPWG+L IDLVIEGTGVFVDR+GAGKH
Sbjct  119  LGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVNAD Y+ DE IISNAS
Sbjct  179  IQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDESIISNAS  219



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 182/221 (82%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  55   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDREGAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNAS
Sbjct  175  IQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNAS  215



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 183/221 (83%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP +LPWGELGIDLVIEGTGVFVDREGAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSSLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  175  IQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  215



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 183/222 (82%), Gaps = 7/222 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            MASA LSVA S+L         SEFSGLRSSS      + S D+  S V+FQT  +G   
Sbjct  1    MASATLSVAKSSLQLQG----FSEFSGLRSSSGLPFAKKPSSDEFVSFVTFQTKALGNNN  56

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDS
Sbjct  57   GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAAHLLKYDS  116

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKP GD  +SVDGK+I+VVS RNP NLPW +LGIDLVIEGTGVFVD+EGAGK
Sbjct  117  TLGIFDADVKPSGDKALSVDGKIIQVVSDRNPANLPWKDLGIDLVIEGTGVFVDQEGAGK  176

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNADAY P EPIISNAS
Sbjct  177  HIQAGAKKVLITAPGKGDIPTYVVGVNADAYDPAEPIISNAS  218



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 181/221 (82%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S       FSGLR+SS+     R S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  55   AYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDR+GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ++AGAKKVLITAPGKGDIPTYVVGVNA+ YS  + IISNAS
Sbjct  175  LQAGAKKVLITAPGKGDIPTYVVGVNAELYSHADTIISNAS  215



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   303 bits (775),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 180/221 (81%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
               + V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYSKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDREGAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNAS
Sbjct  175  IQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNAS  215



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = +1

Query  169  DLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  345
            D  S VSFQTS+VGG K ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND
Sbjct  106  DFVSFVSFQTSLVGGEKNQKVVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  165

Query  346  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  525
            TGGVKQA+HLLKYDSTLGIFDA VKPVG D ISVDGK+I+VVS RNP NLPWG++GIDLV
Sbjct  166  TGGVKQAAHLLKYDSTLGIFDAVVKPVGTDAISVDGKIIQVVSDRNPSNLPWGDMGIDLV  225

Query  526  IEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            IEGTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+  + IISNAS
Sbjct  226  IEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNAS  282



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S VSFQTS +G  G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ I
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVI  96

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+I++VS RNP NLPWGELGID
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIQIVSDRNPSNLPWGELGID  156

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            LVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  157  LVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  215



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 181/221 (82%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDR+GAGKH
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  175  LQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  215



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 181/221 (82%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+I++VS RNP NLPWGELGIDLVIEGTGVFVDR+GAGKH
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIQIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  175  IQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  215



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDA VKPVG D ISVDGK IKVVS RNP NLPW ELGIDLVIEGTGVFVDREGAGKH
Sbjct  119  LGTFDAVVKPVGSDIISVDGKEIKVVSDRNPANLPWKELGIDLVIEGTGVFVDREGAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I AGAKKVLITAPGKGDIPTYVVGVN   YS DEPIISNAS
Sbjct  179  IVAGAKKVLITAPGKGDIPTYVVGVNEYDYSGDEPIISNAS  219



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   300 bits (769),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 181/221 (82%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSSMGSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQATHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDR+GAGKH
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ++AGAKKVLITAPGKGDIPTYVVGVNA+ YS  + IISNAS
Sbjct  175  LQAGAKKVLITAPGKGDIPTYVVGVNAELYSHADTIISNAS  215



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 180/221 (81%), Gaps = 8/221 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVV--GG  213
            MASA  SVA  +L   S       FSGLR+SS+     R S D+  S VSFQTS +   G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMRSNG  54

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDR+GAGKH
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKH  174

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  175  LQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  215



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 177/221 (80%), Gaps = 6/221 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  219
            MAS  LS+AN +L +V NKG S       SS           DDL + VSFQT+ VGGK+
Sbjct  1    MASNMLSIANPSL-RVYNKGFSEFSGLHTSSLPFGRKGS---DDLMAFVSFQTNAVGGKR  56

Query  220  --RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              +  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS 
Sbjct  57   SSQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSI  116

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDADVK  GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFVDR+GAGKH
Sbjct  117  LGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKH  176

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ++AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNAS
Sbjct  177  LQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNAS  217



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 179/221 (81%), Gaps = 6/221 (3%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  219
            MAS  LS+AN +L +VSNKG S       SS           DDL ++V+FQT+ + GK+
Sbjct  1    MASNMLSIANPSL-RVSNKGFSEFAGLHTSSLPFARRGS---DDLVALVAFQTNALAGKR  56

Query  220  --RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              +  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ IND+GGVKQASHLLKYDS 
Sbjct  57   STQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVINDSGGVKQASHLLKYDSI  116

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDADVKP G+D ISVDGKVIKVVS RNPLNLPW +LGIDLVIEGTGVFVDREGAGKH
Sbjct  117  LGTFDADVKPEGNDAISVDGKVIKVVSDRNPLNLPWKDLGIDLVIEGTGVFVDREGAGKH  176

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I+AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNAS
Sbjct  177  IQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNAS  217



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +1

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  10   GGYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  69

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKPVGD+G+SVDGK++KVVSSRNPL+LPW +L IDLVIEGTGVFVDREGAGK
Sbjct  70   TLGIFDADVKPVGDNGLSVDGKIVKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGK  129

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            H+ AGAKKVLITAPGKGDIPTYVVGVNADAY+PDE IISNAS
Sbjct  130  HLLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNAS  171



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 176/221 (80%), Gaps = 4/221 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDA VKPVG D ISVDGK IKVVS RNP NLPW ELGIDLVIEGTGVFVDRE AGKH
Sbjct  119  LGTFDAVVKPVGSDIISVDGKEIKVVSDRNPANLPWKELGIDLVIEGTGVFVDRERAGKH  178

Query  574  IEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            I AGAKKVLITAPGKGDIPTYVVGVN   YS DEPIISNAS
Sbjct  179  IVAGAKKVLITAPGKGDIPTYVVGVNEYDYSGDEPIISNAS  219



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 159/181 (88%), Gaps = 4/181 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGK---QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVI  333
            +D  S VSF+T  VG      RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PLDVI
Sbjct  39   EDFMSAVSFRTYAVGTSGSGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVI  98

Query  334  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  513
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+G
Sbjct  99   AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMG  158

Query  514  IDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNA  693
            IDLVIEGTGVFVDR+GAGKH+EAGAKKVLITAPGKGDIPTYVVGVNA+ YS  + IISNA
Sbjct  159  IDLVIEGTGVFVDRDGAGKHLEAGAKKVLITAPGKGDIPTYVVGVNAELYSHSDTIISNA  218

Query  694  S  696
            S
Sbjct  219  S  219



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   295 bits (755),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSV-VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            DDL + V+ Q++V V G Q+RAVVEAK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+ IN
Sbjct  37   DDLLTRVAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVIN  96

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDS LGIFDA VK VGDD ISVDGK+IK+VS RNPLNLPWGE+G+DL
Sbjct  97   DTGGVKQASHLLKYDSMLGIFDAYVKAVGDDAISVDGKIIKIVSDRNPLNLPWGEMGVDL  156

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYV+GVN + Y P E IISNAS
Sbjct  157  VIEGTGVFVDKEGAGKHLQAGAKKVLITAPGKGPIPTYVIGVNEELYDPSEQIISNAS  214



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   295 bits (755),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 157/180 (87%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  336
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+GI
Sbjct  98   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGI  157

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDR GAGKH+EAGAKKVLITAPGKGDIPTYV GVNAD Y+  + IISNAS
Sbjct  158  DLVIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNAS  217



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 157/180 (87%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  336
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  29   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  88

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+GI
Sbjct  89   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGI  148

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDR GAGKH+EAGAKKVLITAPGKGDIPTYV GVNAD Y+  + IISNAS
Sbjct  149  DLVIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNAS  208



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   293 bits (750),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDS  64

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID+VIEGTGVFVDREGAGK
Sbjct  65   TLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGK  124

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            H+EAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  125  HMEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  166



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = +1

Query  184  VSFQTSV-VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVK  360
            V+ Q++V V G Q+RAVVEAK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+ INDTGGVK
Sbjct  2    VAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVINDTGGVK  61

Query  361  QASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTG  540
            QASHLLKYDS LGIFDADVK VGDD ISVDGK+IK+VS RNPLNLPWGE+G+DLVIEGTG
Sbjct  62   QASHLLKYDSMLGIFDADVKAVGDDAISVDGKIIKIVSDRNPLNLPWGEMGVDLVIEGTG  121

Query  541  VFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VFVD+EGAGKH++AGAKKVLITAPGKG IPTYV+GVN + Y P E IISNAS
Sbjct  122  VFVDKEGAGKHLQAGAKKVLITAPGKGPIPTYVIGVNEELYDPSEQIISNAS  173



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  64

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDREGAGK
Sbjct  65   TLGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGK  124

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNAS
Sbjct  125  HIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNAS  166



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   293 bits (751),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  336
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGG KQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+GI
Sbjct  98   INDTGGAKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGI  157

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            DLVIEGTGVFVDR GAGKH+EAGAKKVLITAPGKGDIPTYV GVNAD Y+  + IISNAS
Sbjct  158  DLVIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNAS  217



>ref|XP_008663264.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58480.1| hypothetical protein ZEAMMB73_511551 [Zea mays]
Length=401

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 157/181 (87%), Gaps = 4/181 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  333
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRIGRNFLRCWHGR  DSPLDVI
Sbjct  37   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIGRNFLRCWHGRDNDSPLDVI  96

Query  334  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  513
            AINDTG +KQASHLLKYDS LGIFDADV+PVGD+ ISVDGKVIKVVS RNP NLPWGEL 
Sbjct  97   AINDTGDIKQASHLLKYDSMLGIFDADVEPVGDNAISVDGKVIKVVSDRNPSNLPWGELS  156

Query  514  IDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNA  693
            +DL IEGTGVFVD EGAGKHI+AGAKKVLITAP KG+IPTYVVGVNAD Y+PDEPII+NA
Sbjct  157  VDLFIEGTGVFVDHEGAGKHIQAGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIINNA  216

Query  694  S  696
            S
Sbjct  217  S  217



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   293 bits (749),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            +DL S V+ QT  V   G  +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDVI I
Sbjct  40   EDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVIVI  99

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDS LG FDADVK  GD  ISVDGKVIKVVS+R+PL LPWGELG+D
Sbjct  100  NDTGGVKQASHLLKYDSMLGTFDADVKVSGDSAISVDGKVIKVVSNRDPLKLPWGELGVD  159

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            LVIEGTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYVVGVNA+ YSP EPIISNAS
Sbjct  160  LVIEGTGVFVDQEGAGKHLKAGAKKVLITAPGKGAIPTYVVGVNAEQYSPTEPIISNAS  218



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   293 bits (749),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            +DL S V+ QT  V   G  +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDVI I
Sbjct  40   EDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVIVI  99

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDS LG FDADVK  GD  ISVDGKVIKVVS+R+PL LPWGELG+D
Sbjct  100  NDTGGVKQASHLLKYDSMLGTFDADVKVSGDSAISVDGKVIKVVSNRDPLKLPWGELGVD  159

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            LVIEGTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYVVGVNA+ YSP EPIISNAS
Sbjct  160  LVIEGTGVFVDQEGAGKHLKAGAKKVLITAPGKGAIPTYVVGVNAEQYSPTEPIISNAS  218



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score =   291 bits (744),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 155/166 (93%), Gaps = 3/166 (2%)
 Frame = +1

Query  205  VGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  378
            VGG++  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  8    VGGREGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  67

Query  379  KYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDRE  558
            KYDSTLGIFDADVKPVGD  IS+DGKVIKVVS  NP+NLPW +L IDLVIEGTGVFVDR+
Sbjct  68   KYDSTLGIFDADVKPVGDI-ISIDGKVIKVVSDHNPVNLPWKDLEIDLVIEGTGVFVDRD  126

Query  559  GAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            GAGKHI+AGAK VLITAPGKGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  127  GAGKHIQAGAKXVLITAPGKGDIPTYVVGVNADIYNPDEPIISNAS  172



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDS LG FD +VK  G DGISV GKVIKVVSSRNP NLPW +  IDL
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIKVVSSRNPQNLPWKDYEIDL  167

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNAS
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNAS  225



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDS LG FD +VK  G DGISV GKVIKVVSSRNP NLPW +  IDL
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIKVVSSRNPQNLPWKDYEIDL  167

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNAS
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNAS  225



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   291 bits (744),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDS LG FD +VK  G DGISV GKVIKVVSSRNP NLPW +  IDL
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIKVVSSRNPQNLPWKDYEIDL  167

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNAS
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNAS  225



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   290 bits (743),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDS LG FD +VK  G DGISV GKVIKVVSSRNP NLPW +  IDL
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIKVVSSRNPQNLPWKDYEIDL  167

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNAS
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNAS  225



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   288 bits (737),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  220  RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLG  399
            R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPL++IAINDTGGVKQASHLLKYDSTLG
Sbjct  2    RKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLEIIAINDTGGVKQASHLLKYDSTLG  61

Query  400  IFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIE  579
            IF ADVK VGDD ISVDGK I+VVS+RNP NLPWGELGIDLVIEGTGVFVDREGAGKHI+
Sbjct  62   IFGADVKAVGDDVISVDGKPIQVVSNRNPANLPWGELGIDLVIEGTGVFVDREGAGKHIQ  121

Query  580  AGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            AGAKKVLITAPGKGDIPTYVVGVNAD YSPD+ IISNAS
Sbjct  122  AGAKKVLITAPGKGDIPTYVVGVNADQYSPDDTIISNAS  160



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score =   286 bits (733),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  256  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDD  435
            INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF+ADVKPVG D
Sbjct  2    INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTD  61

Query  436  GISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPG  615
            GISVDGKVI+VVS+RNP NLPWG+LGIDLVIEGTGVFVDREGAGKHI+AGAKKVLITAPG
Sbjct  62   GISVDGKVIQVVSNRNPSNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPG  121

Query  616  KGDIPTYVVGVNADAYSPDEPIISNAS  696
            KGDIPTYVVGVNAD Y+PDEPIISNAS
Sbjct  122  KGDIPTYVVGVNADLYNPDEPIISNAS  148



>ref|XP_010458726.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010458727.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=283

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKP GD  +SVD K+I++VS RNP NLPWGELGIDLVIEGTGVFVDREGAGK
Sbjct  65   TLGIFDADVKPSGDAALSVDEKIIQIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGK  124

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            HI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  125  HIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  166



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  256  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDD  435
            INGFGRIGRNFLRCWHGRKDSPL+VIAIND+GGVKQASHLLKYDSTLGIFDADVKPVG D
Sbjct  2    INGFGRIGRNFLRCWHGRKDSPLEVIAINDSGGVKQASHLLKYDSTLGIFDADVKPVGTD  61

Query  436  GISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPG  615
            GISVDGKVIKVVS RNP+NLPW +LG+DLVIEGTGVFVDREGAGKHI+AGAKKVLITAPG
Sbjct  62   GISVDGKVIKVVSDRNPINLPWKDLGVDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPG  121

Query  616  KGDIPTYVVGVNADAYSPDEPIISNAS  696
            KGDIPTYVVGVNAD YSPDEPIISNAS
Sbjct  122  KGDIPTYVVGVNADLYSPDEPIISNAS  148



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   287 bits (734),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDR+GAGK
Sbjct  65   TLGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGK  124

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            H++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  125  HLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  166



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   286 bits (732),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGGVKQASHLLKYDSTLGIFDADV
Sbjct  1    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADV  60

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            KP G+  ISVDGK+I+VVS+RNP  LPW ELGID+VIEGTGVFVDREGAGKHIEAGAKKV
Sbjct  61   KPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKV  120

Query  598  LITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +ITAPGKGDIPTYVVGVNADAYS DEPIISNAS
Sbjct  121  IITAPGKGDIPTYVVGVNADAYSHDEPIISNAS  153



>ref|XP_008663258.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58475.1| hypothetical protein ZEAMMB73_739238 [Zea mays]
Length=401

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 155/181 (86%), Gaps = 4/181 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  333
            D+  S VSF+   +G   G+ RRA  EAKLKVA+NGFGRIGRN +RCWHGR  DSPLDVI
Sbjct  37   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAMNGFGRIGRNLMRCWHGRDNDSPLDVI  96

Query  334  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  513
            AINDTG VKQAS+LLKYDS LGIFDADV+PVGD+ ISVDGKVIKVVS RNP NLPWGEL 
Sbjct  97   AINDTGDVKQASYLLKYDSMLGIFDADVEPVGDNAISVDGKVIKVVSDRNPSNLPWGELS  156

Query  514  IDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNA  693
            +DL IEGTGVFVD E AGKHI+AGAKKVLITAP KG+IPTYVVGVNAD Y+PDEPIISNA
Sbjct  157  VDLFIEGTGVFVDHESAGKHIQAGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNA  216

Query  694  S  696
            S
Sbjct  217  S  217



>gb|AAB82133.1| glyceralehyde-3-phosphate dehydrogenase subunit [Oryza sativa 
Indica Group]
Length=343

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 3/180 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVIA  336
            D+  + VSF+T  VG  G  RRA  EAKLKVAINGFGR GRNFLRCWHGR  DSPL++I 
Sbjct  39   DNFMNPVSFRTHAVGTNGGARRAPTEAKLKVAINGFGRFGRNFLRCWHGRGDDSPLNIIP  98

Query  337  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  516
            INDTGGVKQASH LKY+STLGIFDADVKPVG++ +SV+G+VIKVVS RNP NLPWGELGI
Sbjct  99   INDTGGVKQASHRLKYNSTLGIFDADVKPVGENPLSVEGEVIKVVSDRNPSNLPWGELGI  158

Query  517  DLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +L+IEGTG+F +  GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNAS
Sbjct  159  ELLIEGTGLFFNANGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNAS  218



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 157/190 (83%), Gaps = 13/190 (7%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLR----------CWHGR  309
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLR          CWHGR
Sbjct  29   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRAQRIGRNFLRCWHGR  88

Query  310  KDS-PLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNP  486
             DS PL+VIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP
Sbjct  89   GDSSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNP  148

Query  487  LNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYS  666
             NLPWGE+GIDLVIEGTGVFVDR GAGKH+EAGAKKVLITAPGKGDIPTYV GVNAD Y+
Sbjct  149  SNLPWGEMGIDLVIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYT  208

Query  667  PDEPIISNAS  696
              + IISNAS
Sbjct  209  HADTIISNAS  218



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF ADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDR+GAGK
Sbjct  65   TLGIFGADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGK  124

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            H++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNAS
Sbjct  125  HLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNAS  166



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = +1

Query  178  SVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  354
             +V+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGG
Sbjct  53   QLVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGG  112

Query  355  VKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEG  534
            VKQASHLLKYDS LG FD DV+  G+DGISVDGKVIKVVS RNP+NLPW +  IDLVIEG
Sbjct  113  VKQASHLLKYDSILGTFDPDVQVAGNDGISVDGKVIKVVSDRNPVNLPWKDYEIDLVIEG  172

Query  535  TGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
             GVFVDREGAGKH++AGAKKVLITAPGKGDIPTYV GVN D Y P E IISNAS
Sbjct  173  PGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVCGVNEDKYYPAEEIISNAS  226



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  241  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  420
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV+QASHLLKYDSTLGIFDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVEQASHLLKYDSTLGIFDADVK  60

Query  421  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVL  600
            P GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDREGAGKHI+AGAKKVL
Sbjct  61   PSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVL  120

Query  601  ITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ITAPGKGDIPTYV GVNA+ YS ++ I+SNAS
Sbjct  121  ITAPGKGDIPTYVCGVNAELYSHEDTIVSNAS  152



>gb|AFW58485.1| hypothetical protein ZEAMMB73_956640 [Zea mays]
Length=372

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 151/181 (83%), Gaps = 4/181 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVI  333
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRI RNFLRCWHGR D SPLDVI
Sbjct  8    DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIRRNFLRCWHGRDDDSPLDVI  67

Query  334  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  513
            AINDTG VKQASHLLKYDS LGIFDAD + VGD+ ISVD KVIKVVS RNP NLPWGEL 
Sbjct  68   AINDTGDVKQASHLLKYDSLLGIFDADAELVGDNAISVDDKVIKVVSDRNPSNLPWGELS  127

Query  514  IDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNA  693
            +DL IEGTGVFVD EGAGKHI+ GAKKVLITAP KG+IPTYVVGVNAD Y+PDEPIISN 
Sbjct  128  VDLFIEGTGVFVDHEGAGKHIQVGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNT  187

Query  694  S  696
            S
Sbjct  188  S  188



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            DDL ++V+ QT V       RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ IN
Sbjct  38   DDLSTIVAAQTVVAASSGASRAVTEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVIN  97

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            DTGGVKQASHLLKYDS LG F+ADVK  G+D ISVDGKVIKVVS RNPLNLPWGE+GIDL
Sbjct  98   DTGGVKQASHLLKYDSMLGTFNADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGEMGIDL  157

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VIEGTGVFVD  GAGKHI+AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNAS
Sbjct  158  VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEQDYKHSDAIISNAS  215



>ref|XP_008664191.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Zea mays]
Length=420

 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 151/181 (83%), Gaps = 4/181 (2%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVI  333
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRI RNFLRCWHGR D SPLDVI
Sbjct  56   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIRRNFLRCWHGRDDDSPLDVI  115

Query  334  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  513
            AINDTG VKQASHLLKYDS LGIFDAD + VGD+ ISVD KVIKVVS RNP NLPWGEL 
Sbjct  116  AINDTGDVKQASHLLKYDSLLGIFDADAELVGDNAISVDDKVIKVVSDRNPSNLPWGELS  175

Query  514  IDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNA  693
            +DL IEGTGVFVD EGAGKHI+ GAKKVLITAP KG+IPTYVVGVNAD Y+PDEPIISN 
Sbjct  176  VDLFIEGTGVFVDHEGAGKHIQVGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNT  235

Query  694  S  696
            S
Sbjct  236  S  236



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = +1

Query  163  YDDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            +DDL ++V+ Q++V      +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ I
Sbjct  36   HDDLTTIVTAQSAVAASSGAKRAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVI  95

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDS LG FDADVK  G+D ISVDGKVIKVVS RNPLNLPWG++ ID
Sbjct  96   NDTGGVKQASHLLKYDSMLGTFDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDID  155

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            LVIEGTGVFVD  GAGKHI+AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNAS
Sbjct  156  LVIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEKDYKHSDSIISNAS  214



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 170/218 (78%), Gaps = 8/218 (4%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  210
            M S  +SVA  TL Q + KG +       S+S +        DD  SV++FQTS +G   
Sbjct  1    MVSVTVSVAKPTL-QANAKGFAEFSGLRNSASLTFARKTS--DDFQSVIAFQTSALGINN  57

Query  211  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  390
            G  ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  58   GGYQKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  117

Query  391  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGK  570
            TLGIF+ADVKPVGD+ ISVDGKVIKVVS RNP+NLPW +LGIDLVIEGTGVFVDR+GAGK
Sbjct  118  TLGIFEADVKPVGDNAISVDGKVIKVVSDRNPVNLPWKDLGIDLVIEGTGVFVDRDGAGK  177

Query  571  HIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPII  684
            H++AGAKKVLITAPGKG I   +   +  +Y+ D+ ++
Sbjct  178  HVQAGAKKVLITAPGKGIIKGTMTTTH--SYTGDQRLL  213



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 166/205 (81%), Gaps = 7/205 (3%)
 Frame = +1

Query  40   MASAALSVANSTLH-QVSNKGlssefsglrssssslp-farrsYDDLHSVVSFQTSVVG-  210
            MASA +SVA   L  Q   KG+         +SS+   FAR++ DD HS+V+FQTS +G 
Sbjct  1    MASATVSVAKPNLQIQAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGS  60

Query  211  --GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  384
              G  R+ + EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY
Sbjct  61   NNGGYRKGMAEAKVKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  120

Query  385  DSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGA  564
            DSTLGIF ADVKPVG DGISVDGKVIKVVS RNP NLPWG+LGIDLVIEGTGVFVDREGA
Sbjct  121  DSTLGIFAADVKPVGTDGISVDGKVIKVVSDRNPSNLPWGDLGIDLVIEGTGVFVDREGA  180

Query  565  GKHIEAGAKKVLITAPG--KGDIPT  633
            GKHI+AGAKKVLITAPG  KG + T
Sbjct  181  GKHIQAGAKKVLITAPGIIKGTMTT  205



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  241  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  420
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  421  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVL  600
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFVDR+GAGKH++AGAKKVL
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  601  ITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ITAPGKGDIPTYVVGVN + Y+  + IISNAS
Sbjct  121  ITAPGKGDIPTYVVGVNEEGYTHADTIISNAS  152



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   270 bits (690),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  241  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  420
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  421  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVL  600
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFVDR+GAGKH++AGAKKVL
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  601  ITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ITAPGKGDIPTYVVGVN + Y+  + IISNAS
Sbjct  121  ITAPGKGDIPTYVVGVNEEGYTHADTIISNAS  152



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   270 bits (690),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  241  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  420
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  421  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVL  600
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFVDR+GAGKH++AGAKKVL
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  601  ITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ITAPGKGDIPTYVVGVN + Y+  + IISNAS
Sbjct  121  ITAPGKGDIPTYVVGVNEEGYTHADTIISNAS  152



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  265  FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGIS  444
            FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDSTLGIFDADVKP GD  +S
Sbjct  1    FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALS  60

Query  445  VDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGD  624
            VDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGD
Sbjct  61   VDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGD  120

Query  625  IPTYVVGVNADAYSPDEPIISNAS  696
            IPTYVVGVNA+ YS ++ IISNAS
Sbjct  121  IPTYVVGVNAELYSHEDTIISNAS  144



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  241  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  420
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  421  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVL  600
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFVDR+GAGKH++AGAKKVL
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  601  ITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ITAPGKGDIPTYVVGVN + Y+  + IISNAS
Sbjct  121  ITAPGKGDIPTYVVGVNEEGYTHADTIISNAS  152



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   270 bits (691),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +1

Query  220  RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLG  399
            +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG
Sbjct  63   KRAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLG  122

Query  400  IFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIE  579
             FDADVK  G+D ISVDGKVIKVVS RNPLNLPWG++ IDLVIEGTGVFVD  GAGKHI+
Sbjct  123  TFDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQ  182

Query  580  AGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNAS
Sbjct  183  AGAKKVLITAPGKGAIPTYVVGVNEKDYKHSDSIISNAS  221



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   268 bits (684),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  241  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  420
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ IND GGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDAGGVKQASHLLKYDSILGTFDADVK  60

Query  421  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVL  600
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFVDR+GAGKH++AGAKKVL
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  601  ITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ITAPGKGDIPTYVVGVN + Y+  + IISNAS
Sbjct  121  ITAPGKGDIPTYVVGVNEEGYTHADTIISNAS  152



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   268 bits (686),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLD++ INDTGGVKQASHLLKYDS LG 
Sbjct  34   RAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDIVVINDTGGVKQASHLLKYDSMLGT  93

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            FDADVK  G+D ISVDGKVIKVVS RNPLNLPWG++ IDLVIEGTGVFVD  GAGKHI+A
Sbjct  94   FDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQA  153

Query  583  GAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            GAKKVLITAPGKG IPTYVVGVN   Y   + IISNAS
Sbjct  154  GAKKVLITAPGKGPIPTYVVGVNEQDYKHSDTIISNAS  191



>gb|AAB66887.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
Length=268

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 137/144 (95%), Gaps = 1/144 (1%)
 Frame = +1

Query  268  GRIGRNFLRCWHGR-KDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGIS  444
            GRIGRNFLRCWHGR   SPLDVIAIN+TGGVKQASHLLKY+STLGIFDADVKPVGD+ IS
Sbjct  2    GRIGRNFLRCWHGRGNSSPLDVIAINNTGGVKQASHLLKYNSTLGIFDADVKPVGDNAIS  61

Query  445  VDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGD  624
            VDGKVIKVVS RNP NLPWGELGI+LVI+GTGVFV+R+GAGKHI+AGAKKVLITAPGKGD
Sbjct  62   VDGKVIKVVSDRNPSNLPWGELGINLVIKGTGVFVNRDGAGKHIQAGAKKVLITAPGKGD  121

Query  625  IPTYVVGVNADAYSPDEPIISNAS  696
            IPTYVVGVNAD YSPDEPIISNAS
Sbjct  122  IPTYVVGVNADQYSPDEPIISNAS  145



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   267 bits (682),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  235  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDAD  414
            EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG F+AD
Sbjct  68   EAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNAD  127

Query  415  VKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKK  594
            VK  G+D ISVDGKVIKVVS RNPLNLPWGE+GIDLVIEGTGVFVD  GAGKHI+AGAKK
Sbjct  128  VKVEGNDAISVDGKVIKVVSDRNPLNLPWGEMGIDLVIEGTGVFVDEAGAGKHIQAGAKK  187

Query  595  VLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            VLITAPGKG IPTYVVGVN   Y   + IISNAS
Sbjct  188  VLITAPGKGAIPTYVVGVNEQDYKHSDAIISNAS  221



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score =   261 bits (668),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  247  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  426
            KV INGFGRIGRNF+RCWHGR DSPL+VIAINDTGGVKQA+HLLKYDS LGIF+ADVK  
Sbjct  1    KVGINGFGRIGRNFIRCWHGRDDSPLEVIAINDTGGVKQAAHLLKYDSMLGIFNADVKIA  60

Query  427  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLIT  606
             D+ ISVDGK+IKVVS RNPLNLPWGE+GIDLVIEGTGVF+D  GAGKHIEAGAKKVLIT
Sbjct  61   DDNSISVDGKIIKVVSDRNPLNLPWGEMGIDLVIEGTGVFIDGPGAGKHIEAGAKKVLIT  120

Query  607  APGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            APGKG IPTYVVGVNAD Y   EPIISNAS
Sbjct  121  APGKGPIPTYVVGVNADKYVHSEPIISNAS  150



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RAV EAK+KVAINGFGRIGRNF+RCW GRKDSPLDV+ INDTGGVKQASHLLKYDS LG 
Sbjct  64   RAVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGT  123

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F+ADVK  G++ ISVDGKVIKVVS RNPLNLPWG++ IDLVIEGTGVFVD  GAGKHI+A
Sbjct  124  FNADVKVEGNNAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQA  183

Query  583  GAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            GAKKVLITAPGKG IPT+VVGVN   Y   + IISNAS
Sbjct  184  GAKKVLITAPGKGAIPTFVVGVNEQDYKHSDAIISNAS  221



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RAV EAK+KVAINGFGRIGRNF+RCW GRKDSPLDV+ INDTGGVKQASHLLKYDS LG 
Sbjct  36   RAVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGT  95

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F+ADVK  G++ ISVDGKVIKVVS RNPLNLPWG++ IDLVIEGTGVFVD  GAGKHI+A
Sbjct  96   FNADVKVEGNNAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQA  155

Query  583  GAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            GAKKVLITAPGKG IPT+VVGVN   Y   + IISNAS
Sbjct  156  GAKKVLITAPGKGAIPTFVVGVNEQDYKHSDAIISNAS  193



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 141/179 (79%), Gaps = 22/179 (12%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S VSFQTS +G     R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP D+IAI
Sbjct  38   DEFVSAVSFQTSAMGSSSGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDIIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IKVVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKVVSNRNPSLLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDRE                    GDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  158  IVIEGTGVFVDRE--------------------GDIPTYVVGVNADAYNPDEPIISNAS  196



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 142/179 (79%), Gaps = 22/179 (12%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S ++FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAITFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IKVVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKVVSNRNPSLLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDRE                    GDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  158  IVIEGTGVFVDRE--------------------GDIPTYVVGVNADAYNPDEPIISNAS  196



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 142/179 (79%), Gaps = 22/179 (12%)
 Frame = +1

Query  166  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  339
            D+  S V+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  340  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  519
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IK+VS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKIVSNRNPSLLPWKELGID  157

Query  520  LVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            +VIEGTGVFVDRE                    GDIPTYVVGVNADAY+PDEPIISNAS
Sbjct  158  IVIEGTGVFVDRE--------------------GDIPTYVVGVNADAYNPDEPIISNAS  196



>gb|ABD37958.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Chara vulgaris]
Length=318

 Score =   257 bits (656),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  247  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  426
            KV INGFGRIGRNFLRCWH RKDSPL+++AINDTGGVKQASHLLKYDS LG+F  +VK  
Sbjct  1    KVGINGFGRIGRNFLRCWHTRKDSPLEIVAINDTGGVKQASHLLKYDSMLGVFSGNVKIE  60

Query  427  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLIT  606
             +D ISVDGK I++VS+RNPLNLPWGE+GIDLVIEGTGVFVDREGAGKH++AGAKKVLIT
Sbjct  61   AEDVISVDGKSIQIVSNRNPLNLPWGEMGIDLVIEGTGVFVDREGAGKHLQAGAKKVLIT  120

Query  607  APGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            APGKGDIPTYVVGVN   Y P E IISNAS
Sbjct  121  APGKGDIPTYVVGVNDADYDPSETIISNAS  150



>emb|CAC80393.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=318

 Score =   256 bits (655),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  247  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  426
            KV INGFGRIGRNF+RCWHGRKDSPL+++ INDTGG+KQASHLLKYDS LG F ADVK  
Sbjct  1    KVGINGFGRIGRNFIRCWHGRKDSPLEIVVINDTGGLKQASHLLKYDSMLGTFAADVKVD  60

Query  427  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLIT  606
            G+D ISVDGK IKVVS RNPLNLPWGELGIDLVIEGTGVFVD+EGAGKH++AGAKKVLIT
Sbjct  61   GNDSISVDGKTIKVVSDRNPLNLPWGELGIDLVIEGTGVFVDKEGAGKHLKAGAKKVLIT  120

Query  607  APGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            APGKG IPTYVVGVNAD Y+  + IISNAS
Sbjct  121  APGKGAIPTYVVGVNADEYNHGDEIISNAS  150



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RAV EAK++VAINGFGRIGRNF+RCWHGRKDSPL+V+ INDTGGVKQASHLLKYDS LG 
Sbjct  36   RAVTEAKIRVAINGFGRIGRNFVRCWHGRKDSPLEVVVINDTGGVKQASHLLKYDSMLGT  95

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F+ADVK V  DGISVDGK IKVVS RNPLNLPWG++ IDLVIEGTGVFVD  GAGKH++A
Sbjct  96   FNADVK-VDGDGISVDGKTIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHLQA  154

Query  583  GAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            GAKKVLITAPGKG IPTYV+GVN   Y+  + IISNAS
Sbjct  155  GAKKVLITAPGKGAIPTYVIGVNEQDYTHADKIISNAS  192



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +1

Query  241  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  420
            KLKVAINGFGRIGRNFLRCWHG KDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHG-KDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  59

Query  421  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVL  600
              GD  ISV GKVIKVVS RNP+NLPWG++GIDLVIEGTGVFVDR+GAGKH++AGAKKVL
Sbjct  60   TAGDSAISV-GKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  118

Query  601  ITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            ITAPGKGDIPTYVVGVN + Y+  + IISNAS
Sbjct  119  ITAPGKGDIPTYVVGVNEEGYTHADTIISNAS  150



>gb|AGV54738.1| glyceraldehyde-3-phosphate dehydrogenase A chloroplastic-like 
protein [Phaseolus vulgaris]
Length=316

 Score =   254 bits (649),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 152/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  40   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  213
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  214  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  393
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  394  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKH  573
            LG FDA VKPVG D ISVDGK IKVVS RNP NLPW ELGIDLVIEGTGVFVDREG GKH
Sbjct  119  LGTFDAVVKPVGSDIISVDGKEIKVVSDRNPANLPWKELGIDLVIEGTGVFVDREGTGKH  178

Query  574  IEAGAKKVLITAPG  615
            I AGAKKVLIT PG
Sbjct  179  IVAGAKKVLITTPG  192



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 144/173 (83%), Gaps = 5/173 (3%)
 Frame = +1

Query  193  QTSVVGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVK  360
            Q + V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVK
Sbjct  17   QKAGVRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVK  76

Query  361  QASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTG  540
            QASHLLKYDSTLG FDADVK V D  ISVDGKVIK+VSSR+PL LPWGE+ +DLVIEGTG
Sbjct  77   QASHLLKYDSTLGTFDADVKIVDDSHISVDGKVIKIVSSRDPLQLPWGEMDVDLVIEGTG  136

Query  541  VFVDREGAGKHIEAGAKKVLITAPGK-GDIPTYVVGVNADAYSPDEPIISNAS  696
            VF+D+ GAGKHI+AGAKKVLITAP K  DIPT+VVGVN   Y  + PIISNAS
Sbjct  137  VFIDKVGAGKHIQAGAKKVLITAPAKDKDIPTFVVGVNEADYKHEYPIISNAS  189



>emb|CAC80391.2| glyceraldehyde-3-phosphate dehydrogenase [Klebsormidium flaccidum]
Length=315

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  247  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  426
            +  INGFGRIGRNFLRCW+GR++SPL+V+ INDTGGVKQASHLLKYDS LG FDADVK V
Sbjct  1    EFGINGFGRIGRNFLRCWNGRENSPLEVVVINDTGGVKQASHLLKYDSILGTFDADVKVV  60

Query  427  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLIT  606
            GDD ISVDGKVIKVVS+R+P  LPWGE+ IDLVIEGTGVFVD  GAGKH+EAGAKKVLIT
Sbjct  61   GDDAISVDGKVIKVVSNRDPTKLPWGEMNIDLVIEGTGVFVDEAGAGKHLEAGAKKVLIT  120

Query  607  APGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            APGKG+IPTYV+GVN + Y   E IISNAS
Sbjct  121  APGKGNIPTYVIGVNEEKYKHSEKIISNAS  150



>gb|ABD37960.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Coleochaete 
scutata]
Length=314

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +1

Query  256  INGFGRIGRNFLRCWHGR-KDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGD  432
            INGFGRIGRNF+RCWHGR KDSPL+VIAINDTGGVKQASHLLKYDS LG F A+VK VGD
Sbjct  1    INGFGRIGRNFIRCWHGRGKDSPLEVIAINDTGGVKQASHLLKYDSMLGTFGAEVKIVGD  60

Query  433  DGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAP  612
            D ISVDG VIKVVS RNPLN+PWG++G+DLVIEGTGVFVD EGAGKHI AGAKKVLITAP
Sbjct  61   DAISVDGHVIKVVSDRNPLNMPWGKMGVDLVIEGTGVFVDSEGAGKHITAGAKKVLITAP  120

Query  613  GKG-DIPTYVVGVNADAYSPDEPIISNAS  696
            GKG DIPTYVVGVNA  Y   + IISNAS
Sbjct  121  GKGKDIPTYVVGVNAQNYKHTDTIISNAS  149



>gb|ADB81491.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Klebsormidium 
flaccidum]
Length=314

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +1

Query  256  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDD  435
            INGFGRIGRNFLRCW+GR++SPL+V+ INDTGGVKQASHLLKYDS LG FDAD+K VGDD
Sbjct  2    INGFGRIGRNFLRCWNGRENSPLEVVVINDTGGVKQASHLLKYDSILGTFDADIKVVGDD  61

Query  436  GISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPG  615
             ISVDGKVIK+VS+R+P  LPWGE+ IDLVIEGTGVFVD  GAGKH++AGAKKVLITAPG
Sbjct  62   AISVDGKVIKIVSNRDPTKLPWGEMDIDLVIEGTGVFVDEAGAGKHLQAGAKKVLITAPG  121

Query  616  KGDIPTYVVGVNADAYSPDEPIISNAS  696
            KG+IPTYVVGV+ + Y   E IISNAS
Sbjct  122  KGNIPTYVVGVSEEKYKHSEAIISNAS  148



>gb|AEW46689.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ulva linza]
Length=352

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 135/158 (85%), Gaps = 1/158 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
             A  E KLKVAINGFGRIGR FLRCW+GR DS L+V+ IND+GG KQASHLLKYDST G 
Sbjct  30   EATSEKKLKVAINGFGRIGRQFLRCWYGRGDSLLEVVCINDSGGPKQASHLLKYDSTFGT  89

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            FDADV+ + DDGI+VDGK I+VVS+R+P  LPWGE+G+DLVIEGTGVFVD  GAGKH+EA
Sbjct  90   FDADVQ-IADDGITVDGKPIRVVSNRDPTQLPWGEMGVDLVIEGTGVFVDEAGAGKHLEA  148

Query  583  GAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNAS  696
            GAKKV+ITAPGKGDIPT+V+GVN D Y  + PI+SNAS
Sbjct  149  GAKKVVITAPGKGDIPTFVMGVNGDDYKHEYPIVSNAS  186



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 1/148 (1%)
 Frame = +1

Query  256  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDD  435
            INGFGRIGRNFLRCWHGR++SPL+V+AIND+GGVKQASHLLKYDS LG F ADVK V DD
Sbjct  2    INGFGRIGRNFLRCWHGRENSPLEVVAINDSGGVKQASHLLKYDSMLGTFAADVKAVSDD  61

Query  436  GISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPG  615
             ISVDGK+IK+VSSR+PL+LPW E+GID+VIEGTGVF+D  GAGKHI AGAKKVLITAPG
Sbjct  62   TISVDGKLIKIVSSRDPLSLPWKEMGIDIVIEGTGVFIDEAGAGKHITAGAKKVLITAPG  121

Query  616  KG-DIPTYVVGVNADAYSPDEPIISNAS  696
            KG +IPTYVVGVNAD Y   + I+SNAS
Sbjct  122  KGPNIPTYVVGVNADQYKSTDTIVSNAS  149



>gb|ACN39951.1| unknown [Picea sitchensis]
Length=330

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +1

Query  271  RIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVD  450
            RIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FD +VK  G DGISV 
Sbjct  4    RIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVG  63

Query  451  GKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIP  630
            GKVIKVVSSRNP NLPW +  IDLVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIP
Sbjct  64   GKVIKVVSSRNPQNLPWKDYEIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIP  123

Query  631  TYVVGVNADAYSPDEPIISNAS  696
            TYVVGVN   YSP + IISNAS
Sbjct  124  TYVVGVNEGKYSPTDDIISNAS  145



>gb|ADB81492.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=315

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 1/148 (1%)
 Frame = +1

Query  256  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDD  435
            INGFGRIGRNFLRCWHGR++SPL V+AIND+GGVKQASHLLKYDS LG F ADVK V DD
Sbjct  2    INGFGRIGRNFLRCWHGRENSPLAVVAINDSGGVKQASHLLKYDSMLGTFAADVKAVSDD  61

Query  436  GISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPG  615
             ISVDGK+IK+VSSR+PL+LPW E+GID+VIEGTGVF+D  GAGKHI AGAKKVLITAPG
Sbjct  62   TISVDGKLIKIVSSRDPLSLPWKEMGIDIVIEGTGVFIDEAGAGKHITAGAKKVLITAPG  121

Query  616  KG-DIPTYVVGVNADAYSPDEPIISNAS  696
            KG +IPTYVVGVNAD Y   + I+SNAS
Sbjct  122  KGPNIPTYVVGVNADQYKSTDTIVSNAS  149



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   242 bits (618),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  247  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  426
            KV INGFGRIGRNFLRCW GR+DSPL+++AINDTGGVKQASHLLKYDS LG F  DVK V
Sbjct  1    KVGINGFGRIGRNFLRCWWGREDSPLELVAINDTGGVKQASHLLKYDSMLGTFAPDVKAV  60

Query  427  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLIT  606
            GD+ ISVDG+   +VSSRNPL+LPW EL IDLVIEGTGVFVD  GAGKHIEAGAKKVLIT
Sbjct  61   GDNKISVDGQEFMIVSSRNPLDLPWKELDIDLVIEGTGVFVDSAGAGKHIEAGAKKVLIT  120

Query  607  APGKG-DIPTYVVGVNADAYSPDEPIISNAS  696
            AP KG DIPTYVVGVN   Y P  PIISNAS
Sbjct  121  APAKGSDIPTYVVGVNDQDYDPSAPIISNAS  151



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 5/169 (3%)
 Frame = +1

Query  205  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  372
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  21   VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  80

Query  373  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVD  552
            LLKYDSTLG F ADVK V D  ISVDGK IK+VSSR+PL LPW E+ IDLVIEGTGVF+D
Sbjct  81   LLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMNIDLVIEGTGVFID  140

Query  553  REGAGKHIEAGAKKVLITAPGK-GDIPTYVVGVNADAYSPDEPIISNAS  696
            + GAGKHI+AGA KVLITAP K  DIPT+VVGVN   Y  + PIISNAS
Sbjct  141  KVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYPIISNAS  189



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   241 bits (614),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 1/132 (1%)
 Frame = +1

Query  304  GRKD-SPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSR  480
            GR D SPL+VIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS+R
Sbjct  1    GRGDASPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSNR  60

Query  481  NPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADA  660
            NP NLPWGELG+DLVIEGTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD 
Sbjct  61   NPSNLPWGELGVDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQ  120

Query  661  YSPDEPIISNAS  696
            Y+PDEPIISNAS
Sbjct  121  YNPDEPIISNAS  132



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  205  IITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS  239



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  205  IITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS  239



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 135/169 (80%), Gaps = 2/169 (1%)
 Frame = +1

Query  196  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  375
            T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  376  LKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDR  555
            LKYDS LG F ADVK + ++ I+VDGK I VVSSR+PL LPW ELGID+VIEGTGVFVD 
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  556  EGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
             GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNAS  238



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  205  IITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS  239



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  205  IITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS  239



>gb|ABA01156.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
incerta]
Length=342

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 5/169 (3%)
 Frame = +1

Query  205  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  372
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  8    VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  67

Query  373  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVD  552
            LLKYDSTLG F ADVK V D  ISVDGK IK+VSSR+PL LPW E+ IDLVIEGTGVF+D
Sbjct  68   LLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMDIDLVIEGTGVFID  127

Query  553  REGAGKHIEAGAKKVLITAPGK-GDIPTYVVGVNADAYSPDEPIISNAS  696
            + GAGKHI+AGA KVLITAP K  DIPT+VVGVN   Y  + PIISNAS
Sbjct  128  KVGAGKHIQAGAHKVLITAPAKDKDIPTFVVGVNDADYKHEYPIISNAS  176



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 5/169 (3%)
 Frame = +1

Query  205  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  372
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  16   VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  75

Query  373  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVD  552
            LLKYDSTLG F ADVK V D  ISVDGK IK+VSSR+PL LPW E+ IDLVIEGTGVF+D
Sbjct  76   LLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMDIDLVIEGTGVFID  135

Query  553  REGAGKHIEAGAKKVLITAPGK-GDIPTYVVGVNADAYSPDEPIISNAS  696
            + GAGKHI+AGA KVLITAP K  DIPT+VVGVN   Y  + PIISNAS
Sbjct  136  KVGAGKHIQAGAHKVLITAPAKDKDIPTFVVGVNDADYKHEYPIISNAS  184



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = +1

Query  202  VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  381
            VVG    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLK
Sbjct  72   VVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  131

Query  382  YDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREG  561
            YDS LG F A+VK V ++ ISVDGK IKVVSSR+PL LPWGELGID+VIEGTGVFVD  G
Sbjct  132  YDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWGELGIDIVIEGTGVFVDGPG  191

Query  562  AGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            AGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  D   IISNAS
Sbjct  192  AGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYYHDVANIISNAS  238



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = +1

Query  202  VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  381
            VVG    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLK
Sbjct  71   VVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  130

Query  382  YDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREG  561
            YDS LG F A+VK V ++ ISVDGK IKVVSSR+PL LPWGELGID+VIEGTGVFVD  G
Sbjct  131  YDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWGELGIDIVIEGTGVFVDGPG  190

Query  562  AGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            AGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  D   IISNAS
Sbjct  191  AGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYYHDVANIISNAS  237



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GA KV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  199  GATKVIITAPAKGADIPTYVVGVNEKDYDHEVANIISNAS  238



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  53   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  112

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  113  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  172

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  173  IITAPAKGADIPTYVVGVNEQDYSHEVADIISNAS  207



>gb|ABC00187.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
 gb|ABC00188.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
Length=376

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G  +   V + K++VAINGFGRIGRNFLRCW GRKDS LDV+ +ND+GGVKQASHLLKYD
Sbjct  28   GAVKMEVVAQKKVRVAINGFGRIGRNFLRCWEGRKDSLLDVVCVNDSGGVKQASHLLKYD  87

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            +TLG FDADVK V D  ISV+GK I VVSSR+P  LPW  + IDLVIEGTGVFVD  GAG
Sbjct  88   TTLGKFDADVKAVDDKTISVNGKNIAVVSSRDPTQLPWKAMDIDLVIEGTGVFVDTPGAG  147

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNAS  696
            KHI+AGAKKVLITAP KG DIPT+VVGVN D Y+   PIISNAS
Sbjct  148  KHIQAGAKKVLITAPAKGNDIPTFVVGVNCDGYNHSYPIISNAS  191



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 141/179 (79%), Gaps = 4/179 (2%)
 Frame = +1

Query  172  LHSVVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  345
            L  VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND
Sbjct  58   LFDVVSAQLTPKTTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVND  117

Query  346  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  525
            +GGVK ASHLLKYDS LG F ADVK V ++ ISVDGK IKVVSSR+PL LPW ELGID+V
Sbjct  118  SGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIV  177

Query  526  IEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            IEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  178  IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  236



>gb|KJB57937.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=278

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            S LG F ADVK V ++ ISVDGK IKVVS+R+P+ LPW ELGID+VIEGTGVFVD  GAG
Sbjct  137  SMLGTFKADVKIVDNETISVDGKPIKVVSNRDPVQLPWAELGIDIVIEGTGVFVDGPGAG  196

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            KHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  197  KHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNAS  241



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAY  663
            +ITAP KG DIPTYVVGVN   Y
Sbjct  205  IITAPAKGADIPTYVVGVNEKDY  227



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGTFKADV  141

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  142  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  201

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  202  IITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  236



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  141

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  142  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  201

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  202  IITAPAKGADIPTYVVGVNEQDYSHEVADIISNAS  236



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V +  ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKADVKIVDNTTISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  199  GAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIVSNAS  238



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LGIF ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGIFKADV  143

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK ++VVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  144  KIVDNETISVDGKPVQVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  203

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  204  IITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  238



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  141

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  142  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  201

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  202  IITAPAKGADIPTYVVGVNEQDYSHEVADIISNAS  236



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 140/179 (78%), Gaps = 4/179 (2%)
 Frame = +1

Query  172  LHSVVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  345
               VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FFDVVSAQLTPKTTGSAPAKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  346  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  525
            +GGVK ASHLLKYDS LG F ADVK V ++ ISVDGK IKVVSSR+PL LPW ELGID+V
Sbjct  119  SGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIV  178

Query  526  IEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            IEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  179  IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEIANIISNAS  237



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGT  139

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK+IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  140  FKADVKIVNNETISVDGKLIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  199

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  200  GAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIVSNAS  239



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  143  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  202

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  203  IITAPAKGADIPTYVVGVNEQDYSHEIANIISNAS  237



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI +ND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVVNDSGGVRNASHLLKYDSMLGT  130

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V D+ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  131  FKADVKIVDDETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  190

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYV+GVN   YS +   IISNAS
Sbjct  191  GAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNAS  230



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  229  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFD  408
            V EAK+KVAINGFGRIGRNFLRCWHGR  S L+V+AIND+GGVKQASHL+KYDS LG F+
Sbjct  36   VTEAKVKVAINGFGRIGRNFLRCWHGRASSNLEVVAINDSGGVKQASHLVKYDSILGTFN  95

Query  409  ADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGA  588
            ADVK V D  IS+DGK I++VSSR+PL LPW +LG+ LVIEGTGVF+D  GA KH+EAGA
Sbjct  96   ADVKIVDDTHISIDGKSIEIVSSRDPLQLPWKKLGVQLVIEGTGVFIDTPGASKHLEAGA  155

Query  589  KKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNAS  696
            +KVLITAP KG DIPTYV+GVNAD Y+  + IISNAS
Sbjct  156  EKVLITAPAKGDDIPTYVMGVNADQYTHADKIISNAS  192



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 140/179 (78%), Gaps = 4/179 (2%)
 Frame = +1

Query  172  LHSVVSFQ--TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  345
             H V++ Q  T   G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FHDVIAAQLTTKTTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  346  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  525
            +GGVK A+HLLKYDS LG F ADVK V ++  S+DGK IKVVS+R+PL LPW +LGID+V
Sbjct  119  SGGVKSATHLLKYDSILGTFKADVKIVDNETFSIDGKSIKVVSNRDPLKLPWADLGIDIV  178

Query  526  IEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            IEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS D   IISNAS
Sbjct  179  IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHDVANIISNAS  237



>gb|KJB57939.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=320

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            S LG F ADVK V ++ ISVDGK IKVVS+R+P+ LPW ELGID+VIEGTGVFVD  GAG
Sbjct  137  SMLGTFKADVKIVDNETISVDGKPIKVVSNRDPVQLPWAELGIDIVIEGTGVFVDGPGAG  196

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            KHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  197  KHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNAS  241



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  143  KIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  202

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  203  IITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  237



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = +1

Query  178  SVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV  357
            SV    +S V G   R   EAKL+VAINGFGRIGRNFLRCWHGR DSPL+VIAIND+GGV
Sbjct  90   SVTRDVSSKVIGSGHRGETEAKLRVAINGFGRIGRNFLRCWHGRPDSPLEVIAINDSGGV  149

Query  358  KQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGT  537
            KQA+HLLKYDS LG F+ADVK V +  ISVDGKVI++VS+R+PL LPW ELGID+VIEGT
Sbjct  150  KQATHLLKYDSMLGTFNADVKTVDETHISVDGKVIQIVSNRDPLKLPWAELGIDIVIEGT  209

Query  538  GVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GVFVD  GAGKHI+AGAKKV+ITAP KG +IPTY VGVN   Y  D   IISNAS
Sbjct  210  GVFVDGPGAGKHIQAGAKKVIITAPAKGSEIPTYAVGVNEGDYHHDVSNIISNAS  264



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  143  KIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  202

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  203  IITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  237



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score =   234 bits (597),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAY  663
            +ITAP KG DIPTYVVGVN   Y
Sbjct  205  IITAPAKGADIPTYVVGVNEKDY  227



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  199  GAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIISNAS  238



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  143  KIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  202

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYV+GVN   YS +   I+SNAS
Sbjct  203  IITAPAKGADIPTYVIGVNEQDYSHEVANIVSNAS  237



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYD  133

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            S LG F ADVK V ++ ISVDGK+IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAG
Sbjct  134  SMLGTFKADVKIVDNETISVDGKLIKVVSSRDPLKLPWTELGIDIVIEGTGVFVDGPGAG  193

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            KHI+AGAKKV+ITAP KG DIPTYVVGVN   Y+ +   IISNAS
Sbjct  194  KHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHEISNIISNAS  238



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 139/169 (82%), Gaps = 5/169 (3%)
 Frame = +1

Query  196  TSVVGGKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  372
            T  VG KQ   V +AK + VAINGFGRIGRNFLRC  GR++S L++  IND+GGVKQASH
Sbjct  45   TGTVGSKQ---VTQAKKINVAINGFGRIGRNFLRCVEGRENSNLNITVINDSGGVKQASH  101

Query  373  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVD  552
            LLKYDSTLG F+AD+K + D  +SV+GK IK+VS+R+PL LPWGE+GIDLVIEGTGVFV 
Sbjct  102  LLKYDSTLGTFNADIKVIDDSTVSVNGKQIKIVSNRDPLQLPWGEMGIDLVIEGTGVFVS  161

Query  553  REGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNAS  696
             +GAGKHI+AGAKKVLITAP KG DIPTYV+GVN D + P  PIISNAS
Sbjct  162  SDGAGKHIKAGAKKVLITAPAKGNDIPTYVIGVNDDTFDPSAPIISNAS  210



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  134

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  135  FKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  194

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GA KV+ITAP KG DIPTYVVGVN   YS D   IISNAS
Sbjct  195  GASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNAS  234



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  205  IITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS  239



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score =   236 bits (601),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAY  663
            +ITAP KG DIPTYVVGVN   Y
Sbjct  205  IITAPAKGADIPTYVVGVNEKDY  227



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LGIF ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGIFKADV  143

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK ++VVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  144  KIVDNETISVDGKPVQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  203

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  204  IITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  238



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 143/180 (79%), Gaps = 4/180 (2%)
 Frame = +1

Query  163  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            +D + + ++ +T+  G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +N
Sbjct  61   FDAVAAQLTLKTA--GSTTVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVN  118

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            D+GGVK ASHLLKYDS LG F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+
Sbjct  119  DSGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDI  178

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  D   IISNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEQDYEHDVANIISNAS  238



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   239 bits (611),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA  EAKLKVAINGFGRIGRNFLRCWHGR+DSPLDV+ +ND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPLDVVVVNDSGGVRNASHLLKYDSMLGT  130

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V D  ISVDGK IKVVSSR+PL LPW E+GID+VIEGTGVFVD  GAGKHI+A
Sbjct  131  FKADVKIVDDTTISVDGKPIKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKHIQA  190

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   Y      IISNAS
Sbjct  191  GAKKVIITAPAKGADIPTYVVGVNEGDYDHGVADIISNAS  230



>gb|ACA35006.1| glyceraldehyde-3-phosphate dehydrogenase [Dunaliella salina]
Length=376

 Score =   238 bits (606),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G  +   V + KL+VAINGFGRIGRNFLRCW GR+DS LDV+ +ND+GGVKQASHLLKYD
Sbjct  28   GAVKMEVVAQKKLRVAINGFGRIGRNFLRCWEGRQDSLLDVVCVNDSGGVKQASHLLKYD  87

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            +TLG F ADVK V +  +SV+GK I VVSSR+P  LPW  + IDLVIEGTGVF+D  GAG
Sbjct  88   TTLGKFSADVKAVDEKTLSVNGKNIAVVSSRDPTQLPWKAMNIDLVIEGTGVFIDTPGAG  147

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNAS  696
            KHI+AGAKKVLITAP KG DIPT+VVGVN D Y  D PI+SNAS
Sbjct  148  KHIQAGAKKVLITAPAKGSDIPTFVVGVNCDGYKHDYPIVSNAS  191



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKADV  143

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  144  KIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  203

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  204  IITAPAKGADIPTYVVGVNEQGYSHEVSDIISNAS  238



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGT  134

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  135  FKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  194

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GA KV+ITAP KG DIPTYVVGVN   YS D   IISNAS
Sbjct  195  GASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNAS  234



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA  EAKLKVAINGFGRIGRNFLRCWHGR+DSP+DV+ +ND+GGV+ ASHLLKYDS LG 
Sbjct  76   RAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPIDVVVVNDSGGVRNASHLLKYDSMLGT  135

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V D  ISVDGK I VVSSR+PL LPWGELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  136  FKADVKIVDDTTISVDGKPITVVSSRDPLKLPWGELGIDIVIEGTGVFVDGPGAGKHIQA  195

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   Y      IISNAS
Sbjct  196  GAKKVIITAPAKGADIPTYVVGVNEGDYDHSVADIISNAS  235



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = +1

Query  190  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  369
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  370  HLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  549
            HLLKYDS LG F ADVK + ++ I+VDGK I VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  128  HLLKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFV  187

Query  550  DREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            D  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  188  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNAS  238



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +1

Query  172  LHSVVSFQ--TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  345
             H V++ Q  T   G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FHDVIAAQLTTKPTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  346  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  525
            +GGVK A+HLLKYDS LG F ADVK + ++  S+DGK IKVVS+R+PL LPW ELGID+V
Sbjct  119  SGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIV  178

Query  526  IEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            IEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  D   IISNAS
Sbjct  179  IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNAS  237



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  205  IITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS  239



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  235  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDAD  414
            +AK+KVAINGFGRIGRNFLRCWHGRKDS LDV+AIND+GGVKQASHL+KYDS LG F AD
Sbjct  40   KAKIKVAINGFGRIGRNFLRCWHGRKDSLLDVVAINDSGGVKQASHLVKYDSILGTFQAD  99

Query  415  VKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKK  594
            VK V D  +S+DGK I++VSSR+PL LPW ELG+ +VIEGTGVF+D  GA KH+ AGA K
Sbjct  100  VKIVDDTHMSIDGKSIQIVSSRDPLQLPWKELGVQIVIEGTGVFIDTPGASKHLTAGASK  159

Query  595  VLITAPGKG-DIPTYVVGVNADAYSPDEPIISNAS  696
            V+ITAP KG DIPTYV+GVNAD Y   + IISNAS
Sbjct  160  VIITAPAKGDDIPTYVMGVNADDYKDSDKIISNAS  194



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 140/179 (78%), Gaps = 4/179 (2%)
 Frame = +1

Query  172  LHSVVSFQTSV--VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  345
             + VV+ Q S    G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND
Sbjct  38   FYDVVAAQLSTKRTGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND  97

Query  346  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  525
            +GGVK ASHLLKYDS LG F A+VK + ++ I+VDGK IKVVSSR+PL LPW ELGID+V
Sbjct  98   SGGVKNASHLLKYDSMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIV  157

Query  526  IEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            IEGTGVFVD  GAGKH++AGAKKV+ITAP KG DIPTYV+GVN   Y  +   IISNAS
Sbjct  158  IEGTGVFVDGPGAGKHLQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNAS  216



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  139

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F A+VK V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  140  FKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  199

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  200  GAKKVIITAPAKGADIPTYVVGVNEGDYSHEVSNIVSNAS  239



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  139

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F A+VK V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  140  FKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  199

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  200  GAKKVIITAPAKGADIPTYVVGVNEGDYSHEVSNIVSNAS  239



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG 
Sbjct  78   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGT  137

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F A+VK V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  138  FKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  197

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   Y  D   I+SNAS
Sbjct  198  GAKKVIITAPAKGADIPTYVVGVNEKDYYHDVANIVSNAS  237



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK A+HLLKYDS LG F A V
Sbjct  46   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNAAHLLKYDSMLGTFKAAV  105

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  106  KIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  165

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  166  IITAPAKGSDIPTYVVGVNEGDYSDEVSNIVSNAS  200



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  204

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  205  IITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS  239



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  29   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGT  88

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK+IKVVS+R+PL LPW +LGID+VIEGTGVFVD  GAGKHI+A
Sbjct  89   FKADVKIVDNETISVDGKLIKVVSNRDPLKLPWADLGIDIVIEGTGVFVDGPGAGKHIQA  148

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GA KV+ITAP KG DIPTYVVGVN   YS D   IISNAS
Sbjct  149  GASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNAS  188



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  134

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  135  FKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  194

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GA KV+ITAP KG DIPTYVVGVN   Y+ D   IISNAS
Sbjct  195  GASKVIITAPAKGADIPTYVVGVNEQDYAHDVANIISNAS  234



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = +1

Query  190  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  369
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  370  HLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  549
            HLLKYDS LG F ADVK + ++ I+VDGK I VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  128  HLLKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFV  187

Query  550  DREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            D  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  188  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNAS  238



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = +1

Query  190  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  369
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  370  HLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  549
            HLLKYDS LG F ADVK + ++ I+VDGK I VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  128  HLLKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFV  187

Query  550  DREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            D  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  188  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNAS  238



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  199  GAKKVIITAPAKGADIPTYVVGVNEKDYDHEVSNIVSNAS  238



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK +KVVSSR+PL LPW E+GID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   Y  D   I+SNAS
Sbjct  199  GAKKVIITAPAKGADIPTYVVGVNEKDYGHDVANIVSNAS  238



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK +KVVSSR+PL LPW E+GID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   Y  D   I+SNAS
Sbjct  199  GAKKVIITAPAKGADIPTYVVGVNEKDYGHDVANIVSNAS  238



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  196  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  375
            T   G K   A+    +KVAINGFGRIGRNFLRCWHGR ++ LD++AIND+GGVKQASHL
Sbjct  29   TKATGSKTVAAMKGKTIKVAINGFGRIGRNFLRCWHGRANTMLDIVAINDSGGVKQASHL  88

Query  376  LKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDR  555
            +KYDS LG F+ADVK V D  IS+DGK I++VSSR+PL LPW  LG+DLVIEGTGVF+D 
Sbjct  89   VKYDSVLGTFEADVKIVDDTHISIDGKKIEIVSSRDPLQLPWKALGVDLVIEGTGVFIDT  148

Query  556  EGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNAS  696
             GA KHI AGA KVLITAP KG DIPTYV+GVNAD Y   + IISNAS
Sbjct  149  PGASKHITAGASKVLITAPAKGDDIPTYVLGVNADGYKHSDKIISNAS  196



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  196  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  375
            T   G K   A+    +KVAINGFGRIGRNFLRCWHGR ++ LD++AIND+GGVKQASHL
Sbjct  27   TKATGSKTVAAMKGKTIKVAINGFGRIGRNFLRCWHGRANTMLDIVAINDSGGVKQASHL  86

Query  376  LKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDR  555
            +KYDS LG F+ADVK V D  IS+DGK I++VSSR+PL LPW  LG+DLVIEGTGVF+D 
Sbjct  87   VKYDSVLGTFEADVKIVDDTHISIDGKKIEIVSSRDPLQLPWKALGVDLVIEGTGVFIDT  146

Query  556  EGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNAS  696
             GA KHI AGA KVLITAP KG DIPTYV+GVNAD Y   + IISNAS
Sbjct  147  PGASKHITAGASKVLITAPAKGDDIPTYVLGVNADGYKHSDKIISNAS  194



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  199  GAKKVIITAPAKGADIPTYVVGVNEKDYDHEVSNIVSNAS  238



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 139/178 (78%), Gaps = 3/178 (2%)
 Frame = +1

Query  172  LHSVVSFQTSVV-GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDT  348
            L   V  Q S+V  G   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA+ND+
Sbjct  40   LFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAVNDS  99

Query  349  GGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVI  528
            GGVK ASHLLKYDS LG F A+VK V D  ISVDGK I VVSSR+PL LPW ++GID+VI
Sbjct  100  GGVKNASHLLKYDSMLGTFKANVKVVDDKTISVDGKNITVVSSRDPLKLPWADMGIDIVI  159

Query  529  EGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            EGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  160  EGTGVFVDGPGAGKHIQAGAKKVIITAPAKGTDIPTYVVGVNEADYDHEVANIVSNAS  217



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V D  ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKADVKIVDDSTISVDGKHIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYVVGVN   YS     I+SNAS
Sbjct  199  GAKKVIITAPAKGADIPTYVVGVNEKDYSHQVANIVSNAS  238



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  72   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKADV  131

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            + V    ISVDGK+IKVVS+R+PL LPW +LGID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  132  QVVDSQTISVDGKLIKVVSNRDPLQLPWSDLGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  191

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   YS D   IISNAS
Sbjct  192  IITAPAKGADIPTYVVGVNEQDYSHDVSDIISNAS  226



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYD
Sbjct  75   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYD  134

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            S LG F ADVK + ++ I+VDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAG
Sbjct  135  SMLGTFKADVKILDNETITVDGKSIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  194

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            KHI+AGAKKV+ITAP KG DIPTYVVGVN   Y+ +   IISNAS
Sbjct  195  KHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHEISNIISNAS  239



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 139/178 (78%), Gaps = 3/178 (2%)
 Frame = +1

Query  172  LHSVVSFQTSVV-GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDT  348
            L   V  Q S+V  G   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA+ND+
Sbjct  40   LFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAVNDS  99

Query  349  GGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVI  528
            GGVK ASHLLKYDS LG F A+VK V D  ISVDGK I VVSSR+PL LPW ++GID+VI
Sbjct  100  GGVKNASHLLKYDSMLGTFKANVKVVDDKTISVDGKNIAVVSSRDPLKLPWADMGIDIVI  159

Query  529  EGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            EGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  160  EGTGVFVDGPGAGKHIQAGAKKVIITAPAKGTDIPTYVVGVNEADYDHEVANIVSNAS  217



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYD  133

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            S LG F ADVK + ++ I+VDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAG
Sbjct  134  SMLGTFKADVKILDNETITVDGKSIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  193

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            KHI+AGAKKV+ITAP KG DIPTYVVGVN   Y+ +   IISNAS
Sbjct  194  KHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHEISNIISNAS  238



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  238  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  417
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKADV  143

Query  418  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEAGAKKV  597
            K V ++ ISVDGK +KVVS+R+PL LPW E+GID+VIEGTGVFVD  GAGKHI+AGAKKV
Sbjct  144  KIVDNETISVDGKPVKVVSNRDPLKLPWTEMGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  203

Query  598  LITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            +ITAP KG DIPTYVVGVN   Y  D   I+SNAS
Sbjct  204  IITAPAKGADIPTYVVGVNEKDYDHDVANIVSNAS  238



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            S LG F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAG
Sbjct  137  SMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAG  196

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            KHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  197  KHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNAS  241



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA  EAKLKVAINGFGRIGRNFLRCWH R++SPL+V+ +ND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGGVRNASHLLKYDSMLGT  130

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V D  ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  131  FKADVKIVDDQTISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  190

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYV+GVN   YS +   IISNAS
Sbjct  191  GAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNAS  230



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+V+ IND+GGV+ ASHLLKYDS LG 
Sbjct  74   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVVVINDSGGVRNASHLLKYDSMLGT  133

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F ADVK V ++ ISVDGK I+VVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  134  FKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  193

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GAKKV+ITAP KG DIPTYV+GVN + Y  D   I+SNAS
Sbjct  194  GAKKVIITAPAKGADIPTYVLGVNEEGYDHDVANIVSNAS  233



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  139  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  198

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GA KV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  199  GATKVIITAPAKGADIPTYVVGVNEKDYDHEVANIISNAS  238



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +1

Query  223  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  402
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  48   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  107

Query  403  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIEA  582
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFVD  GAGKHI+A
Sbjct  108  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQA  167

Query  583  GAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            GA KV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  168  GATKVIITAPAKGADIPTYVVGVNEKDYDHEVANIISNAS  207



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  208  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  387
            G    + V  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYD
Sbjct  74   GSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYD  133

Query  388  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFVDREGAG  567
            S LG F A+VK + ++ I+VDGK IKVVSSR+PL LPW ELGID+VIEGTGVFVD  GAG
Sbjct  134  SMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  193

Query  568  KHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            KHI+AGAKKV+ITAP KG DIPTYV+GVN   Y  +   IISNAS
Sbjct  194  KHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNAS  238



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 142/180 (79%), Gaps = 2/180 (1%)
 Frame = +1

Query  163  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  342
            +D L + ++ ++  V     R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +N
Sbjct  61   FDVLAAQLTPKSEGVPSASVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVN  120

Query  343  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  522
            D+GGVK ASHLLKYDS LG F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+
Sbjct  121  DSGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDI  180

Query  523  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  696
            VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  181  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNAS  240



Lambda      K        H        a         alpha
   0.315    0.136    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160