BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038D08

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               144   2e-36   Solanum tuberosum [potatoes]
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           142   1e-35   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               141   2e-35   Solanum tuberosum [potatoes]
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           142   7e-35   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             139   1e-34   
gb|KDO42969.1|  hypothetical protein CISIN_1g048689mg                   134   1e-34   Citrus sinensis [apfelsine]
ref|XP_002510311.1|  cytochrome P450, putative                          138   3e-34   Ricinus communis
gb|KDO44281.1|  hypothetical protein CISIN_1g037130mg                   133   3e-34   Citrus sinensis [apfelsine]
ref|XP_002510308.1|  cytochrome P450, putative                          137   4e-34   Ricinus communis
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           137   4e-34   Nicotiana tomentosiformis
ref|XP_006375023.1|  hypothetical protein POPTR_0014s03670g             132   4e-34   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           137   5e-34   Nicotiana sylvestris
gb|KDO43361.1|  hypothetical protein CISIN_1g0369161mg                  134   6e-34   Citrus sinensis [apfelsine]
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     136   1e-33   Eucalyptus grandis [rose gum]
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           136   1e-33   Eucalyptus grandis [rose gum]
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           136   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_004291926.1|  PREDICTED: cytochrome P450 CYP82D47-like           136   1e-33   Fragaria vesca subsp. vesca
gb|KDO57198.1|  hypothetical protein CISIN_1g044206mg                   131   2e-33   Citrus sinensis [apfelsine]
ref|XP_007017415.1|  Cytochrome P450, putative                          135   2e-33   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     134   5e-33   Eucalyptus grandis [rose gum]
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   5e-33   Eucalyptus grandis [rose gum]
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   7e-33   Prunus mume [ume]
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   7e-33   Nicotiana sylvestris
ref|XP_006471190.1|  PREDICTED: cytochrome P450 82A3-like               129   7e-33   Citrus sinensis [apfelsine]
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               134   8e-33   Citrus sinensis [apfelsine]
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     133   8e-33   Eucalyptus grandis [rose gum]
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   9e-33   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               133   1e-32   Nicotiana tomentosiformis
ref|XP_006486513.1|  PREDICTED: cytochrome P450 82A3-like               132   1e-32   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             133   1e-32   Citrus clementina [clementine]
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               133   1e-32   
ref|XP_007017411.1|  Cytochrome P450, putative                          133   1e-32   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           133   2e-32   Eucalyptus grandis [rose gum]
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     134   2e-32   
ref|XP_006387541.1|  hypothetical protein POPTR_0875s00200g             131   2e-32   
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           132   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_004308852.2|  PREDICTED: cytochrome P450 CYP82D47-like           132   2e-32   Fragaria vesca subsp. vesca
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     132   2e-32   Eucalyptus grandis [rose gum]
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   132   2e-32   Citrus sinensis [apfelsine]
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             132   2e-32   Citrus clementina [clementine]
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     132   2e-32   Eucalyptus grandis [rose gum]
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           132   3e-32   Eucalyptus grandis [rose gum]
gb|KJB63762.1|  hypothetical protein B456_010G014800                    132   3e-32   Gossypium raimondii
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               132   4e-32   Citrus sinensis [apfelsine]
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               132   4e-32   Glycine max [soybeans]
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               131   4e-32   Citrus sinensis [apfelsine]
gb|AFO67235.1|  putative cytochrome P450                                125   5e-32   Aralia elata
ref|XP_006431672.1|  hypothetical protein CICLE_v10001614mg             130   5e-32   
ref|XP_006432715.1|  hypothetical protein CICLE_v10003834mg             127   6e-32   
ref|XP_007017412.1|  Cytochrome P450, putative                          131   6e-32   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     131   7e-32   Eucalyptus grandis [rose gum]
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           131   7e-32   Eucalyptus grandis [rose gum]
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             131   8e-32   Citrus clementina [clementine]
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             130   8e-32   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 CYP82D47-like           131   8e-32   Fragaria vesca subsp. vesca
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               131   8e-32   Glycine max [soybeans]
gb|KJB63759.1|  hypothetical protein B456_010G014500                    130   9e-32   Gossypium raimondii
gb|KJB63751.1|  hypothetical protein B456_010G014900                    130   9e-32   Gossypium raimondii
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           130   1e-31   Pyrus x bretschneideri [bai li]
gb|AGO03797.1|  cytochrome P450-like protein                            130   1e-31   Tanacetum cinerariifolium [pyrethrum]
ref|XP_006375027.1|  putative cytochrome P450 family protein            124   2e-31   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           130   2e-31   Eucalyptus grandis [rose gum]
ref|XP_006486182.1|  PREDICTED: cytochrome P450 82A3-like               128   2e-31   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           130   2e-31   Solanum lycopersicum
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             129   2e-31   Citrus clementina [clementine]
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               129   3e-31   Citrus sinensis [apfelsine]
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             129   3e-31   Citrus clementina [clementine]
ref|XP_010060881.1|  PREDICTED: cytochrome P450 82A3-like               126   3e-31   Eucalyptus grandis [rose gum]
ref|XP_006435901.1|  hypothetical protein CICLE_v10031635mg             129   3e-31   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               129   3e-31   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               129   3e-31   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               129   3e-31   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             129   3e-31   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               129   3e-31   Citrus sinensis [apfelsine]
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         129   4e-31   Jatropha curcas
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             129   4e-31   Citrus clementina [clementine]
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   129   4e-31   Citrus sinensis [apfelsine]
ref|XP_010106079.1|  Cytochrome P450 82A3                               129   4e-31   Morus notabilis
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             129   4e-31   Phaseolus vulgaris [French bean]
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             129   4e-31   Phaseolus vulgaris [French bean]
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               129   4e-31   Malus domestica [apple tree]
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             129   5e-31   Phaseolus vulgaris [French bean]
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               129   5e-31   Glycine max [soybeans]
gb|KHN13272.1|  Cytochrome P450 82A4                                    128   5e-31   Glycine soja [wild soybean]
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         128   6e-31   Jatropha curcas
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               128   7e-31   
gb|KDP38429.1|  hypothetical protein JCGZ_04354                         128   7e-31   Jatropha curcas
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    128   8e-31   Populus euphratica
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    128   8e-31   Populus euphratica
ref|XP_011030937.1|  PREDICTED: cytochrome P450 CYP82H23-like           126   8e-31   Populus euphratica
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           128   9e-31   Vitis vinifera
gb|KJB63753.1|  hypothetical protein B456_010G014200                    125   1e-30   Gossypium raimondii
gb|KJB63756.1|  hypothetical protein B456_010G014200                    125   1e-30   Gossypium raimondii
gb|AGC29951.1|  CYP82D61                                                127   1e-30   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|KJB63755.1|  hypothetical protein B456_010G014200                    125   1e-30   Gossypium raimondii
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               127   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    127   1e-30   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               127   1e-30   Solanum tuberosum [potatoes]
gb|KHG26594.1|  Cytochrome P450                                         127   2e-30   Gossypium arboreum [tree cotton]
dbj|BAF98469.1|  cytochrome P450                                        127   2e-30   Coptis japonica var. dissecta
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    127   2e-30   
gb|KEH30993.1|  cytochrome P450 family protein                          127   2e-30   Medicago truncatula
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               127   2e-30   Glycine max [soybeans]
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             127   2e-30   Citrus clementina [clementine]
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           127   2e-30   Solanum lycopersicum
ref|XP_007017413.1|  Cytochrome P450                                    126   2e-30   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               127   2e-30   
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             127   2e-30   Phaseolus vulgaris [French bean]
gb|KJB63763.1|  hypothetical protein B456_010G015000                    129   2e-30   Gossypium raimondii
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             126   2e-30   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           127   2e-30   Pyrus x bretschneideri [bai li]
gb|KJB63754.1|  hypothetical protein B456_010G014200                    126   2e-30   Gossypium raimondii
gb|KCW67760.1|  hypothetical protein EUGRSUZ_F01497                     126   3e-30   Eucalyptus grandis [rose gum]
gb|KJB59837.1|  hypothetical protein B456_009G274900                    126   3e-30   Gossypium raimondii
ref|XP_010106088.1|  Cytochrome P450 82A4                               126   3e-30   
gb|KJB14542.1|  hypothetical protein B456_002G130200                    125   3e-30   Gossypium raimondii
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         126   3e-30   Jatropha curcas
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             126   3e-30   
gb|KGN59915.1|  Cytochrome P450                                         126   3e-30   Cucumis sativus [cucumbers]
gb|KJB63765.1|  hypothetical protein B456_010G015200                    126   4e-30   Gossypium raimondii
gb|KDP38435.1|  hypothetical protein JCGZ_04360                         120   5e-30   Jatropha curcas
gb|KHN19614.1|  Cytochrome P450 82A4                                    125   5e-30   Glycine soja [wild soybean]
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                125   6e-30   Vitis vinifera
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           125   6e-30   Eucalyptus grandis [rose gum]
gb|KHN34164.1|  Cytochrome P450 82A4                                    124   6e-30   Glycine soja [wild soybean]
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    125   6e-30   Populus euphratica
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               125   7e-30   
emb|CBI19611.3|  unnamed protein product                                127   7e-30   Vitis vinifera
gb|KDO36922.1|  hypothetical protein CISIN_1g041575mg                   122   8e-30   Citrus sinensis [apfelsine]
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             125   8e-30   Citrus clementina [clementine]
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               125   9e-30   Solanum tuberosum [potatoes]
gb|KDP38430.1|  hypothetical protein JCGZ_04355                         125   9e-30   Jatropha curcas
gb|KJB47835.1|  hypothetical protein B456_008G044400                    125   1e-29   Gossypium raimondii
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   125   1e-29   Citrus sinensis [apfelsine]
ref|XP_007151149.1|  hypothetical protein PHAVU_004G022000g             125   1e-29   Phaseolus vulgaris [French bean]
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           125   1e-29   Cucumis melo [Oriental melon]
gb|ABB20912.1|  P450 mono-oxygenase                                     125   1e-29   Stevia rebaudiana
gb|KJB63760.1|  hypothetical protein B456_010G014600                    125   1e-29   Gossypium raimondii
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               125   1e-29   Cicer arietinum [garbanzo]
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   1e-29   Populus euphratica
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   2e-29   Eucalyptus grandis [rose gum]
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   124   2e-29   Citrus sinensis [apfelsine]
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               124   2e-29   Malus domestica [apple tree]
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               124   2e-29   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               124   2e-29   Solanum tuberosum [potatoes]
ref|XP_006432703.1|  hypothetical protein CICLE_v10003959mg             124   2e-29   
ref|XP_010106083.1|  Cytochrome P450 82A3                               124   2e-29   Morus notabilis
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             124   2e-29   Phaseolus vulgaris [French bean]
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             124   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    126   3e-29   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    124   3e-29   
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     124   3e-29   Eucalyptus grandis [rose gum]
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     125   3e-29   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             124   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    123   4e-29   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           123   4e-29   Vitis vinifera
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             123   4e-29   Prunus persica
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               123   5e-29   Solanum tuberosum [potatoes]
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               123   5e-29   Pyrus x bretschneideri [bai li]
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           122   7e-29   Solanum lycopersicum
ref|XP_002510312.1|  cytochrome P450, putative                          122   7e-29   Ricinus communis
ref|XP_002510313.1|  cytochrome P450, putative                          122   7e-29   Ricinus communis
emb|CAN74205.1|  hypothetical protein VITISV_031127                     122   7e-29   Vitis vinifera
ref|XP_010064547.1|  PREDICTED: cytochrome P450 CYP82D47-like           122   8e-29   Eucalyptus grandis [rose gum]
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           122   8e-29   Vitis vinifera
gb|KHN16363.1|  Cytochrome P450 82A4                                    122   8e-29   Glycine soja [wild soybean]
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               122   9e-29   Pyrus x bretschneideri [bai li]
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     122   9e-29   Eucalyptus grandis [rose gum]
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             122   1e-28   
gb|KJB63758.1|  hypothetical protein B456_010G014400                    119   1e-28   Gossypium raimondii
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               124   1e-28   
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               122   1e-28   
ref|XP_010092357.1|  Cytochrome P450 82A3                               122   1e-28   Morus notabilis
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               122   1e-28   Fragaria vesca subsp. vesca
emb|CBI19610.3|  unnamed protein product                                124   2e-28   Vitis vinifera
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           122   2e-28   Populus euphratica
ref|XP_010106080.1|  Cytochrome P450 82A3                               122   2e-28   
gb|KJB63761.1|  hypothetical protein B456_010G014700                    122   2e-28   Gossypium raimondii
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               121   2e-28   Malus domestica [apple tree]
ref|XP_003611841.1|  Cytochrome P450 82A3                               119   2e-28   
gb|KDP38436.1|  hypothetical protein JCGZ_04361                         121   2e-28   Jatropha curcas
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               119   2e-28   Glycine max [soybeans]
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               121   2e-28   Vitis vinifera
gb|KDP38431.1|  hypothetical protein JCGZ_04356                         120   3e-28   Jatropha curcas
ref|XP_003618361.1|  Cytochrome P450                                    121   3e-28   Medicago truncatula
ref|XP_006443548.1|  hypothetical protein CICLE_v10019706mg             120   3e-28   
gb|KJB63757.1|  hypothetical protein B456_010G014300                    121   3e-28   Gossypium raimondii
gb|KEH30997.1|  cytochrome P450 family protein                          120   3e-28   Medicago truncatula
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             120   3e-28   Phaseolus vulgaris [French bean]
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           120   4e-28   Cucumis melo [Oriental melon]
ref|XP_002510314.1|  conserved hypothetical protein                     118   4e-28   
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               122   4e-28   
ref|XP_011042272.1|  PREDICTED: cytochrome P450 82A4-like               119   4e-28   Populus euphratica
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               117   5e-28   Glycine max [soybeans]
ref|XP_010060879.1|  PREDICTED: cytochrome P450 CYP82D47-like           120   5e-28   Eucalyptus grandis [rose gum]
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           120   5e-28   Eucalyptus grandis [rose gum]
ref|XP_008388076.1|  PREDICTED: cytochrome P450 CYP82D47-like           120   5e-28   
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             119   6e-28   
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               120   6e-28   Pyrus x bretschneideri [bai li]
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    120   6e-28   Glycine max [soybeans]
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               120   6e-28   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                120   6e-28   Vitis vinifera
sp|H2DH23.1|C7H23_PANGI  RecName: Full=Cytochrome P450 CYP82H23         117   6e-28   Panax ginseng [Asiatic ginseng]
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   119   6e-28   Citrus sinensis [apfelsine]
emb|CAN81092.1|  hypothetical protein VITISV_004720                     119   7e-28   Vitis vinifera
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    120   7e-28   
gb|KHG16624.1|  Cytochrome P450                                         118   7e-28   Gossypium arboreum [tree cotton]
gb|KJB43594.1|  hypothetical protein B456_007G208800                    120   8e-28   Gossypium raimondii
gb|KJB58366.1|  hypothetical protein B456_009G207100                    119   8e-28   Gossypium raimondii
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             119   8e-28   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               119   8e-28   Citrus sinensis [apfelsine]
ref|XP_002519132.1|  cytochrome P450, putative                          118   8e-28   
gb|KEH30995.1|  cytochrome P450 family protein                          119   8e-28   Medicago truncatula
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           119   8e-28   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               119   8e-28   
gb|KHN22283.1|  Cytochrome P450 82C4                                    119   9e-28   Glycine soja [wild soybean]
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               119   9e-28   
gb|KCW67755.1|  hypothetical protein EUGRSUZ_F01490                     119   9e-28   Eucalyptus grandis [rose gum]
gb|KDO40895.1|  hypothetical protein CISIN_1g038677mg                   114   1e-27   Citrus sinensis [apfelsine]
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                119   1e-27   Vitis vinifera
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             119   1e-27   Phaseolus vulgaris [French bean]
emb|CDP15065.1|  unnamed protein product                                119   1e-27   Coffea canephora [robusta coffee]
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               122   1e-27   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     119   1e-27   Vitis vinifera
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               119   1e-27   
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             119   1e-27   Citrus clementina [clementine]
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                119   1e-27   Vitis vinifera
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       119   1e-27   Cucumis sativus [cucumbers]
emb|CBI40977.3|  unnamed protein product                                119   1e-27   Vitis vinifera
gb|KDO37275.1|  hypothetical protein CISIN_1g012878mg                   118   1e-27   Citrus sinensis [apfelsine]
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    119   1e-27   
emb|CAN65890.1|  hypothetical protein VITISV_018868                     120   1e-27   Vitis vinifera
ref|XP_006435894.1|  hypothetical protein CICLE_v10033457mg             118   1e-27   
gb|AFK38862.1|  unknown                                                 119   1e-27   Lotus japonicus
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             119   1e-27   Phaseolus vulgaris [French bean]
gb|KJB43593.1|  hypothetical protein B456_007G208700                    119   2e-27   Gossypium raimondii
emb|CAN65652.1|  hypothetical protein VITISV_016780                     118   2e-27   Vitis vinifera
ref|XP_011025653.1|  PREDICTED: cytochrome P450 CYP82H23-like           117   2e-27   Populus euphratica
gb|KHN44000.1|  Cytochrome P450 82A4                                    118   2e-27   Glycine soja [wild soybean]
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             118   2e-27   
ref|XP_010106089.1|  Cytochrome P450 82C4                               118   2e-27   Morus notabilis
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             118   3e-27   Phaseolus vulgaris [French bean]
ref|XP_004489342.1|  PREDICTED: cytochrome P450 82A1-like               118   3e-27   Cicer arietinum [garbanzo]
emb|CAN74206.1|  hypothetical protein VITISV_031128                     115   3e-27   Vitis vinifera
emb|CBI29738.3|  unnamed protein product                                119   3e-27   Vitis vinifera
gb|KHN22284.1|  Cytochrome P450 82A3                                    117   4e-27   Glycine soja [wild soybean]
ref|XP_010106082.1|  Cytochrome P450 82A3                               117   4e-27   
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               117   5e-27   Solanum lycopersicum
ref|XP_004154825.1|  PREDICTED: cytochrome P450 82C4-like isoform 2     114   5e-27   
emb|CAN76287.1|  hypothetical protein VITISV_027433                     117   5e-27   Vitis vinifera
ref|XP_010034443.1|  PREDICTED: cytochrome P450 CYP82D47-like           117   5e-27   Eucalyptus grandis [rose gum]
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               117   5e-27   Solanum tuberosum [potatoes]
gb|KGN59912.1|  Cytochrome P450                                         116   6e-27   Cucumis sativus [cucumbers]
gb|KCW44328.1|  hypothetical protein EUGRSUZ_L02217                     117   6e-27   Eucalyptus grandis [rose gum]
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             117   6e-27   
ref|XP_003618363.1|  Cytochrome P450                                    117   6e-27   Medicago truncatula
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               117   6e-27   Glycine max [soybeans]
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    119   6e-27   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         117   7e-27   Jatropha curcas
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           117   7e-27   Cucumis melo [Oriental melon]
ref|XP_003618354.1|  Cytochrome P450                                    117   7e-27   Medicago truncatula
ref|XP_004293232.2|  PREDICTED: cytochrome P450 CYP82D47-like           117   8e-27   Fragaria vesca subsp. vesca
ref|XP_011459726.1|  PREDICTED: cytochrome P450 CYP82D47-like           117   9e-27   Fragaria vesca subsp. vesca
gb|KHG08974.1|  Cytochrome P450                                         115   1e-26   Gossypium arboreum [tree cotton]
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               116   1e-26   Citrus sinensis [apfelsine]
ref|XP_008378984.1|  PREDICTED: cytochrome P450 82A3-like               115   1e-26   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               116   1e-26   Citrus sinensis [apfelsine]
gb|KJB63767.1|  hypothetical protein B456_010G015400                    116   1e-26   Gossypium raimondii
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         115   1e-26   Jatropha curcas
gb|AGN54072.1|  cytochrome P450 monooxygenase                           116   1e-26   Artemisia annua [sweet Annie]
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           116   2e-26   Populus euphratica
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    116   2e-26   Vitis vinifera
gb|KDP46184.1|  hypothetical protein JCGZ_10024                         115   2e-26   Jatropha curcas
ref|NP_001240972.1|  cytochrome P450 82A3                               116   2e-26   Glycine max [soybeans]
ref|XP_007136642.1|  hypothetical protein PHAVU_009G061400g             115   2e-26   Phaseolus vulgaris [French bean]
gb|KFK29808.1|  hypothetical protein AALP_AA7G181800                    110   2e-26   Arabis alpina [alpine rockcress]
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             115   2e-26   Citrus clementina [clementine]
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           115   2e-26   Eucalyptus grandis [rose gum]
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         115   2e-26   Jatropha curcas
ref|XP_008235731.1|  PREDICTED: cytochrome P450 CYP82H23-like           114   2e-26   
gb|KJB78289.1|  hypothetical protein B456_012G164400                    115   2e-26   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               115   3e-26   
ref|XP_009365832.1|  PREDICTED: cytochrome P450 CYP82D47-like           115   3e-26   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               115   3e-26   
ref|XP_011083776.1|  PREDICTED: cytochrome P450 CYP82D47-like           115   3e-26   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                115   3e-26   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           115   3e-26   
ref|XP_006856215.1|  hypothetical protein AMTR_s00059p00202900          116   3e-26   
gb|KCW45363.1|  hypothetical protein EUGRSUZ_L00956                     115   4e-26   
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           115   4e-26   
ref|XP_007047112.1|  Cytochrome P450                                    116   4e-26   
gb|KCW59285.1|  hypothetical protein EUGRSUZ_H01963                     114   4e-26   
ref|XP_007223263.1|  hypothetical protein PRUPE_ppa004464mg             114   5e-26   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               114   5e-26   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                114   5e-26   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   114   5e-26   
prf||2209439B  cytochrome P450 monooxygenase                            115   6e-26
emb|CAN81014.1|  hypothetical protein VITISV_025152                     114   6e-26   
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    114   7e-26   
ref|XP_007033359.1|  Cytochrome P450                                    114   7e-26   
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              114   7e-26   
gb|ACO90217.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   110   7e-26   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               114   7e-26   
ref|XP_002869302.1|  CYP82C4                                            114   8e-26   
ref|XP_010026987.1|  PREDICTED: cytochrome P450 CYP82D47-like           113   8e-26   
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    114   8e-26   
ref|NP_001240077.1|  cytochrome P450 82A2                               111   9e-26   
ref|XP_007151140.1|  hypothetical protein PHAVU_004G021100g             114   9e-26   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     114   1e-25   
ref|XP_006856218.1|  hypothetical protein AMTR_s00059p00203770          114   1e-25   
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           114   1e-25   
ref|XP_010026988.1|  PREDICTED: cytochrome P450 82A4-like               112   1e-25   
gb|ABK55756.1|  P450 monooxygenase-like protein                         114   1e-25   
gb|KEH18125.1|  cytochrome P450 family protein                          113   1e-25   
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           114   1e-25   
ref|XP_006428106.1|  hypothetical protein CICLE_v10027086mg             112   1e-25   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               113   1e-25   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            113   1e-25   
gb|KDO38174.1|  hypothetical protein CISIN_1g0106221mg                  112   1e-25   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    113   2e-25   
gb|KHN36187.1|  Cytochrome P450 82A3                                    113   2e-25   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    113   2e-25   
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               113   2e-25   
ref|XP_007047111.1|  Cytochrome P450                                    113   2e-25   
gb|KGN59916.1|  hypothetical protein Csa_3G853140                       111   2e-25   
ref|XP_004147821.1|  PREDICTED: cytochrome P450 82A3-like               113   2e-25   
gb|KHN16362.1|  Cytochrome P450 82A3                                    113   2e-25   
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               113   2e-25   
emb|CDP15728.1|  unnamed protein product                                113   2e-25   
emb|CBI32505.3|  unnamed protein product                                115   2e-25   
gb|AAS90126.1|  cytochrome P450                                         113   2e-25   
gb|KHG24650.1|  Cytochrome P450 protein                                 112   2e-25   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             113   2e-25   
emb|CBI32510.3|  unnamed protein product                                114   2e-25   
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                112   3e-25   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                113   3e-25   
ref|XP_004154900.1|  PREDICTED: cytochrome P450 82A3-like               113   3e-25   
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           112   3e-25   
ref|XP_011099830.1|  PREDICTED: cytochrome P450 CYP82D47-like           112   3e-25   
gb|KDO36111.1|  hypothetical protein CISIN_1g046501mg                   105   3e-25   
ref|XP_003546624.1|  PREDICTED: cytochrome P450 82A2-like               111   3e-25   
emb|CAN61061.1|  hypothetical protein VITISV_018742                     112   3e-25   
ref|XP_003618351.1|  Cytochrome P450 82A1                               112   3e-25   
ref|XP_004291928.1|  PREDICTED: cytochrome P450 CYP82D47-like           111   3e-25   
emb|CBI37514.3|  unnamed protein product                                114   3e-25   
ref|XP_011465960.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    112   3e-25   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           112   3e-25   
ref|XP_011458158.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    112   4e-25   
emb|CBI36491.3|  unnamed protein product                                112   4e-25   
emb|CDP15727.1|  unnamed protein product                                113   4e-25   
ref|XP_011073058.1|  PREDICTED: cytochrome P450 CYP82D47-like           112   4e-25   
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               112   4e-25   
emb|CDP03915.1|  unnamed protein product                                111   4e-25   
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               112   4e-25   
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           112   5e-25   
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           112   5e-25   
gb|KHG07864.1|  Cytochrome P450 protein                                 112   5e-25   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               112   6e-25   
gb|EPS58631.1|  hypothetical protein M569_16182                         111   6e-25   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             112   6e-25   
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 112   6e-25   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           111   6e-25   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             111   6e-25   
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         111   7e-25   
gb|KDP45300.1|  hypothetical protein JCGZ_15165                         110   8e-25   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               111   9e-25   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     110   9e-25   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             111   1e-24   
ref|XP_008464770.1|  PREDICTED: cytochrome P450 CYP82D47-like           111   1e-24   
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         111   1e-24   
gb|KDP38425.1|  hypothetical protein JCGZ_04350                         109   1e-24   
emb|CAN77159.1|  hypothetical protein VITISV_019026                     111   1e-24   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               110   1e-24   
emb|CDP07595.1|  unnamed protein product                                112   1e-24   
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             110   1e-24   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             110   1e-24   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               110   2e-24   
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               110   2e-24   
ref|XP_010089020.1|  Cytochrome P450 82A3                               110   2e-24   
ref|XP_011459594.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    108   2e-24   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           110   2e-24   
ref|XP_002510297.1|  cytochrome P450, putative                          110   2e-24   
ref|XP_010664941.1|  PREDICTED: cytochrome P450 82A4-like               106   2e-24   
emb|CDY23316.1|  BnaA08g12300D                                          110   2e-24   
emb|CDY53704.1|  BnaC03g67210D                                          110   2e-24   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    110   2e-24   
ref|XP_003589812.1|  Cytochrome P450                                    109   2e-24   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    110   2e-24   
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           110   2e-24   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         110   2e-24   
gb|KHG29587.1|  Cytochrome P450 protein                                 110   2e-24   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   110   2e-24   
gb|KJB08751.1|  hypothetical protein B456_001G104400                    110   3e-24   
ref|XP_008372515.1|  PREDICTED: cytochrome P450 82C4-like               110   3e-24   
ref|XP_010106085.1|  Cytochrome P450 82C4                               109   3e-24   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             110   3e-24   
ref|XP_002510298.1|  cytochrome P450, putative                          110   3e-24   
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               109   3e-24   
gb|KHN42045.1|  Cytochrome P450 82C4                                    109   3e-24   
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               109   3e-24   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     109   3e-24   
ref|XP_002869304.1|  CYP82C4                                            109   4e-24   
ref|XP_003619141.1|  Cytochrome P450                                    109   4e-24   
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             109   4e-24   
ref|XP_007049681.1|  Cytochrome P450                                    109   4e-24   
gb|KCW58036.1|  hypothetical protein EUGRSUZ_H00764                     108   5e-24   
gb|KDP20666.1|  hypothetical protein JCGZ_03866                         108   5e-24   
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             109   5e-24   
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             109   5e-24   
ref|XP_006375029.1|  putative cytochrome P450 family protein            109   5e-24   
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           109   6e-24   
gb|AII31759.1|  cytochrome P450 monooxygenase                           108   6e-24   
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    109   6e-24   
ref|XP_007217488.1|  hypothetical protein PRUPE_ppa027160mg             108   6e-24   
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           108   7e-24   
ref|XP_004147801.1|  PREDICTED: cytochrome P450 82A4-like               108   7e-24   
ref|XP_006384481.1|  hypothetical protein POPTR_0004s15460g             104   7e-24   
gb|KHG29694.1|  Cytochrome P450                                         108   7e-24   
gb|AII31758.1|  cytochrome P450 monooxygenase                           108   7e-24   
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               108   7e-24   
gb|KJB58361.1|  hypothetical protein B456_009G206600                    108   8e-24   
ref|XP_006376421.1|  cytochrome P450 family protein                     108   8e-24   
ref|XP_010070484.1|  PREDICTED: cytochrome P450 CYP82D47-like           108   8e-24   
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             108   8e-24   
ref|XP_003618345.1|  Cytochrome P450                                    107   8e-24   
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             108   9e-24   
ref|XP_003619137.1|  Cytochrome P450                                    108   9e-24   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             108   1e-23   
emb|CAN82345.1|  hypothetical protein VITISV_023279                     107   1e-23   
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               108   1e-23   
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               108   1e-23   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           108   1e-23   
gb|KHG29695.1|  Cytochrome P450                                         108   1e-23   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           108   1e-23   
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           108   1e-23   
gb|KHG07801.1|  Cytochrome P450                                         108   1e-23   
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     108   1e-23   
gb|KDO65988.1|  hypothetical protein CISIN_1g011292mg                   107   1e-23   
ref|XP_008235430.1|  PREDICTED: cytochrome P450 CYP82D47-like           108   1e-23   
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               108   1e-23   
ref|XP_004154823.1|  PREDICTED: cytochrome P450 82A3-like               108   1e-23   
ref|XP_004147805.1|  PREDICTED: cytochrome P450 82A3-like               108   1e-23   
gb|KDO57196.1|  hypothetical protein CISIN_1g0386072mg                  102   2e-23   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               108   2e-23   
gb|ADA70805.1|  cytochrome P450 CYP71D176                               107   2e-23   
ref|XP_003604789.1|  Cytochrome P450                                    108   2e-23   
ref|XP_002510306.1|  cytochrome P450, putative                          107   2e-23   
emb|CDP16080.1|  unnamed protein product                                107   2e-23   
emb|CDP00859.1|  unnamed protein product                                107   2e-23   
gb|KGN59907.1|  hypothetical protein Csa_3G852560                       108   2e-23   
ref|XP_004489341.1|  PREDICTED: cytochrome P450 82A3-like               105   2e-23   
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             107   2e-23   
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               107   2e-23   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               107   2e-23   
gb|KJB10202.1|  hypothetical protein B456_001G188600                    107   2e-23   
ref|XP_010026403.1|  PREDICTED: cytochrome P450 82C4-like               106   2e-23   
gb|KHN04536.1|  Cytochrome P450 82A1                                    107   2e-23   
gb|KHN36186.1|  Cytochrome P450 82A3                                    107   3e-23   
ref|XP_007216265.1|  hypothetical protein PRUPE_ppa017300mg             107   3e-23   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             107   3e-23   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    107   3e-23   
ref|XP_007134137.1|  hypothetical protein PHAVU_010G022400g             107   3e-23   
gb|KHN42046.1|  Cytochrome P450 82C4                                    105   3e-23   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           107   3e-23   
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         107   3e-23   
gb|KHG01290.1|  Cytochrome P450                                         107   3e-23   
gb|KJB58364.1|  hypothetical protein B456_009G206900                    107   3e-23   
gb|ABK28662.1|  unknown                                                 107   3e-23   
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    107   3e-23   
gb|KEH25406.1|  cytochrome P450 family protein                          107   3e-23   
gb|EYU23763.1|  hypothetical protein MIMGU_mgv1a023100mg                107   3e-23   
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               107   3e-23   
gb|EYU45077.1|  hypothetical protein MIMGU_mgv1a023617mg                107   4e-23   
emb|CBI29743.3|  unnamed protein product                                107   4e-23   
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               106   4e-23   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    106   5e-23   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    106   5e-23   
ref|XP_006379221.1|  hypothetical protein POPTR_0009s11200g             102   5e-23   
gb|KHM99473.1|  Cytochrome P450 71D11                                   105   5e-23   
ref|XP_006826997.1|  hypothetical protein AMTR_s00010p00212030          105   5e-23   
ref|XP_007146615.1|  hypothetical protein PHAVU_006G0551000g            101   5e-23   
gb|KJB08798.1|  hypothetical protein B456_001G104500                    106   5e-23   
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             106   5e-23   
gb|KJB60932.1|  hypothetical protein B456_009G331600                    106   5e-23   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           106   6e-23   
sp|F2Z9C1.1|P6H_ESCCA  RecName: Full=Protopine 6-monooxygenase; A...    106   6e-23   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           106   6e-23   
ref|XP_007200972.1|  hypothetical protein PRUPE_ppa004569mg             105   6e-23   
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             106   6e-23   
gb|EYU25485.1|  hypothetical protein MIMGU_mgv1a022219mg                101   7e-23   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             106   7e-23   
ref|XP_002522370.1|  cytochrome P450, putative                          106   7e-23   
ref|XP_004510285.1|  PREDICTED: uncharacterized protein LOC101505071    107   7e-23   
ref|XP_002510309.1|  conserved hypothetical protein                   99.8    7e-23   
ref|XP_006435897.1|  hypothetical protein CICLE_v10031875mg             104   7e-23   
gb|KEH18124.1|  cytochrome P450 family 82 protein                       105   8e-23   
ref|XP_006435896.1|  hypothetical protein CICLE_v10031875mg             104   8e-23   
ref|XP_010026402.1|  PREDICTED: cytochrome P450 82C4-like               104   8e-23   
ref|XP_003530791.1|  PREDICTED: cytochrome P450 71D9-like               105   9e-23   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               105   9e-23   



>ref|XP_006364811.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G + PH I   MA+KYGPIFR++LG  Q  +VS+ KIAKECFTTND++ A R K+LASE
Sbjct  51   NGSQMPHKIFGQMAEKYGPIFRLKLGVNQVVIVSDHKIAKECFTTNDRAFANRPKSLASE  110

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            I+GYNY +F + PYGPYWR+IRK V +E LS RRI  L+  RE+
Sbjct  111  ILGYNYAMFGLGPYGPYWREIRKIVTIEFLSARRIKMLKHVREF  154



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H++L  +AD YGPIF IRLG + T VVSN +IAKECFTTNDK+ A R + LA+E+
Sbjct  59   GSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAKECFTTNDKAFANRPRTLAAEL  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +F  +PYGPYWRQIRK V LE+LS  R++ L+  RE
Sbjct  119  LGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKHIRE  160



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G + PH I   MA+KYGPIFR++LG     +VS+ KIAKECFTTNDK+ A R K++ASE
Sbjct  51   NGPQMPHKIFGQMAEKYGPIFRLKLGVNDVVIVSDHKIAKECFTTNDKAFANRPKSIASE  110

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            I+GYNY +F + PYGPYWR+IRK V  E LS RRI+ L+  RE+
Sbjct  111  ILGYNYAMFGLGPYGPYWREIRKIVTTEFLSARRIEMLKHVREF  154



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H++L  +AD YGPIF IRLG + T VVSN +IAKECFTTNDK+ A R + LA+E+
Sbjct  329  GSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAKECFTTNDKAFANRPRTLAAEL  388

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +F  +PYGPYWRQIRK V LE+LS  R++ L+  RE
Sbjct  389  LGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKHIRE  430


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP  ++L  +AD YGPIF IRLG Q T VVSN ++AKECFTTN K+   R + LA+E+
Sbjct  23   GSKPAQVVLGDLADTYGPIFTIRLGMQSTLVVSNWEMAKECFTTNHKAFVNRPRTLAAEL  82

Query  189  MGYNYTIFAVA  221
            +GYNY +  + 
Sbjct  83   LGYNYAMMVIG  93


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH++L  MA+KYG IF I++G  +  VV+N + AKEC TTNDK+ A+R K LA E 
Sbjct  203  GPQPPHIVLGDMAEKYGSIFTIKMGVYRALVVNNWETAKECLTTNDKAFASRPKTLAMEF  262

Query  189  MGYNYTI  209
            + + +T+
Sbjct  263  LSFEHTM  269



>ref|XP_007207908.1| hypothetical protein PRUPE_ppa019731mg, partial [Prunus persica]
 gb|EMJ09107.1| hypothetical protein PRUPE_ppa019731mg, partial [Prunus persica]
Length=502

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  MADKYGPIF I+LG  +  VVSN +IAKE FTTNDK+ ATR K LA+EI
Sbjct  23   GPRPPHISLGNMADKYGPIFTIKLGVHRALVVSNWEIAKEFFTTNDKNFATRPKFLAAEI  82

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            MGY+Y +F  +PYGPYWRQ+RK   +ELLS  R++ L+  REY
Sbjct  83   MGYDYAMFGFSPYGPYWRQMRKIATVELLSNHRLELLKRVREY  125



>gb|KDO42969.1| hypothetical protein CISIN_1g048689mg, partial [Citrus sinensis]
Length=239

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  MADKYGPIF ++LG +Q  VVSN +IAKECFTTNDK+ A R K +A+E+
Sbjct  64   GSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATEL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+ +   APYG YWRQ RK   +ELLS RR++ L+  RE
Sbjct  124  LGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRE  165



>ref|XP_002510311.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52498.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G +PPH+ L  +ADKYGPIF I+LG  +T +VSN +IAKEC TTNDK+ A+R K+LA E
Sbjct  52   SGSQPPHITLGNLADKYGPIFTIKLGVHRTLIVSNGEIAKECLTTNDKAFASRPKSLAME  111

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            I+GY+Y++   +PYG YWRQ+RK + LELLS  R++ L+  RE
Sbjct  112  ILGYDYSMLGFSPYGEYWRQMRKIITLELLSKHRLEMLKRVRE  154



>gb|KDO44281.1| hypothetical protein CISIN_1g037130mg, partial [Citrus sinensis]
Length=252

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  MADKYGPIF ++LG +Q  VVSN +IAKECFTTNDK+ A+R K +A E+
Sbjct  62   GPEPAHRVLGDMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFASRPKTMAMEL  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+++ + APYG YWRQ RK  ++ELLS  R++ L+  RE
Sbjct  122  LGYNFSVISFAPYGNYWRQSRKIAIIELLSSHRLEKLKHVRE  163



>ref|XP_002510308.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52495.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G +PPH+ L  +ADKYGPIF I+LG  +T +VSN +IAKEC TTNDK+ A R K+LA E
Sbjct  52   SGSQPPHITLGNLADKYGPIFAIKLGVHRTLIVSNGEIAKECLTTNDKAFANRPKSLAME  111

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            I+GY+Y++   +PYG YWRQ+RK + LELLS  R++ L+  RE
Sbjct  112  ILGYDYSMLGFSPYGEYWRQMRKIITLELLSKHRLEMLKHVRE  154



>ref|XP_009606708.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=523

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +3

Query  3    STGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  182
            S   + PH +LA MA+KYGPIF ++LG  +  VVS+ KIAKECFTTND +LA R K+LAS
Sbjct  56   SESDQLPHKVLARMAEKYGPIFGLKLGVYKAVVVSDPKIAKECFTTNDLALANRPKSLAS  115

Query  183  EIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            EI+GYN+ +F VAPYGPYWR+IRK   +E LS RRI+ L+  RE+
Sbjct  116  EIIGYNHAMFGVAPYGPYWREIRKIATIEFLSTRRIEVLKHIREF  160



>ref|XP_006375023.1| hypothetical protein POPTR_0014s03670g, partial [Populus trichocarpa]
 gb|ERP52820.1| hypothetical protein POPTR_0014s03670g, partial [Populus trichocarpa]
Length=216

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYGPIF ++LG  +T +VSN ++AKEC  TNDK+ ATR K LA +I
Sbjct  50   GSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDI  109

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY+I + +PYG YWR IRK V LE+LS  R++ L+  RE
Sbjct  110  LGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMLKNVRE  151



>ref|XP_009804510.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=525

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH +LA MA+KYGPIF ++LG  +  VVS+ K+AKECFTTND +LA R K+LASEI+GYN
Sbjct  63   PHKVLARMAEKYGPIFGLKLGVYKVVVVSDPKVAKECFTTNDLALANRPKSLASEIIGYN  122

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            + +F VAPYGPYWR+IRK   +E LS RRI+ L+  RE+
Sbjct  123  HAMFGVAPYGPYWREIRKIATIEFLSSRRIEMLKHIREF  161



>gb|KDO43361.1| hypothetical protein CISIN_1g0369161mg, partial [Citrus sinensis]
Length=328

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +3

Query  9    GGKPP--HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  182
            GG+ P  H+ L ++ADK+GPIF I+LG  +  +VSN +IAKECFTTNDK    R KALA 
Sbjct  59   GGQKPAAHVTLGSIADKHGPIFMIKLGMHRALIVSNWEIAKECFTTNDKVFCNRIKALAP  118

Query  183  EIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            EI+GYNY +F  +PYGPYWRQIRK   LE+LS  R++ L+  RE
Sbjct  119  EILGYNYAMFGFSPYGPYWRQIRKIATLEILSNHRLEMLKHVRE  162



>gb|KCW68803.1| hypothetical protein EUGRSUZ_F02402, partial [Eucalyptus grandis]
Length=525

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L  MADKYGPIF I+LG+ Q  VVS S++AKECFTTNDK+   R K LA+E+
Sbjct  61   GPDPPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKECFTTNDKAFCNRPKYLAAEL  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +   +PYGPYWR +RK   LELLS   ++ LR  RE
Sbjct  121  LGYNYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVRE  162



>ref|XP_010064743.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L  MADKYGPIF I+LG+ Q  VVS S++AKECFTTNDK+   R K LA+E+
Sbjct  61   GPDPPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKECFTTNDKAFCNRPKYLAAEL  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +   +PYGPYWR +RK   LELLS   ++ LR  RE
Sbjct  121  LGYNYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVRE  162



>ref|XP_009365841.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=537

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+IL  MADKYGPIF I LG  +  +VS+ ++AK+CFTTNDK  ATR K LA ++
Sbjct  55   GPQPPHVILGNMADKYGPIFTINLGQHKALIVSSWEMAKQCFTTNDKVFATRPKHLAGKL  114

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYT*ENPSNACS  347
            +GYNY++F  +PYGPYWR +RK   +ELLS  R++ LR  R    E+  NAC+
Sbjct  115  LGYNYSMFGFSPYGPYWRHVRKIATVELLSNHRLELLRHVR----ESEVNACT  163



>ref|XP_004291926.1| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=538

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L  MADKYGP+F I+LG  ++ +VS+  +AKEC TTND+  A R K L SE+
Sbjct  61   GSLPPHITLGNMADKYGPVFTIKLGVHRSLIVSSWDMAKECLTTNDRVFANRPKLLVSEV  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYNY +F  +PYGPYWRQ+RK   LELLS  R++SL   RE
Sbjct  121  MGYNYAMFGFSPYGPYWRQMRKVATLELLSNHRLESLNHVRE  162



>gb|KDO57198.1| hypothetical protein CISIN_1g044206mg, partial [Citrus sinensis]
Length=245

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  MAD+YGPIF+I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI
Sbjct  63   GPEPSHWVLGKMADEYGPIFKIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+IRK   LELLS  R+  LR  REY
Sbjct  123  LGYNFSMFGFSPYGSYWREIRKIATLELLSNHRLGKLRHVREY  165



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H++L  +AD  GPIF IRLG   T VVSN +IAKECFTTNDK+ A R + +A+E+
Sbjct  59   GSKPAHVVLGDLADTNGPIFTIRLGMHPTLVVSNWEIAKECFTTNDKAFANRPRTIAAEL  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +F  +PYGPYWRQIRK   LE+LS  R++ L+  RE
Sbjct  119  LGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEKLKHIRE  160



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ILA+MADKYGPIF I+ G  +  +VSN +IAK+C T ND++ A+R K+++SE+
Sbjct  35   GPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEV  94

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F +APYGPYWR +RK  +LELLS  R++ L+  R 
Sbjct  95   MAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRH  136



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ILA+MADKYGPIF I+ G  +  +VSN +IAK+C T ND++ A+R K+++SE+
Sbjct  65   GPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEV  124

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F +APYGPYWR +RK  +LELLS  R++ L+  R 
Sbjct  125  MAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRH  166



>ref|XP_008236910.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=540

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  MADKYGPIF I+LG  +  VVSN + AKE FTTNDK+ ATR K LA+EI
Sbjct  61   GPRPPHISLGNMADKYGPIFTIKLGVHRALVVSNWETAKEFFTTNDKNFATRPKFLAAEI  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            MGY+Y +F  +PYGPYWRQ+RK   +ELLS  R++ L+   EY
Sbjct  121  MGYDYAMFGFSPYGPYWRQMRKIATVELLSNHRLELLKRVLEY  163



>ref|XP_009795251.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G + PH I   MA+KYGPIFRI+LG  Q  VVS++KIAKECFTTND + A R K++ASE
Sbjct  51   NGSQMPHKIFGHMAEKYGPIFRIKLGVNQVVVVSDAKIAKECFTTNDMAFANRPKSIASE  110

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRID  293
            I+GYNY +F + PYGPYWR+IRK   +E LS R+++
Sbjct  111  IIGYNYAMFGLGPYGPYWREIRKIATIEFLSTRQVE  146



>ref|XP_006471190.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=240

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP ++ L  +A+K GPIF I+LG  +  +VSN +IAKECFTTNDK  + R KALA EI
Sbjct  81   GQKPAYVTLGNIAEKCGPIFMIKLGMHRALIVSNWEIAKECFTTNDKVFSNRIKALAPEI  140

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +F  +PYGPYWRQIRK   LE+LS  R++ L+  RE
Sbjct  141  LGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEMLKHVRE  182



>ref|XP_006471191.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=538

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +3

Query  9    GGKPP--HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  182
            GG+ P  H+ L ++ADK+GPIF I+LG  +  +VSN +IAKECFTTNDK    R KALA 
Sbjct  59   GGQKPAAHVTLGSIADKHGPIFMIKLGLHRALIVSNWEIAKECFTTNDKVFCNRIKALAP  118

Query  183  EIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            EI+GYNY +F  +PYGPYWRQIRK   LE+LS  R++ L+  RE
Sbjct  119  EILGYNYAMFGFSPYGPYWRQIRKIATLEILSNHRLEMLKHVRE  162



>gb|KCW85809.1| hypothetical protein EUGRSUZ_B02554, partial [Eucalyptus grandis]
Length=487

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ILA+MADKYGPIF I+ G  +  +VS  +IAK+C T ND++ A+R K+++SE+
Sbjct  20   GPVPPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLTVNDRAFASRPKSVSSEV  79

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F +APYGPYWRQ+RK  +LELLS  R++ L+  R 
Sbjct  80   MAYNYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRH  121



>ref|XP_010046449.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ILA+MADKYGPIF I+ G  +  +VS  +IAK+C T ND++ A+R K+++SE+
Sbjct  65   GPVPPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLTVNDRAFASRPKSVSSEV  124

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F +APYGPYWRQ+RK  +LELLS  R++ L+  R 
Sbjct  125  MAYNYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRH  166



>ref|XP_009624056.1| PREDICTED: cytochrome P450 82A3-like, partial [Nicotiana tomentosiformis]
Length=510

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G + PH I   MA+K+GPIFRI+LG  Q  VVS++KIAKECFTTND + A R K++ASE
Sbjct  51   NGTQMPHKIFGHMAEKHGPIFRIKLGVNQVVVVSDAKIAKECFTTNDMAFANRPKSIASE  110

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            I+GYNY +F + PYGPYWR+IRK   +E LS R+++     RE+
Sbjct  111  IIGYNYAMFGLGPYGPYWREIRKIATIEFLSTRQVEMSSHIREF  154



>ref|XP_006486513.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=395

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  +ADKYG IF ++LG +Q  VVSN +IAKECFTTNDK+ A+R K +A E+
Sbjct  64   GPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIAKECFTTNDKAFASRPKRMAVEL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYN+++   APYG YWRQ RK V +ELLS RR++ L+  RE
Sbjct  124  MGYNFSVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRE  165



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  MADKYGPIF ++LG +Q  VVSN +IAKECFTTNDK+ A R K +A+E+
Sbjct  64   GSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATEL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+ +   APYG YWRQ RK   +ELLS RR++ L+  RE
Sbjct  124  LGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRE  165



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  MADKYGPIF ++LG +Q  VVSN +IAKECFTTNDK+ A R K +A+E+
Sbjct  64   GSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATEL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+ +   APYG YWRQ RK   +ELLS RR++ L+  RE
Sbjct  124  LGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRE  165



>ref|XP_007017411.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14636.1| Cytochrome P450, putative [Theobroma cacao]
Length=525

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPHL LA MADK+G IF I+LG  +  VVSN +IAKEC TTNDK+ ATR K    EI
Sbjct  59   GPRPPHLSLANMADKFGTIFTIKLGVHRALVVSNWEIAKECLTTNDKAFATRPKLAGMEI  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY + A APYGPYWRQ+R+   ++LLS  R+D L+  RE
Sbjct  119  LGYNYAMIAFAPYGPYWRQVRRFATVKLLSNHRLDMLKRVRE  160



>ref|XP_010061806.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=541

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ILA+MADKYGPIF I+ G  +  +VSN +IAK+C T ND++ A+R K+++SE+
Sbjct  74   GPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEV  133

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F +APYGPYWR +RK  +L+LLS  R++ L+  R+
Sbjct  134  MAYNYAMFGLAPYGPYWRYVRKVTMLDLLSSHRLELLKHVRD  175



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P HL L+AMADKYGPIF I+LG ++  VVS+ + AKEC TTNDK+ ATR K ++ E+
Sbjct  163  GRQPAHLTLSAMADKYGPIFTIKLGVRRALVVSSWETAKECLTTNDKAFATRPKNISMEV  222

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+ +F  APYGPYWR +RK   LELLS  R+D L+  RE
Sbjct  223  LGYNHAMFGFAPYGPYWRNMRKITTLELLSNHRLDMLKHVRE  264


 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +3

Query  30   ILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTI  209
            +L   A  YGPIF I+LG  Q  +VSN ++AKEC +TNDK  ATR K++A EI+GYNY +
Sbjct  22   LLFKRAGNYGPIFTIKLGLSQAVIVSNRELAKECLSTNDKVFATRPKSIAFEILGYNYAV  81

Query  210  FAVAPYGPYWRQIRK-TVVLELL  275
            F  +PYG YW  IRK   VL++L
Sbjct  82   FGFSPYGSYWHHIRKLATVLQVL  104



>ref|XP_006387541.1| hypothetical protein POPTR_0875s00200g [Populus trichocarpa]
 gb|ERP46455.1| hypothetical protein POPTR_0875s00200g [Populus trichocarpa]
Length=377

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYGPIF ++LG  +T +VSN ++AKEC  TNDK+ ATR K LA +I
Sbjct  99   GSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDI  158

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY+I + +PYG YWR IRK V LE+LS  R++  +  RE
Sbjct  159  LGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMFKHVRE  200



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH+ L AMADKYGP F IRLG ++  VVS+ ++AKECFT ND++LATR   +A + 
Sbjct  58   GPELPHITLGAMADKYGPAFTIRLGVRRALVVSDWEVAKECFTINDRALATRPSGVAMKH  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            MGYNY +FA APYGPYWR++RK   LELLS RR++ L+  R
Sbjct  118  MGYNYAMFAFAPYGPYWREVRKIATLELLSNRRLEMLKHVR  158



>ref|XP_004308852.2| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=544

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ILA MADKYGP+F I+LG  +  +VS+  +AKEC T NDK+ A R KAL +EI
Sbjct  63   GPQPPHIILANMADKYGPLFTIKLGVHRALIVSSWDVAKECLTINDKAFANRPKALCAEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GY+Y +F  +PYGPYWRQ+RK   L +LS  +++ L+  RE
Sbjct  123  LGYDYALFGFSPYGPYWRQVRKIATLHILSNHKLELLKHVRE  164



>gb|KCW68808.1| hypothetical protein EUGRSUZ_F02407 [Eucalyptus grandis]
Length=562

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ILA+MADKYGPIF I+ G  +  +VSN +IAK+C T ND++ A+R K+++SE+
Sbjct  95   GPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEV  154

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F +APYGPYWR +RK  +L+LLS  R++ L+  R+
Sbjct  155  MAYNYAMFGLAPYGPYWRYVRKVTMLDLLSSHRLELLKHVRD  196



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L  MADKYGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI
Sbjct  63   GPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   LELLS  R++ L+  REY
Sbjct  123  LGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVREY  165



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L  MADKYGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI
Sbjct  63   GPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   LELLS  R++ L+  REY
Sbjct  123  LGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVREY  165



>gb|KCW67753.1| hypothetical protein EUGRSUZ_F01486 [Eucalyptus grandis]
Length=514

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH  LA+MAD+YGPIF IRLG     VVS+S+IAKECFT +D +LA+R + LASE+MGYN
Sbjct  47   PHKTLASMADEYGPIFTIRLGLSPAVVVSSSEIAKECFTKHDLALASRPQLLASEVMGYN  106

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            +  FA APYGPYWR++RK   +ELLS RRI+SL
Sbjct  107  HAFFAFAPYGPYWREVRKIATMELLSIRRIESL  139



>ref|XP_010060877.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=535

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH  LA+MAD+YGPIF IRLG     VVS+S+IAKECFT +D +LA+R + LASE+MGYN
Sbjct  68   PHKTLASMADEYGPIFTIRLGLSPAVVVSSSEIAKECFTKHDLALASRPQLLASEVMGYN  127

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            +  FA APYGPYWR++RK   +ELLS RRI+SL
Sbjct  128  HAFFAFAPYGPYWREVRKIATMELLSIRRIESL  160



>gb|KJB63762.1| hypothetical protein B456_010G014800 [Gossypium raimondii]
Length=525

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYG IF IRLG  +  VVSN +IAKEC T NDK+ A+R K  +SEI
Sbjct  58   GPQPPHISLGNLADKYGGIFAIRLGVNRALVVSNWEIAKECLTINDKAFASRPKLASSEI  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN  + A+APYGPYWRQ+RK   +ELLS  R++ L+P RE
Sbjct  118  LGYNCAMIALAPYGPYWRQVRKFATIELLSNHRLELLKPVRE  159



>ref|XP_006471496.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L  MAD+YGPIF+I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI
Sbjct  63   GPEPPHRVLGKMADEYGPIFKIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   LELLS  R+  LR  REY
Sbjct  123  LGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLRHVREY  165



>ref|XP_003528211.2| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=541

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KPPH+ L  MADKYGP+F +RLGA +T VVSN ++AK+CFT NDK+ A+R K+++ E+
Sbjct  79   GSKPPHVTLGHMADKYGPVFTLRLGAHKTLVVSNWEMAKQCFTVNDKAFASRPKSVSFEL  138

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +GYNY++    PYG YWR +RK + LELLS   ID L+
Sbjct  139  LGYNYSMIGFIPYGSYWRHVRKIITLELLSTHCIDMLK  176



>ref|XP_006471495.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L  MAD+YGPIF+I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI
Sbjct  63   GPEPPHRVLGKMADEYGPIFKIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   LELLS  R+  LR  REY
Sbjct  123  LGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLRHVREY  165



>gb|AFO67235.1| putative cytochrome P450, partial [Aralia elata]
Length=158

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H+ L ++ADKYGPIF IRLG  Q  VVS+SK+AKEC TTNDK  ATR K +  E+
Sbjct  60   GPKPLHITLGSIADKYGPIFSIRLGVNQALVVSDSKMAKECLTTNDKVFATRPKTIMGEV  119

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRID  293
            MGYNY I  +  YG YWRQ+RK + LELLS R + 
Sbjct  120  MGYNYAIIGLTAYGHYWRQVRKIMGLELLSSRSLQ  154



>ref|XP_006431672.1| hypothetical protein CICLE_v10001614mg [Citrus clementina]
 gb|ESR44912.1| hypothetical protein CICLE_v10001614mg [Citrus clementina]
Length=361

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP ++ L  +A+K GPIF I+LG  +  +VSN +IAKECFTTNDK  + R KALA EI
Sbjct  81   GQKPAYVTLGNIAEKCGPIFMIKLGMHRALIVSNWEIAKECFTTNDKVFSNRIKALAPEI  140

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +F  +PYGPYWRQIRK   LE+LS  R++ L+  RE
Sbjct  141  LGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEMLKHVRE  182



>ref|XP_006432715.1| hypothetical protein CICLE_v10003834mg [Citrus clementina]
 gb|ESR45955.1| hypothetical protein CICLE_v10003834mg [Citrus clementina]
Length=219

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L  MADKYGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA+EI
Sbjct  6    GPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAAEI  65

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PY  YWR+  K   LELLS  R++ L+  REY
Sbjct  66   LGYNFSMFGFSPYDFYWRETHKIATLELLSNYRLEKLKHVREY  108



>ref|XP_007017412.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14637.1| Cytochrome P450, putative [Theobroma cacao]
Length=497

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PP++ LA MADK+G  F I+LG  +  VVSNS+IAK+C TTNDK+ ATR K  A EI
Sbjct  62   GPRPPYITLANMADKFGTFFAIKLGVHRALVVSNSEIAKQCLTTNDKAFATRPKLTAMEI  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +GYN +I A APYGPYWRQ+RK V +ELLS  R+D L+
Sbjct  122  LGYNNSIIAFAPYGPYWRQVRKFVNIELLSNHRLDMLK  159



>gb|KCW68806.1| hypothetical protein EUGRSUZ_F02405 [Eucalyptus grandis]
Length=524

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  P ++ L  MADKYGPIF I+LG+Q+  VVS S++AKECFTTNDK+   R K LA+++
Sbjct  59   GPDPAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKECFTTNDKAFCNRPKYLAAKL  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +F  +PYGPYWR +RK   LELLS   +++LR  RE
Sbjct  119  LGYNYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVRE  160



>ref|XP_010064744.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=529

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  P ++ L  MADKYGPIF I+LG+Q+  VVS S++AKECFTTNDK+   R K LA+++
Sbjct  64   GPDPAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKECFTTNDKAFCNRPKYLAAKL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +F  +PYGPYWR +RK   LELLS   +++LR  RE
Sbjct  124  LGYNYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVRE  165



>ref|XP_006435899.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
 gb|ESR49139.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
Length=528

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  +ADKYG IF ++LG +Q  VVSN +IAKECFTTNDK+ A+R K +A E+
Sbjct  64   GPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIAKECFTTNDKAFASRPKRMAVEL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYN+++   APYG YWRQ RK V +ELLS RR++ L+  RE
Sbjct  124  MGYNFSVIGFAPYGKYWRQSRKIVTIELLSNRRLEKLKHVRE  165



>ref|XP_007224171.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
 gb|EMJ25370.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
Length=517

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KPPHL+L  MA++YGPIF + +G Q+  +VS+S+IAKECFTTNDK  A+R K +A+EI
Sbjct  38   GSKPPHLVLGKMAERYGPIFTVNIGVQKALIVSSSEIAKECFTTNDKVFASRPKFMAAEI  97

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F  +PY  Y RQ+RK V+LE+LS  R++ L+  RE
Sbjct  98   MAYNYALFPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVRE  139



>ref|XP_004306669.1| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=539

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFT-TNDKSLATRTKALASE  185
            G +PPH+ILA MA+KYGP+F I+LG  +  VVS+  +AKEC T TNDK+ A R KALA+E
Sbjct  60   GPQPPHVILANMANKYGPLFTIKLGVHRALVVSSWDVAKECLTSTNDKAFANRPKALAAE  119

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            IMGY+Y +F  +PYG YWRQ+RK  +L +LSG +++ L+  RE
Sbjct  120  IMGYDYAMFGFSPYGAYWRQVRKIAMLHILSGHKLEMLKHVRE  162



>ref|XP_003527704.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=535

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            KPPH+ L  MADKYGPIF +RLG  +T VVSN ++AK+CFT NDK+ A+R K++A E++G
Sbjct  65   KPPHVTLGNMADKYGPIFTLRLGVHKTLVVSNWEMAKQCFTVNDKAFASRPKSVAFEVLG  124

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            YN+++   +PYG YWR +RK   LELLS  RID ++   E
Sbjct  125  YNFSMIGFSPYGSYWRHVRKIATLELLSSHRIDMIKHVME  164



>gb|KJB63759.1| hypothetical protein B456_010G014500, partial [Gossypium raimondii]
Length=524

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYG IF IRLG  +  VVSN +IAKEC T NDK+ ATR K  + EI
Sbjct  51   GPQPPHISLGNLADKYGGIFTIRLGVHRALVVSNWEIAKECLTINDKAFATRPKLASWEI  110

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN  + A APYGPYWRQ+RK   +ELLS  R++ L+P RE
Sbjct  111  LGYNSAMIAFAPYGPYWRQVRKFATIELLSNHRLELLKPVRE  152



>gb|KJB63751.1| hypothetical protein B456_010G014900 [Gossypium raimondii]
Length=408

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG IF I+LG  +  VVSN +IAKEC T NDK+ A+R K   SEI
Sbjct  58   GSQPPHISLANMADKYGRIFSIKLGVHRALVVSNWEIAKECLTINDKAFASRPKLAFSEI  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYN  +   APYGPYWR +RK V +ELLS  R++ L+P R+
Sbjct  118  MGYNGAMTGFAPYGPYWRPVRKIVTIELLSNHRLELLKPVRD  159



>ref|XP_009364178.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IR+G   + V+S+S+IAKECFTTND SL +R K  A E 
Sbjct  55   GSTPPHITLGAMADKYGPIFTIRIGVYPSLVISSSEIAKECFTTNDLSLNSRPKMAAVEH  114

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GYNY +F   P GPYWR+IRK V LELLS R+++ L+  R
Sbjct  115  IGYNYAMFGFGPSGPYWREIRKIVTLELLSIRKVELLKHIR  155



>gb|AGO03797.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=518

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P   +L   ADKYGPIF I+LG  Q  VVS+++IAKECFTTNDK  A+R KA A EI
Sbjct  51   GSRPRQHVLGDWADKYGPIFTIKLGFHQALVVSSTEIAKECFTTNDKVFASRPKAKAVEI  110

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYNY +F +APYG YWRQ RK + LE+LS RR++ L   RE
Sbjct  111  MGYNYAMFGLAPYGDYWRQERKIITLEVLSPRRVEMLGHVRE  152



>ref|XP_006375027.1| putative cytochrome P450 family protein, partial [Populus trichocarpa]
 gb|ERP52824.1| putative cytochrome P450 family protein, partial [Populus trichocarpa]
Length=183

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYGPIF ++L   +T +VSN ++AKEC  TNDK+ ATR K LA +I
Sbjct  57   GSQPPHITLGNLADKYGPIFTVKLEVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDI  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY++   +PYG YWR IRK V LE+LS  R++     RE
Sbjct  117  LGYNYSMLGFSPYGTYWRLIRKIVTLEVLSNHRLEMFTHVRE  158



>ref|XP_010061805.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW68805.1| hypothetical protein EUGRSUZ_F02404 [Eucalyptus grandis]
Length=533

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH++LA MADKYGPIF +++G  +  +VSN +IAK+C T ND+  ATR K+++SEI
Sbjct  66   GPVPPHIVLANMADKYGPIFIVKMGIHRALIVSNWQIAKQCLTVNDRVFATRPKSISSEI  125

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F +APYG YWR  RK  +LELLS  R++ L+  RE
Sbjct  126  MAYNYAMFGLAPYGSYWRHARKLTMLELLSNHRLELLKHIRE  167



>ref|XP_006486182.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=358

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  +ADKYG IF ++ G +Q  VVSN +IAKECFTTNDK+ A R K +A E+
Sbjct  64   GPEPAHRVLGNLADKYGTIFTMKWGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMAVEL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYN+ +   APYG YWRQ RK V +ELLS RR++ L+  RE
Sbjct  124  MGYNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRE  165



>ref|XP_004238199.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=539

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH I+  MADKYGPIF ++LG  Q  VVS+ K+AKECFTTND +LA R K++ASEI+GY 
Sbjct  81   PHKIMGRMADKYGPIFGMKLGVHQVVVVSDPKLAKECFTTNDLALAGRPKSMASEIVGYK  140

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            + +FA++ YGPYWR+ RK   +EL S RRI+ L+  RE+
Sbjct  141  HAMFALSAYGPYWRETRKIATIELFSARRIEMLKHIREF  179



>ref|XP_006435895.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
 gb|ESR49135.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
Length=528

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  +ADKYG IF ++LG +Q  VVSN +IAKECFTTNDK+ A R K +A E+
Sbjct  64   GPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMAVEL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYN+ +   APYG YWRQ RK V +ELLS RR++ L+  RE
Sbjct  124  MGYNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRE  165



>ref|XP_006471473.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=525

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L  +AD+YGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI
Sbjct  63   GPEPPHWVLGKLADEYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   LELLS  R+  LR  REY
Sbjct  123  LGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLRHVREY  165



>ref|XP_006432669.1| hypothetical protein CICLE_v10000844mg [Citrus clementina]
 gb|ESR45909.1| hypothetical protein CICLE_v10000844mg [Citrus clementina]
Length=525

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L  +AD+YGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI
Sbjct  63   GPEPPHWVLGKLADEYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   LELLS  R+  LR  REY
Sbjct  123  LGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLRHVREY  165



>ref|XP_010060881.1| PREDICTED: cytochrome P450 82A3-like [Eucalyptus grandis]
Length=273

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            K PH  LA+MAD++GPIF IRLG  +  VVS S+IAKECFT ND +L+TR + LA +I+ 
Sbjct  58   KLPHKTLASMADQFGPIFTIRLGMFRALVVSGSEIAKECFTKNDIALSTRPQQLAPKILA  117

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            Y Y +F   PYGPYWR++RK V LELLS RR++SL
Sbjct  118  YGYAMFGYVPYGPYWREVRKMVTLELLSNRRVNSL  152



>ref|XP_006435901.1| hypothetical protein CICLE_v10031635mg [Citrus clementina]
 gb|ESR49141.1| hypothetical protein CICLE_v10031635mg [Citrus clementina]
Length=423

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  +ADKYG IF ++LG +   VVSN +IAKECFTTNDK+ A R K +A E+
Sbjct  64   GPEPAHRVLGNLADKYGTIFTMKLGVKHALVVSNWEIAKECFTTNDKAFAGRPKTMAVEL  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYN+ +   APYG YWRQ RK V +ELLS RR++ L+  RE
Sbjct  124  MGYNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRE  165



>ref|XP_009336438.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+IL AMADKYGPIF +RLG Q + VVS+S+IAKEC+TTND S+ +R K +  + 
Sbjct  62   GSTPPHIILGAMADKYGPIFTVRLGVQPSLVVSSSEIAKECYTTNDLSILSRPKMVVVDH  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + YNY +F   P GPYWR+IRK V LELLS R+++ L+  R
Sbjct  122  VSYNYAMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHVR  162



>ref|XP_009364766.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+IL AMADKYGPIF +RLG Q + VVS+S+IAKEC+TTND S+ +R K +  + 
Sbjct  62   GSTPPHIILGAMADKYGPIFTVRLGVQPSLVVSSSEIAKECYTTNDLSILSRPKMVVVDH  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + YNY +F   P GPYWR+IRK V LELLS R+++ L+  R
Sbjct  122  VSYNYAMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHVR  162



>ref|XP_008391540.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=531

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IRLG QQ+ V+S+S+IAKEC+TTND S+  R + + ++ 
Sbjct  62   GPTPPHITLGAMADKYGPIFTIRLGVQQSLVISSSEIAKECYTTNDLSILGRPEMVVADH  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + YNY +FA AP GPYWR+IRK V LE+LS R+++ L+  R
Sbjct  122  VTYNYAMFAFAPPGPYWREIRKIVTLEMLSVRKVELLKHIR  162



>ref|XP_006375025.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
 gb|ERP52822.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
Length=569

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYGPIF ++LG  +T +VSN ++AKEC  TNDK+ ATR K LA +I
Sbjct  99   GSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDI  158

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY++   +PYG YWR IRK V LE+LS  R++  +  RE
Sbjct  159  LGYNYSMLGFSPYGTYWRLIRKIVTLEVLSNHRLEMFKHVRE  200



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP ++ L  +A+K GPIF I+LG  +  +VSN +IAKECFTTNDK  + R KALA EI
Sbjct  81   GQKPAYVTLGNIAEKCGPIFMIKLGMHRALIVSNWEIAKECFTTNDKVFSNRIKALAPEI  140

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +F  +PYGPYWRQIRK   LE+LS  R++ L+  RE
Sbjct  141  LGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEMLKHVRE  182



>gb|KDP38434.1| hypothetical protein JCGZ_04359 [Jatropha curcas]
Length=558

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H++L  MADKYGPIF I++G  +  VVSN +IAKEC TTNDK+ A R K LA E+
Sbjct  50   GPEPSHIVLGDMADKYGPIFTIKMGVHRNLVVSNWEIAKECLTTNDKAFANRPKILAMEL  109

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GY+ ++F  +PYG YWRQ+RK   LELLS  R++ LR  R+
Sbjct  110  LGYDRSMFGFSPYGTYWRQLRKIATLELLSNHRLEMLRHVRQ  151



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  P H +L  MADKYGPIF IR+G  +  VVSN ++AKEC TT+D+  A+R KAL +EI
Sbjct  58   GRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEI  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +G+N+++F  +PYGP+WRQIRK   LELLS  R++ L+  RE
Sbjct  118  LGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVRE  159



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  P H +L  MADKYGPIF IR+G  +  VVSN ++AKEC TT+D+  A+R KAL +EI
Sbjct  58   GRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEI  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +G+N+++F  +PYGP+WRQIRK   LELLS  R++ L+  RE
Sbjct  118  LGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVRE  159



>ref|XP_010106079.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07349.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYGPIF I++G  +  VVS+ ++AKEC TTNDK  A R KA A E 
Sbjct  55   GPQPPHITLAHMADKYGPIFTIKMGVHRALVVSSWEMAKECLTTNDKIFANRPKAAAPEH  114

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            M YNY +F  +PYGPYWRQ+RK   LELLS  R++ L
Sbjct  115  MTYNYAMFGFSPYGPYWRQVRKIATLELLSNHRLEML  151



>ref|XP_007151146.1| hypothetical protein PHAVU_004G021700g [Phaseolus vulgaris]
 gb|ESW23140.1| hypothetical protein PHAVU_004G021700g [Phaseolus vulgaris]
Length=524

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G K PH  L A+ADKYGPIF I++G+++  +++N +IAKECFTT D  +++R K LASE
Sbjct  54   SGSKTPHRTLGALADKYGPIFTIKIGSKKALIINNWEIAKECFTTIDMVVSSRPKLLASE  113

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +MGYN+ +F  APYGPYWR++RK   LE+L+ RR++ L+  R
Sbjct  114  LMGYNHAMFGFAPYGPYWRELRKITTLEILTTRRVEQLQHVR  155



>ref|XP_007151147.1| hypothetical protein PHAVU_004G021800g [Phaseolus vulgaris]
 gb|ESW23141.1| hypothetical protein PHAVU_004G021800g [Phaseolus vulgaris]
Length=524

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G K PH  L A+A+KYGPIF I+LG+++  +++N +IAKECFTT D  +++R K LASE
Sbjct  54   SGSKSPHRTLGALAEKYGPIFTIQLGSKKALIINNWEIAKECFTTIDMVVSSRPKILASE  113

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +MGYN+ +F  APYGPYWR+IRK   LE+L+ RR++ L+  R
Sbjct  114  LMGYNHAMFGFAPYGPYWREIRKITTLEILTTRRVEQLQHVR  155



>ref|XP_008388075.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=531

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IRLG Q + V+S+S+IAKEC+TTND S+ +R K +  + 
Sbjct  62   GSTPPHITLGAMADKYGPIFTIRLGVQPSLVISSSEIAKECYTTNDLSILSRPKMVVVDH  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + YNY +FA  P GPYWR+IRK V LELLS R+++ L+  R
Sbjct  122  VSYNYAMFAFGPPGPYWREIRKIVTLELLSVRKVELLKHIR  162



>ref|XP_007151148.1| hypothetical protein PHAVU_004G021900g [Phaseolus vulgaris]
 gb|ESW23142.1| hypothetical protein PHAVU_004G021900g [Phaseolus vulgaris]
Length=545

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            TG K PH  L A+ADKYGPIF I+LG+++  V++N + AKECFTTND ++++R K +A+E
Sbjct  71   TGSKRPHRTLGALADKYGPIFTIQLGSKRALVINNWETAKECFTTNDMAVSSRPKLVAAE  130

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +MGYN+ +   APYGPYWR++RK + LE+L+ RR++ L+  R
Sbjct  131  LMGYNHAMLVFAPYGPYWRELRKILTLEILTTRRVEQLQHVR  172



>ref|XP_003543523.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=547

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G + PH +L A+ADKYGPIF I++G ++  V+SN +IAKECFTTND  +++R K +A E
Sbjct  79   SGSETPHRVLGALADKYGPIFTIKIGVKKALVISNWEIAKECFTTNDIVVSSRPKLVAIE  138

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +M YN  +F  APYGPYWRQ+RK V LE+LS RR++ L+
Sbjct  139  LMCYNQAMFGFAPYGPYWRQLRKIVNLEILSNRRVEQLQ  177



>gb|KHN13272.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G + PH +L A+ADKYGPIF I++G ++  V+SN +IAKECFTTND  +++R K +A E
Sbjct  55   SGSETPHRVLGALADKYGPIFTIKIGVKKALVISNWEIAKECFTTNDIVVSSRPKLVAIE  114

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +M YN  +F  APYGPYWRQ+RK V LE+LS RR++ L+
Sbjct  115  LMCYNQAMFGFAPYGPYWRQLRKIVNLEILSNRRVEQLQ  153



>gb|KDP38432.1| hypothetical protein JCGZ_04357 [Jatropha curcas]
Length=529

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H+ L  +ADKYGPIF I+LG  +T VVS+  +AKEC TTND++ A+R K LA EI
Sbjct  57   GSQPAHITLGNLADKYGPIFTIKLGVYRTLVVSSRAMAKECLTTNDRAFASRPKGLAMEI  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GY+Y++   +PYG YWRQ+RK V LELLS  R++ L+  RE
Sbjct  117  LGYDYSMLGFSPYGEYWRQMRKIVTLELLSNHRLEMLKHVRE  158



>ref|XP_008388170.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=526

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IRLG Q + V+S+S+IAKEC+TTND S+  R K + ++ 
Sbjct  57   GPTPPHITLGAMADKYGPIFTIRLGVQPSLVISSSEIAKECYTTNDLSILGRPKMVVADH  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + YNY +FA  P GPYWRQIRK V LELLS R+++ L+  R
Sbjct  117  VTYNYAMFAFGPPGPYWRQIRKIVTLELLSVRKVELLKHIR  157



>gb|KDP38429.1| hypothetical protein JCGZ_04354 [Jatropha curcas]
Length=498

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H+ L  MA+KYGPIF I+LG   T +VS+ ++AKEC TTNDK+ A+R K LA EI
Sbjct  27   GSQPAHITLGNMAEKYGPIFTIKLGVHPTLIVSSREMAKECLTTNDKAFASRPKGLAMEI  86

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY +   +PYG YWR +RK + LELLS  R++ L+  RE
Sbjct  87   LGYNYCMVGFSPYGDYWRHMRKIITLELLSNHRLEMLKNVRE  128



>ref|XP_011030947.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=528

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADK+GPIF ++LG  +  +VSN ++AKEC   NDK+ ATR KALA++I
Sbjct  58   GSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEMAKECLRINDKAFATRPKALATDI  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +G+NY++   +PYG YWRQIRK V LE+LS  R++  +  RE
Sbjct  118  LGFNYSMLGFSPYGTYWRQIRKIVTLEVLSNHRLEMFKHVRE  159



>ref|XP_011030954.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADK+GPIF ++LG  +  +VSN ++AKEC   NDK+ ATR KALA++I
Sbjct  58   GSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEMAKECLRINDKAFATRPKALATDI  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +G+NY++   +PYG YWRQIRK V LE+LS  R++  +  RE
Sbjct  118  LGFNYSMLGFSPYGTYWRQIRKIVTLEVLSNHRLEMFKHVRE  159



>ref|XP_011030937.1| PREDICTED: cytochrome P450 CYP82H23-like [Populus euphratica]
Length=328

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADK+GPIF ++LG  +  +VSN ++AKEC   NDK+ ATR K LA +I
Sbjct  58   GSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEMAKECLRINDKAFATRPKTLAMDI  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY+I + +PYG YWR IRK V LE+LS  R++  +  RE
Sbjct  118  LGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMFKHVRE  159



>ref|XP_010664625.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=520

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH  L AMADKYGPIF I+LGA+   VVSN +IAKECFTTNDK+ A R K +A E+
Sbjct  55   GSELPHKTLGAMADKYGPIFFIKLGARPVLVVSNWEIAKECFTTNDKAFANRPKLIAVEV  114

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            MGYN  +F  +PYG YWRQ+RK V   LLS R ++ L+  R
Sbjct  115  MGYNNAMFGFSPYGSYWRQMRKIVTTHLLSNRSLEMLKLVR  155



>gb|KJB63753.1| hypothetical protein B456_010G014200 [Gossypium raimondii]
Length=327

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG +F I+LG  +T VV+N +IAKEC T NDK+ A+R K +  E+
Sbjct  63   GPQPPHISLANMADKYGRMFTIKLGVHRTLVVNNWEIAKECLTINDKAFASRPKVVNMEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN  +   APYGPYWRQ+RK   +ELLS  R+D  +  RE
Sbjct  123  LGYNNAMIVFAPYGPYWRQVRKCATIELLSTHRLDLFKHVRE  164



>gb|KJB63756.1| hypothetical protein B456_010G014200 [Gossypium raimondii]
Length=328

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG +F I+LG  +T VV+N +IAKEC T NDK+ A+R K +  E+
Sbjct  63   GPQPPHISLANMADKYGRMFTIKLGVHRTLVVNNWEIAKECLTINDKAFASRPKVVNMEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN  +   APYGPYWRQ+RK   +ELLS  R+D  +  RE
Sbjct  123  LGYNNAMIVFAPYGPYWRQVRKCATIELLSTHRLDLFKHVRE  164



>gb|AGC29951.1| CYP82D61 [Sinopodophyllum hexandrum]
Length=453

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MADKYGP+F+I LG QQ  VV+NS+IAKECFTTND+    RT  +A +IM YNY +F  A
Sbjct  1    MADKYGPVFKIHLGVQQALVVNNSEIAKECFTTNDRFFLNRTSGVAVKIMSYNYVMFGFA  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLR  302
            PYGPYWR +RK ++L+LLS RR+ SL+
Sbjct  61   PYGPYWRDMRKIIMLDLLSKRRLQSLK  87



>gb|KJB63755.1| hypothetical protein B456_010G014200 [Gossypium raimondii]
Length=332

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG +F I+LG  +T VV+N +IAKEC T NDK+ A+R K +  E+
Sbjct  63   GPQPPHISLANMADKYGRMFTIKLGVHRTLVVNNWEIAKECLTINDKAFASRPKVVNMEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN  +   APYGPYWRQ+RK   +ELLS  R+D  +  RE
Sbjct  123  LGYNNAMIVFAPYGPYWRQVRKCATIELLSTHRLDLFKHVRE  164



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGP++ IRLG   + V+S+S+IAKECFTTND S+ +R K    + 
Sbjct  57   GSTPPHITLGAMADKYGPLYTIRLGVYPSLVISSSEIAKECFTTNDLSVNSRPKMAVVDH  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GYNY +F  AP GPYWR+IRK   LELLS RR++ L+  R
Sbjct  117  IGYNYAMFGFAPSGPYWREIRKITTLELLSNRRVELLKHIR  157



>ref|XP_006486180.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
Length=526

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  MADKYGPIF ++LG +Q  +VSN +IAKECFTTNDK+ A+R K +A E+
Sbjct  62   GPEPAHRVLGDMADKYGPIFTMKLGVKQALMVSNWEIAKECFTTNDKAFASRPKTMAMEL  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            + YN+++ + APYG YWRQ  K   +ELLS  R++ L+  REY
Sbjct  122  LEYNFSVISFAPYGNYWRQSLKIATIELLSSHRLEKLKHVREY  164



>ref|XP_006366469.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=455

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MA+KYGPIFR++LG  +  +VS+ KI KECFTTND++ ATR K++ SEI+GYNY +F + 
Sbjct  1    MAEKYGPIFRLKLGVNEVVIVSDHKIVKECFTTNDRAFATRPKSIGSEILGYNYAMFGLG  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            PYGPYWR+IRK V +E  S RRI  L+  +++
Sbjct  61   PYGPYWREIRKIVTIEFFSARRIKMLQHIKQF  92



>gb|KHG26594.1| Cytochrome P450 [Gossypium arboreum]
Length=526

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H+ +   AD YGPIF  RLG   T VVSN ++AKECFTTNDK+ A+R + LA+E+
Sbjct  59   GPKPAHITMGNFADAYGPIFTFRLGMHPTLVVSNWEMAKECFTTNDKAFASRPRTLAAEL  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+ +F  + YGPYWR +RK   LE+LS  R++ LR  RE
Sbjct  119  LGYNFAMFGFSSYGPYWRHVRKIATLEVLSNYRLEKLRHVRE  160



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +  H  L AMADKYGPIF+IR+G     VVSNS IAKECFTTNDK+ A+R  + AS+I
Sbjct  43   GSELRHKTLGAMADKYGPIFKIRIGVNHALVVSNSDIAKECFTTNDKAFASRPTSTASKI  102

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GY+Y +F +APYG YW ++RK  + ELLS RR++ L+  R+
Sbjct  103  LGYDYVMFGMAPYGQYWVELRKITMSELLSNRRLELLKHVRD  144



>ref|XP_006486181.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
Length=526

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L  MADKYGPIF ++LG +Q  +VSN +IAKECFTTNDK+ A+R K +A E+
Sbjct  62   GPEPAHRVLGDMADKYGPIFTMKLGVKQALMVSNWEIAKECFTTNDKAFASRPKTMAMEL  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            + YN+++ + APYG YWRQ  K   +ELLS  R++ L+  REY
Sbjct  122  LEYNFSVISFAPYGNYWRQSLKIATIELLSSHRLEKLKHVREY  164



>gb|KEH30993.1| cytochrome P450 family protein [Medicago truncatula]
Length=526

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYGPIF +RLG  +T VVS+ ++ K+CFT NDK+ A+R K++A EI
Sbjct  64   GSQPPHVTLGNLADKYGPIFTVRLGVHKTLVVSSYEMVKQCFTVNDKTFASRPKSIAFEI  123

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            MGYN ++F ++PYG YWR +RK   + +LS +RID L+
Sbjct  124  MGYNSSMFGLSPYGSYWRTVRKIATVHVLSAQRIDMLK  161



>ref|XP_003554859.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
 gb|KHN19616.1| Cytochrome P450 82A4 [Glycine soja]
Length=528

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            K PH +L A+ADKYGPIF I+LGA++  V+SN +IAKECFTTND  +++R + +A+E MG
Sbjct  58   KAPHRVLGALADKYGPIFTIKLGAKKALVISNWEIAKECFTTNDIVVSSRPRLVAAENMG  117

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            YN+ I   +PYGPYWR++RK   LE+L+ RR++ L+  R
Sbjct  118  YNHAILGFSPYGPYWRELRKITTLEILTSRRVEQLQHVR  156



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L AMADK GPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI
Sbjct  63   GPEPPHRVLGAMADKCGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
             GYN+++F  +PYG YWR+ RK   +ELLS  R++ L+  R+Y
Sbjct  123  FGYNFSMFGFSPYGSYWRETRKIATVELLSNHRLEKLKHVRDY  165



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH +L  +ADKYGPIF ++LG  Q  VVS+ K+AKECFTTND +LA R K++ASEI+GY 
Sbjct  62   PHKMLGRLADKYGPIFGMKLGVHQVVVVSDHKLAKECFTTNDLALAGRPKSMASEIIGYK  121

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            + +F +  YGPYWR+ RK   +EL S RRI+ L+  RE+
Sbjct  122  HAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIREF  160



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   126 bits (316),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H++L  MA+KYGPIF I++G  +  VV+N + AKEC TTNDK+ A+R K LA E+
Sbjct  61   GPQPAHIVLGDMAEKYGPIFTIKMGVYRALVVNNWETAKECLTTNDKAFASRPKTLAMEL  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + Y++ +F  APYGPYWRQ+RK   LELLS  R+D L+  R+
Sbjct  121  LSYDHAMFGFAPYGPYWRQMRKVATLELLSSYRLDRLKHVRQ  162


 Score = 33.5 bits (75),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 1/31 (3%)
 Frame = +2

Query  320  VRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  412
            ++ S+K +++HWS+NKD ++  V VEMK  F
Sbjct  165  IKTSLKELYQHWSENKD-SSDKVLVEMKAWF  194



>ref|XP_009336967.1| PREDICTED: cytochrome P450 82A4-like [Pyrus x bretschneideri]
Length=526

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IRLG Q + V+S+S+IAKEC+TTND S+ +R K +  + 
Sbjct  57   GSTPPHITLGAMADKYGPIFTIRLGVQPSLVISSSEIAKECYTTNDLSILSRPKMVVVDH  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + Y+Y +FA  P GPYWR+IRK V LELLS R+++ L+  R
Sbjct  117  VSYDYAMFAFGPPGPYWREIRKIVTLELLSVRKVELLKHVR  157



>ref|XP_007151145.1| hypothetical protein PHAVU_004G021600g [Phaseolus vulgaris]
 gb|ESW23139.1| hypothetical protein PHAVU_004G021600g [Phaseolus vulgaris]
Length=530

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G K PH  L A+ADKYGPIF I+LG+++  +++N +IAKECFTT D  +++R K LASE
Sbjct  56   SGSKTPHRTLGALADKYGPIFTIQLGSKKALIINNWEIAKECFTTIDMVVSSRPKILASE  115

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +MGYN+ +F  APYGPYWR++RK   LE+LS R ++ L+  R
Sbjct  116  LMGYNHAMFGFAPYGPYWRELRKITTLEILSPRPVEQLQHVR  157



>gb|KJB63763.1| hypothetical protein B456_010G015000, partial [Gossypium raimondii]
Length=985

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG IF I+LG  +  VVSN +IAKEC T NDK+ A+R     SEI
Sbjct  62   GSQPPHISLANMADKYGRIFSIKLGVHRALVVSNWEIAKECLTINDKAFASRPMLACSEI  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYN  +    PYGPYWRQ+RK V +ELLS  R++ L+P  E
Sbjct  122  MGYNGAMIGFVPYGPYWRQVRKIVTIELLSNHRLELLKPVME  163


 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG IF I+LG  +  VVS+ +IAKEC T NDK  A+R K  +SEI
Sbjct  568  GSQPPHISLANMADKYGRIFSIKLGVHRALVVSDWEIAKECLTVNDKEFASRPKLASSEI  627

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +G N  +   APYGPYWRQIRK   +ELLS  R++ L+  RE
Sbjct  628  LGNNRAMLGFAPYGPYWRQIRKVAAIELLSNHRLELLKHVRE  669



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L +MADKYGPIF I++G  +  VVS+ ++AKEC TTNDK  A+R K LA EI
Sbjct  24   GPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECLTTNDKIFASRPKTLAMEI  83

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   LELLS  R++ LR  R+Y
Sbjct  84   LGYNFSMFGSSPYGSYWRETRKIATLELLSKHRLEKLRHVRDY  126



>ref|XP_009374201.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=532

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +3

Query  3    STGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  182
            S+  +P HL+   +ADKYGPIF I+ G ++  VVS+S+IAKECF TNDK  A+R K++A 
Sbjct  59   SSSTEPAHLLFGNLADKYGPIFTIKFGVKRAIVVSSSEIAKECFKTNDKVFASRPKSIAG  118

Query  183  EIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            E++GYNY  F  +PYG Y+RQIRK   LE+LS  RI+ L+  RE+
Sbjct  119  EVLGYNYAFFPFSPYGDYFRQIRKIATLEVLSQSRIEKLKHIREF  163



>gb|KJB63754.1| hypothetical protein B456_010G014200 [Gossypium raimondii]
Length=428

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG +F I+LG  +T VV+N +IAKEC T NDK+ A+R K +  E+
Sbjct  63   GPQPPHISLANMADKYGRMFTIKLGVHRTLVVNNWEIAKECLTINDKAFASRPKVVNMEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN  +   APYGPYWRQ+RK   +ELLS  R+D  +  RE
Sbjct  123  LGYNNAMIVFAPYGPYWRQVRKCATIELLSTHRLDLFKHVRE  164



>gb|KCW67760.1| hypothetical protein EUGRSUZ_F01497 [Eucalyptus grandis]
Length=440

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            K PH  LA+MAD++GPIF IRLG  +  VVS S+IAKECFT ND +L+TR + LA +I+ 
Sbjct  58   KLPHKTLASMADQFGPIFTIRLGMFRALVVSGSEIAKECFTKNDIALSTRPQQLAPKILA  117

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            Y Y +F   PYGPYWR++RK V LELLS RR++SL
Sbjct  118  YGYAMFGYVPYGPYWREVRKMVTLELLSNRRVNSL  152



>gb|KJB59837.1| hypothetical protein B456_009G274900 [Gossypium raimondii]
Length=526

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H+ L   AD YGPIF  RLG   T VVSN ++AKECFTTNDK+ A+R + LA+E+
Sbjct  59   GPKPAHITLGNFADAYGPIFTFRLGMHPTLVVSNWEMAKECFTTNDKAFASRPRTLAAEL  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+ +F  + YGPYWR +RK   LE+LS  R+  LR  RE
Sbjct  119  LGYNFAMFGFSSYGPYWRHVRKIATLEVLSNYRLAKLRHVRE  160



>ref|XP_010106088.1| Cytochrome P450 82A4 [Morus notabilis]
 gb|EXC07358.1| Cytochrome P450 82A4 [Morus notabilis]
Length=525

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH+ LA +ADKYGPIF I +G   T V+S+ + AKECFTT+D +++TR K ++SEI
Sbjct  59   GSQLPHITLANLADKYGPIFTIHIGVHPTLVISSWESAKECFTTHDLAVSTRPKLISSEI  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +G+NY  F  APYGPYWR+IRK    ELLS +R++ LR  RE
Sbjct  119  LGWNYASFGFAPYGPYWREIRKITTSELLSNKRLEKLRHVRE  160



>gb|KJB14542.1| hypothetical protein B456_002G130200 [Gossypium raimondii]
Length=410

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KPPH+IL+ MA+K GPIF I++G  +  +VS+ K AKEC T NDK+ A+R   LA E 
Sbjct  58   GPKPPHIILSNMAEKCGPIFTIKMGVHRALIVSDHKTAKECLTINDKAFASRPSTLAMEY  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + YN+ +FA APYG +WRQ+RK   LELLS  R++ LR  RE
Sbjct  118  LSYNHAMFAFAPYGNHWRQLRKLATLELLSTHRLEQLRHVRE  159



>gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H+IL  MADK GPIF+I+LG   T VVSN ++AK+C TTND+  ATR K LAS +
Sbjct  59   GSKPLHIILGKMADKMGPIFKIKLGMHPTLVVSNWEMAKQCLTTNDQVFATRPKTLASVL  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN  +   +PYGPYWRQ+RK  +LELLS +RI +    RE
Sbjct  119  VGYNRAMLPFSPYGPYWRQMRKIAILELLSNQRIQTQSRVRE  160



>ref|XP_007224041.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
 gb|EMJ25240.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
Length=517

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KPPHL+L  MA++YGPIF + +G  +  +VS+S+IAKECFTTNDK  A+R K +A+EI
Sbjct  38   GSKPPHLVLGKMAERYGPIFTVNIGVHKALIVSSSEIAKECFTTNDKVFASRPKFMAAEI  97

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY     +PY  Y RQ+RK V+LE+LS  R++ L+  RE
Sbjct  98   MAYNYAFLPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVRE  139



>gb|KGN59915.1| Cytochrome P450 [Cucumis sativus]
Length=521

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            +P H+ LA  AD YGPIF ++LG  +  VVS+ +IAKECFTTND+  A+R K +AS+++G
Sbjct  62   EPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIAKECFTTNDRIFASRPKLVASKLLG  121

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            YNYT+F ++PYG YWR IRK   LELL+ RR+  L+  RE+
Sbjct  122  YNYTMFGLSPYGSYWRHIRKLATLELLTNRRLHQLQHIREF  162



>gb|KJB63765.1| hypothetical protein B456_010G015200 [Gossypium raimondii]
Length=532

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG IF I+LG  +  VVS+ +IAKEC T NDK+ A+R K  +SEI
Sbjct  58   GSQPPHISLANMADKYGRIFSIKLGVHRALVVSDWEIAKECLTVNDKAFASRPKLASSEI  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +G N  +   APYGPYWRQIRK   +ELLS  R++ L+  RE
Sbjct  118  LGNNRAMLGFAPYGPYWRQIRKVATIELLSNHRLELLKHVRE  159



>gb|KDP38435.1| hypothetical protein JCGZ_04360 [Jatropha curcas]
Length=182

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  MA+K GPI+ I+LG  +  +VS+ ++ KECFTTNDK+ A R KAL  ++
Sbjct  61   GSQPPHITLEKMAEKIGPIYSIKLGVHRALIVSSWEMVKECFTTNDKAFAYRPKALFLDV  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M Y+Y +F  +PYG YWR++RK   LELLS RR++ L+  RE
Sbjct  121  MSYDYAMFGASPYGDYWREMRKIATLELLSVRRLELLKHVRE  162



>gb|KHN19614.1| Cytochrome P450 82A4 [Glycine soja]
Length=520

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G + PH +L A+ADKYGPIF I  G ++  V+SN +IAKECFTTND  +++R K LA E
Sbjct  55   SGSETPHKVLDALADKYGPIFTINNGVKKVLVISNWEIAKECFTTNDIVVSSRPKLLAIE  114

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +M YN  +F  APYGPYWR++RK V LE+LS RR++ L   R
Sbjct  115  LMCYNQAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLENVR  156



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH  L AMADKYGP+F I+LG Q+  ++SN ++AKECFTTNDK  A R K++A E+
Sbjct  68   GPELPHKTLGAMADKYGPVFLIKLGVQRVLMLSNWEMAKECFTTNDKVFANRPKSIAVEV  127

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +GYNY +F   PYG YWRQ+RK V   LLS RR++ ++
Sbjct  128  LGYNYAMFGFGPYGSYWRQVRKIVTTGLLSNRRLEIVK  165



>ref|XP_010060880.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW67758.1| hypothetical protein EUGRSUZ_F01493 [Eucalyptus grandis]
Length=540

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            K PH  LA+MAD+YGPIF I+LG  ++ VVS S++AKECFT ND +L+TR + LA +I+G
Sbjct  75   KLPHKTLASMADQYGPIFTIQLGMFRSVVVSGSEMAKECFTKNDIALSTRPQQLAQKILG  134

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            Y++ +F  APYGPYWR++RK   LELLS RR++SL
Sbjct  135  YSFAMFPFAPYGPYWRELRKMATLELLSNRRVNSL  169



>gb|KHN34164.1| Cytochrome P450 82A4 [Glycine soja]
Length=525

 Score =   124 bits (311),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G + PH +L A+ADKYGPIF I  G ++  V+SN +IAKECFT ND  +++R K LA E
Sbjct  55   SGSETPHKVLDALADKYGPIFTINYGVKKALVISNWEIAKECFTKNDIVVSSRPKLLAIE  114

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +M YN  +F  APYGPYWR++RK V LE+LS RR++ L   R
Sbjct  115  LMCYNQAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLENVR  156


 Score = 33.9 bits (76),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +2

Query  320  VRKSIKRMFEHWSDNKDAATGAVTVEMKQTFDR  418
            V+ SIK +F  WS NK+  +G   +E+KQ F +
Sbjct  160  VQSSIKELFNVWSSNKNNESGYALLELKQWFSQ  192



>ref|XP_011030958.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X3 [Populus 
euphratica]
Length=527

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADK+GPIF ++LG  +  +VSN ++AKEC   NDK+ ATR K LA +I
Sbjct  57   GSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEMAKECLRINDKAFATRPKTLAMDI  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYNY+I + +PYG YWR IRK V LE+LS  R++  +  RE
Sbjct  117  LGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMFKHVRE  158



>ref|XP_008351399.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=526

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IRLG Q + V+S+S+IAKEC+TTND S+  R K + ++ 
Sbjct  57   GPTPPHITLGAMADKYGPIFTIRLGVQXSLVISSSEIAKECYTTNDLSILGRPKMVVADH  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + YNY +FA  P GPYWR+IRK V LE LS R+++ L+  R
Sbjct  117  VTYNYAMFAFXPPGPYWRZIRKIVTLEXLSVRKVELLKHIR  157



>emb|CBI19611.3| unnamed protein product [Vitis vinifera]
Length=929

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH  L AMADKYGPIF I+LGA+   VVSN +IAKECFTTNDK+ A R K +A E+
Sbjct  55   GSELPHKTLGAMADKYGPIFFIKLGARPVLVVSNWEIAKECFTTNDKAFANRPKLIAVEV  114

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            MGYN  +F  +PYG YWRQ+RK V   LLS R ++ L+  R
Sbjct  115  MGYNNAMFGFSPYGSYWRQMRKIVTTHLLSNRSLEMLKLVR  155



>gb|KDO36922.1| hypothetical protein CISIN_1g041575mg, partial [Citrus sinensis]
Length=263

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H IL  MA+KYGPIF +++G  +  VVSNS+I KECFTTNDK+LA+R + +A EI
Sbjct  10   GPEPTHRILGNMANKYGPIFTMKMGVNRALVVSNSEITKECFTTNDKALASRPRRMAMEI  69

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+     +PYG YWR+ RK   +ELLS  R++ L+  RE
Sbjct  70   LGYNFLATPSSPYGSYWRETRKIATVELLSNHRLEKLKHVRE  111



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KPP+ +   MADKYGPIF IR+G     +VSN +IAKEC TT+DK  A R K LA EI
Sbjct  63   GPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIAKECLTTHDKVFANRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   L LLS  R++ L+  REY
Sbjct  123  LGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLKHVREY  165



>ref|XP_006366471.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH  L+ MADKYG IF ++LG  Q  VVS+ K+AKECFTTND +LA R K++ SEIMGY 
Sbjct  61   PHRTLSRMADKYGSIFGMKLGVHQVVVVSDPKLAKECFTTNDLALAGRPKSMGSEIMGYK  120

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            + +F +  YGPYWR+ RK   +ELLS RRI+ L+  RE+
Sbjct  121  HAMFGLCSYGPYWRETRKIATVELLSNRRIEMLKHIREF  159



>gb|KDP38430.1| hypothetical protein JCGZ_04355 [Jatropha curcas]
Length=532

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +A+K GPI+RI++G   T ++++S++AKECFT NDK+ A R KAL  ++
Sbjct  61   GSQPPHITLGKIAEKLGPIYRIKVGVHPTLIITSSELAKECFTINDKAFAYRPKALFLDV  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M YNY +F  +PYG YWR+IRK   LELLS RR++ L+  RE
Sbjct  121  MTYNYAMFGASPYGDYWREIRKIASLELLSARRLELLKHVRE  162



>gb|KJB47835.1| hypothetical protein B456_008G044400 [Gossypium raimondii]
Length=520

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H I   MADKYGP F +RLG+ +  VVSN ++AKECFTTNDK  +TR ++LAS++MGY++
Sbjct  62   HRIFGDMADKYGPAFLVRLGSHRALVVSNWQVAKECFTTNDKIFSTRPRSLASKLMGYDH  121

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
             +   APYGPYWR +RK   LELLS RR++ LR  R+
Sbjct  122  KMLGFAPYGPYWRSLRKLATLELLSSRRMELLRHVRD  158



>gb|KDO42181.1| hypothetical protein CISIN_1g009844mg [Citrus sinensis]
Length=524

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KPP+ +   MADKYGPIF IR+G     +VSN +IAKEC TT+DK  A R K LA EI
Sbjct  63   GPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIAKECLTTHDKVFANRPKTLAMEI  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YWR+ RK   L LLS  R++ L+  REY
Sbjct  123  LGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLKHVREY  165



>ref|XP_007151149.1| hypothetical protein PHAVU_004G022000g [Phaseolus vulgaris]
 gb|ESW23143.1| hypothetical protein PHAVU_004G022000g [Phaseolus vulgaris]
Length=544

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G K PH  L A+ADKYGPIF I+LGA++  V++N + AKECFTTND ++++R K +A E
Sbjct  71   SGSKRPHRTLGALADKYGPIFTIQLGAKRALVINNWETAKECFTTNDMAVSSRPKLIAIE  130

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYT*ENPSNACSNI  353
            +MGYN  +F   PYGPYWR++RK V LE+L+ RR++ L+  R    +N      N+
Sbjct  131  LMGYN-AMFGFVPYGPYWRELRKIVTLEILTTRRVEQLQHVRVSELQNSIKELHNV  185



>ref|XP_008464766.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=521

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +  +P H+ LA +AD YGPIF ++LG  +  VVS+ +IAKECFTTND+  A+R K +AS+
Sbjct  59   SATEPAHITLAKLADTYGPIFTLKLGMSKALVVSSWEIAKECFTTNDRIFASRPKLVASK  118

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            ++GYNY +  ++PYGPYWR IRK   LELL+ RR+   +  RE+
Sbjct  119  LLGYNYNMLGLSPYGPYWRHIRKLATLELLTNRRLHQFQHIREF  162



>gb|ABB20912.1| P450 mono-oxygenase [Stevia rebaudiana]
Length=528

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H +L  +ADKYGPIF I+LG  Q  VVS++   K+CFTT+DK+ A+R K+ A EIMGYNY
Sbjct  62   HRVLGDLADKYGPIFTIKLGVYQVLVVSSADAVKDCFTTSDKAFASRPKSTAVEIMGYNY  121

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
             +F +APYG YWRQ+RK  VLE+LS +R+D L   R
Sbjct  122  AMFGLAPYGEYWRQVRKIAVLEILSQKRVDMLEWAR  157



>gb|KJB63760.1| hypothetical protein B456_010G014600 [Gossypium raimondii]
Length=525

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ LA MADKYG +F I+LG  +  VVS+ +IAKEC TTNDK+ A+R K  +SE+
Sbjct  58   GPQPPHISLANMADKYGRMFAIKLGVHRALVVSDWEIAKECLTTNDKAFASRPKLASSEL  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + YN  +F  APYGPYWR +RK   +ELLS  R++ L+  RE
Sbjct  118  LAYNRAMFGFAPYGPYWRHMRKIATIELLSNHRLELLKHVRE  159



>ref|XP_004505090.1| PREDICTED: cytochrome P450 82A3-like [Cicer arietinum]
Length=533

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            +PPH+ L  MA+KYGPIF +RLG  +T VVS+S+IAK+CFT ND +LA+R  ++A EI+G
Sbjct  64   QPPHVTLGNMAEKYGPIFTVRLGVHKTLVVSSSEIAKQCFTVNDGALASRPNSVAFEILG  123

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            YNY +F  +PYG YWR +RK   + +LS ++ID L+
Sbjct  124  YNYAMFGFSPYGSYWRTMRKIATVHVLSAQQIDKLK  159



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L +MA+KYGPIF I++G  +  VVSN + AKECFTT+DK+ + R K LASE+
Sbjct  63   GAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGRPKTLASEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE
Sbjct  123  LTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE  164



>ref|XP_010028533.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW55288.1| hypothetical protein EUGRSUZ_I01215 [Eucalyptus grandis]
Length=524

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H ILAAMA++YGP F IRLG  Q  VVSN ++AKECFT+ND+   TR ++L+ ++MGY++
Sbjct  62   HRILAAMANQYGPAFSIRLGIHQVLVVSNWEVAKECFTSNDRVFPTRPRSLSVKLMGYDH  121

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
             +F  APYGPYWR +RK  V+ELLS  R+D L+  R+
Sbjct  122  AMFGFAPYGPYWRGMRKLAVVELLSNHRLDLLKHVRD  158



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H +L +MADKYGPIF I++G  +  VVS+ ++AKEC TTNDK  A+R K LA EI
Sbjct  70   GPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECLTTNDKIFASRPKTLAMEI  129

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            +GYN+++F  +PYG YW + RK   LELLS  R++ LR  R+Y
Sbjct  130  LGYNFSMFGFSPYGSYWCETRKIATLELLSNHRLEKLRHVRDY  172



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADKYGP F IRLG+++ FVVS+ ++AK+CFT ND++LA+R   +A++ MGYNY +F
Sbjct  63   LGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDCFTVNDRALASRPTTVAAKHMGYNYAVF  122

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR+D LR  R
Sbjct  123  GFAPYSPFWREMRKIATLELLSNRRLDMLRHVR  155



>ref|XP_004154898.1| PREDICTED: cytochrome P450 82A3-like [Cucumis sativus]
Length=501

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            +P H+ LA  AD YGPIF ++LG  +  VVS+ +IAKECFTTND+  A+R K +AS+++G
Sbjct  62   EPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIAKECFTTNDRIFASRPKLVASKLLG  121

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            YNYT+  ++PYG YWR IRK   LELL+ RR+  L+  RE+
Sbjct  122  YNYTMLGLSPYGSYWRHIRKLATLELLTNRRLHQLQHIREF  162



>ref|XP_006366437.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=520

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +3

Query  3    STGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  182
            S   + PH +L  +ADKYG IF ++LG  Q  VVS+ K+AKECFTTND +LA R K++AS
Sbjct  55   SESDQLPHKVLGRLADKYGSIFGMKLGVHQVVVVSDHKLAKECFTTNDLALANRPKSMAS  114

Query  183  EIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            EI+GY + +F +  YGPYWR+ RK   +EL S RRI+ L+  R++
Sbjct  115  EIIGYKHAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIRQF  159



>ref|XP_006432703.1| hypothetical protein CICLE_v10003959mg [Citrus clementina]
 gb|ESR45943.1| hypothetical protein CICLE_v10003959mg [Citrus clementina]
Length=428

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            +P H +L  MADKYGPIF IR+G  +  VVSN +IAKEC TT+DK  A R K LA +I+G
Sbjct  5    EPAHRVLGNMADKYGPIFTIRMGINRALVVSNWEIAKECLTTHDKVFANRPKTLAMDILG  64

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            Y +++F   PYG YWR+ RK   LELLS  R++ L+  REY
Sbjct  65   YKFSMFGFRPYGSYWRETRKIATLELLSNHRLEKLKNVREY  105



>ref|XP_010106083.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07353.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H+ L AMAD  GPIF IR+G+ +  VVS+S++A+ECFTTND +LA+R   LA++ 
Sbjct  59   GPKPSHINLGAMADICGPIFTIRIGSHRGLVVSSSEMARECFTTNDLALASRPNLLAAKH  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GYNY +FA AP+GP+WR+IRK   +ELLS RR++ L+  R
Sbjct  119  IGYNYAMFAFAPHGPFWREIRKIATVELLSNRRLELLKHIR  159



>ref|XP_007133366.1| hypothetical protein PHAVU_011G173200g [Phaseolus vulgaris]
 gb|ESW05360.1| hypothetical protein PHAVU_011G173200g [Phaseolus vulgaris]
Length=527

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G K PH  L A+ADKYGPIF I+LG+++  V++N ++AKECFTTND ++++R K +A E
Sbjct  54   SGSKRPHRTLGALADKYGPIFTIQLGSKKALVINNWEMAKECFTTNDMAVSSRPKLIAIE  113

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +MGYN  +F   PYGPYWR++RK V LE+L+ RR++ L+  R
Sbjct  114  LMGYN-AMFGFVPYGPYWRELRKIVTLEILTTRRVEQLQHVR  154



>ref|XP_006375030.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
 gb|ERP52827.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
Length=538

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L +MA+KYGPIF I++G  +  VVSN + AKECFTT+DK+ + R + LASE+
Sbjct  63   GAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGRPRTLASEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE
Sbjct  123  LTYDGAMLGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE  164



>ref|XP_004147822.1| PREDICTED: uncharacterized protein LOC101212976 [Cucumis sativus]
Length=1051

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            +P H+ LA  AD YGPIF ++LG  +  VVS+ +IAKECFTTND+  A+R K +AS+++G
Sbjct  62   EPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIAKECFTTNDRIFASRPKLVASKLLG  121

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            YNYT+F ++PYG YWR IRK   LELL+ RR+  L+  RE+
Sbjct  122  YNYTMFGLSPYGSYWRHIRKLATLELLTNRRLHQLQHIREF  162


 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
               +P H+ LA MAD YGP+F  R G ++  +VSN  +AKE FTTND+  A+R K +AS+
Sbjct  586  NASEPTHITLAKMADAYGPMFTFRFGMKRALIVSNWDLAKEIFTTNDRIFASRPKLVASK  645

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYT*E  326
            I+ Y+Y +   +PY P+WR +RK   LELL+  R+D L+  R +  E
Sbjct  646  ILAYDYAMMGFSPYSPHWRYVRKIATLELLTNHRVDQLQYIRAFEVE  692



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADKYGP F IRLG+++ FVVS+ ++AKECFT NDK+LATR   +A++ MGYNY +F
Sbjct  65   LGAMADKYGPAFNIRLGSRRAFVVSSWEVAKECFTINDKALATRPTTVAAKHMGYNYAVF  124

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR++ L+  R
Sbjct  125  GFAPYSPFWREMRKIATLELLSNRRLEILKHVR  157



>gb|KCW52083.1| hypothetical protein EUGRSUZ_J01518 [Eucalyptus grandis]
Length=533

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH  L +MADKYGPIF +RLG     VVS+S+IAKEC T +D +LA+R + +ASE+MGYN
Sbjct  66   PHKTLGSMADKYGPIFTVRLGLFPAVVVSSSEIAKECCTKHDHALASRPQLIASEVMGYN  125

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
               F +AP+GPYWR +RK V LE+LS RRI+SL
Sbjct  126  SASFGLAPHGPYWRDMRKIVTLEMLSARRIESL  158



>ref|XP_007017414.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14639.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=755

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH++L  MADKYGPIF I++GA +  VVSN + AKEC TTNDK+ A+R K  A + 
Sbjct  61   GPQPPHIVLGDMADKYGPIFTIKMGAYRALVVSNWETAKECLTTNDKAFASRPKTHAIDF  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + Y++ +F  A YGPYWRQ+RK   LELLS  R+D L+  R+
Sbjct  121  LTYDHAMFGFASYGPYWRQMRKVATLELLSNYRLDMLKHVRQ  162


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G KP H+ L  + DKYGPIF I+LG +   V+SNS++AKEC TTN+++   R K+LA+E 
Sbjct  680  GPKPAHITLGDLVDKYGPIFTIKLGMKPALVISNSELAKECLTTNNEAFVNRLKSLAAEF  739

Query  189  MGYNYTIFAVAPYGPY  236
             GYNY +   +PYG Y
Sbjct  740  FGYNYAMLRFSPYGSY  755



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L +MA+KYGPIF I++G  +  VVSN + AKECFTT+DK+ + R + LASE+
Sbjct  63   GAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGRPRTLASEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE
Sbjct  123  LTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE  164



>ref|XP_007017409.1| Cytochrome P450, family 82, subfamily C, polypeptide 4, putative 
[Theobroma cacao]
 gb|EOY14634.1| Cytochrome P450, family 82, subfamily C, polypeptide 4, putative 
[Theobroma cacao]
Length=514

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH+ L AMADK+GP+F IRLG  Q  VVS+S IAKE FT ND ++++R+K  A+E 
Sbjct  72   GPEQPHVTLGAMADKHGPVFMIRLGVHQAAVVSSSDIAKEIFTVNDMAVSSRSKMAAAEH  131

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +GYNY +F  +PYG +WR++RK  +LELLS  RI+ LR
Sbjct  132  LGYNYAMFGFSPYGQFWREMRKITMLELLSNHRIEKLR  169



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH+ L  MADKYGPIF IRLG  +  VVS+ ++AKECFTTND +++ R K +A E 
Sbjct  61   GSQLPHVTLGTMADKYGPIFTIRLGVHRALVVSSREVAKECFTTNDSAVSGRPKLVAPEH  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GYNY +FA +PY  YWR++RK V  ELLS RR++ L+  R
Sbjct  121  LGYNYAMFAFSPYDAYWREVRKIVNTELLSNRRLELLKDVR  161



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ LAAMADKYGP+F IRLG   + V+S+S+IAKECFTTND  L +R K    + 
Sbjct  54   GSTPPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIAKECFTTNDLVLNSRPKLAVVDH  113

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GYN  +F  AP GP+WR++RK   LELLS RR++ LR  R
Sbjct  114  IGYNCAMFGFAPSGPFWREMRKITTLELLSNRRLELLRHIR  154



>ref|XP_006366470.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=511

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH I+  MADKYGPIF ++LG  Q  VVS+ K+AKECFTTND +LA R K ++SEIMGY 
Sbjct  56   PHKIMGRMADKYGPIFGMKLGVHQVVVVSDHKLAKECFTTNDLALAGRPKLMSSEIMGYK  115

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
               F +  YGPYWR+ +K   +EL S RRI+ L+  R++
Sbjct  116  QAFFGLCSYGPYWRETKKIATIELFSTRRIEMLKHIRQF  154



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADKYGP F IRLG+++ FVVS+ ++AK+CFT ND++LA+R   +A++ MGYNY +F
Sbjct  63   LGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDCFTVNDRALASRPTTVAAKHMGYNYAVF  122

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR+D L+  R
Sbjct  123  GFAPYSPFWREMRKIATLELLSNRRLDMLKHVR  155



>ref|XP_004238200.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=519

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH  L+ MADKYGPIF ++LG  Q  VVS+ K+ KECFTTND +LA R K++ SEI+GY 
Sbjct  61   PHKTLSRMADKYGPIFGMKLGVHQVVVVSDPKLVKECFTTNDLALANRPKSMVSEIIGYK  120

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
              +F +  YGPYWR+ RK   +EL S RRI+ L+  RE+
Sbjct  121  DAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIREF  159



>ref|XP_002510312.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52499.1| cytochrome P450, putative [Ricinus communis]
Length=522

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH+IL  MADKYGPIF I++G  Q+  +S+ ++ KECFT NDK  A R   LA+E+MGYN
Sbjct  54   PHVILGNMADKYGPIFTIKMGVHQSLTISSWELVKECFTINDKIFANRPNFLAAELMGYN  113

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
              +F  +PYG YWRQ+RK   LELLS  R+ + +  RE
Sbjct  114  SAMFGFSPYGQYWRQMRKITTLELLSNHRLQTFKHVRE  151



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H++   MADKYGPIF I++G   T V SN ++AKECFTTNDK+ A R   LA ++
Sbjct  56   GPQPSHIVFGNMADKYGPIFTIKMGVHPTLVASNWEMAKECFTTNDKAFANRPNILAMDL  115

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GY  ++FA +PYG YWRQIRK   LELLS  R+      RE
Sbjct  116  LGYGRSMFAFSPYGNYWRQIRKISTLELLSNHRLQMFNHVRE  157



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PHL+   MADKYGP+F IRLG ++  VVS+ ++AKECFTT+D +LA+R + +A++ +GYN
Sbjct  61   PHLLFGTMADKYGPVFSIRLGXKRAVVVSSWEMAKECFTTHDLALASRPEVVAAKYLGYN  120

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            Y +FA +P+G YWR++RK   LELLS RR++ L+  R
Sbjct  121  YAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVR  157



>ref|XP_010064547.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=520

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H  LA++AD+ GPIF +R G  Q  VVS S+IAKECFT ND +++TR + LA EI+GY+Y
Sbjct  61   HKTLASLADQCGPIFNVRCGTFQALVVSGSEIAKECFTKNDIAVSTRPRYLAQEILGYSY  120

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
             +F  APYGPYWRQ+RK   LELLS RR+ SL
Sbjct  121  AMFPFAPYGPYWRQVRKMATLELLSSRRVKSL  152



>ref|XP_003634362.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PHL+   MADKYGP+F IRLG ++  VVS+ ++AKECFTT+D +LA+R + +A++ +GYN
Sbjct  61   PHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPQLVAAKYLGYN  120

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            Y++FA +P+G YWR++RK   LELLS RR++ L+  R
Sbjct  121  YSMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVR  157



>gb|KHN16363.1| Cytochrome P450 82A4 [Glycine soja]
Length=522

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G   PH  L  +ADKYGPIF I+LG ++  V+SN +IAKECFTTND  +++R K +A E
Sbjct  55   NGSDIPHRALGDLADKYGPIFTIKLGVKKALVISNWEIAKECFTTNDIFVSSRPKLVAVE  114

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
             MGYN  +   APYGPYWR++RK   LE+LS RR++ L+  R
Sbjct  115  YMGYNQAMLGFAPYGPYWRELRKVATLEILSNRRVEQLQDVR  156



>ref|XP_009336448.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IRLG   + V+S+S+IAKEC+TT D S+ +R K +  + 
Sbjct  57   GSTPPHITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECYTTKDLSVLSRPKMVVVDH  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + YNY +F   P GPYWR+IRK V LELLS R+++ L+  R
Sbjct  117  VSYNYAMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHVR  157



>gb|KCW60845.1| hypothetical protein EUGRSUZ_H03582 [Eucalyptus grandis]
Length=520

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            K PH  LA+MAD+ GPIF +R+G  Q  VVS S++ KECFT ND +L+TR + +A +I+G
Sbjct  58   KLPHKTLASMADQCGPIFTVRVGTFQALVVSGSEMVKECFTKNDIALSTRPRHVAQKILG  117

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            Y+Y +F  APYGPYWR++RK V LELLS RR+ S 
Sbjct  118  YSYAMFPFAPYGPYWREVRKMVTLELLSSRRVKSF  152



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L  MA+KYGPIF I++G  +  VVSN + AKECFTT+DK+ + R + LASE+
Sbjct  63   GAEPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGRPRTLASEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE
Sbjct  123  LTYDGAMVGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE  164



>gb|KJB63758.1| hypothetical protein B456_010G014400 [Gossypium raimondii]
Length=261

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKI-AKECFTTNDKSLATRTKALASE  185
            G +PP + LA MADKYG +F I+LG  +  VVS+ +I AKEC TTNDK+ A+R K  +SE
Sbjct  58   GPQPPQISLANMADKYGKMFTIKLGVHRALVVSDWEIIAKECLTTNDKAFASRPKLASSE  117

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            ++GYN  +F  APYGPYWR IRK   +ELLS  R+  L+  RE
Sbjct  118  LLGYNRAMFGFAPYGPYWRHIRKIATIELLSNHRLKLLKHVRE  160



>ref|XP_008220885.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=1017

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ LAAMADKYGP+F IRLG   + V+S+S+IAKECFTTND + ++R K +  E 
Sbjct  546  GSTPPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIAKECFTTNDLASSSRPKLVVVEH  605

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GYN+ +F  AP GP+WR++RK   L+LLS RR++ LR  R
Sbjct  606  VGYNHAMFGFAPSGPFWREMRKITTLKLLSNRRLELLRHIR  646


 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH+ LA++ DKYGP F I +G     V+S  ++AK+CFTTND  +++R   L ++ +GYN
Sbjct  73   PHIALASLVDKYGPAFTINIGIHSALVISTWEVAKDCFTTNDMVVSSRPATLGAKHLGYN  132

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + +F  +PYGPYWR++RK   LELLS RR++ L+  R
Sbjct  133  FAMFGFSPYGPYWREMRKLTSLELLSNRRLELLKKVR  169



>ref|XP_006464328.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=521

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +P H IL  MA+KYGPIF +++G  +  VVSNS+I KECFTTNDK+LA+R + +A EI
Sbjct  61   GPEPTHRILGNMANKYGPIFTMKMGVNRALVVSNSEITKECFTTNDKALASRPRRMAMEI  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +GYN+     +PYG YWR+ RK   +ELLS  R++ L+  RE
Sbjct  121  LGYNFLATPSSPYGSYWRETRKIATVELLSNHRLEKLKHVRE  162



>ref|XP_010092357.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB51033.1| Cytochrome P450 82A3 [Morus notabilis]
Length=534

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH+ LA +ADK GPIF +R+G+    VVS+S++AKECFT ND +LA+R   LA++ 
Sbjct  59   GSQLPHITLANLADKCGPIFTVRIGSHPGLVVSSSEMAKECFTINDLALASRPNLLAAKH  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            MGYNY +F +AP+GP+WR+IRK   ++LLS RR++ L+  R
Sbjct  119  MGYNYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIR  159



>ref|XP_004291927.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PP +IL AMADKYGP+F +RLG   T VVS+S++AKECFT +D + ++R K  A E+
Sbjct  58   GSTPPQIILGAMADKYGPLFTVRLGVYPTLVVSSSEVAKECFTIHDMAASSRPKMAAVEL  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GYNY +F + P GPYWR++RK   L+LLS R++  L+  R
Sbjct  118  IGYNYAMFGMGPSGPYWREVRKLATLKLLSNRQMQLLKDIR  158



>emb|CBI19610.3| unnamed protein product [Vitis vinifera]
Length=933

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH+ L  MADKYGPIF IRLG  +  VVS+ ++AKECFTTND +++ R K +A E 
Sbjct  500  GSQLPHVTLGTMADKYGPIFTIRLGVHRALVVSSREVAKECFTTNDSAVSGRPKLVAPEH  559

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GYNY +FA +PY  YWR++RK V  ELLS RR++ L+  R
Sbjct  560  LGYNYAMFAFSPYDAYWREVRKIVNTELLSNRRLELLKDVR  600



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L +MA+KYGPIF I++G  +  VVS  + AKECFTT+DK+ + R K LASE+
Sbjct  63   GAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSRWETAKECFTTHDKAFSGRPKTLASEL  122

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE
Sbjct  123  LTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDIRE  164



>ref|XP_010106080.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07350.1| Cytochrome P450 82A3 [Morus notabilis]
Length=641

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH  L  MADKYGPIF I++G  +  VVS+ ++AKE  TTNDK  A R+K +ASEI
Sbjct  106  GSQAPHRTLGHMADKYGPIFSIKVGVHRALVVSSWEMAKEFLTTNDKVFANRSKGIASEI  165

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + YNY +F  +PYG YWRQ+RK   LELLS  R++ L   RE
Sbjct  166  LAYNYAMFGFSPYGSYWRQVRKIATLELLSNNRLEILSHVRE  207



>gb|KJB63761.1| hypothetical protein B456_010G014700 [Gossypium raimondii]
Length=559

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYG IF I+LG  +  VVSN +IAKEC T NDK+ ATR K  +SE 
Sbjct  58   GPQPPHISLGNLADKYGRIFTIKLGLHRALVVSNWEIAKECLTINDKAFATRPKLTSSEH  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
             GYN  +   APYGPYWRQ+RK   +ELLS  R++ L+  RE
Sbjct  118  FGYNCAMIGFAPYGPYWRQVRKFSTIELLSNHRLELLKHVRE  159



>ref|XP_008343493.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=532

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +3

Query  3    STGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  182
            S+  +P HL+   +ADKYGPIF I+ G ++  VVS+S+IAK+CF TNDK  A+R K++A 
Sbjct  59   SSSTEPAHLLFGNLADKYGPIFTIKFGMKRAIVVSSSEIAKDCFKTNDKVFASRPKSIAG  118

Query  183  EIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            E++GYNY     +PYG Y+RQIRK   LE+LS  RI  L+  RE+
Sbjct  119  EVLGYNYAFLPFSPYGEYFRQIRKIATLEVLSQSRIGKLKHIREF  163



>ref|XP_003611841.1| Cytochrome P450 82A3 [Medicago truncatula]
 gb|AES94799.1| cytochrome P450 family protein [Medicago truncatula]
Length=320

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H  L  MADK+GPIF I+LG+ +  V+S+S++AKECFT +DK+ +TR    AS++MGYNY
Sbjct  63   HKTLGMMADKHGPIFTIKLGSYKVLVLSSSEMAKECFTLHDKTFSTRPLVAASKLMGYNY  122

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
             +F   PYGPYWR+IRK   LELLS  R++ L+  R
Sbjct  123  AMFGFTPYGPYWREIRKLATLELLSNHRLELLKDTR  158



>gb|KDP38436.1| hypothetical protein JCGZ_04361 [Jatropha curcas]
Length=503

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  MA+K GPI+ I+LG  +  +VS+ ++ KECFTTNDK+ A R KAL  ++
Sbjct  61   GSQPPHITLEKMAEKIGPIYSIKLGVHRALIVSSWEMVKECFTTNDKAFAYRPKALFLDV  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M Y+Y +F  +PYG YWR++RK   LELLS RR++ L+  RE
Sbjct  121  MSYDYAMFGASPYGDYWREMRKIATLELLSVRRLELLKHVRE  162



>ref|XP_003554125.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=525

 Score =   119 bits (297),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G + P  +L A+ADKYGPIF I  G ++  V+SN +IAKECFT ND  +++R K L  E
Sbjct  55   SGSETPDRVLGALADKYGPIFTINNGVKKVLVISNWEIAKECFTKNDIVVSSRPKLLGIE  114

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +M YN  +F  APYGPYWR++RK V LE+LS RR++ L   R
Sbjct  115  LMCYNQAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLENVR  156


 Score = 33.9 bits (76),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +2

Query  320  VRKSIKRMFEHWSDNKDAATGAVTVEMKQTFDR  418
            V+ SIK +F  WS NK+  +G   +E+KQ F +
Sbjct  160  VQSSIKELFNVWSSNKNNESGYALLELKQWFSQ  192



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PHL+   MADKYGP+F IRLG ++  VVS+ ++AKECFTT+D +LA+R + +A++ +GYN
Sbjct  61   PHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLGYN  120

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            Y +F ++P+G YWR++RK   LELLS RR++ L+  R
Sbjct  121  YAMFGLSPHGAYWREVRKIATLELLSNRRLELLKNVR  157



>gb|KDP38431.1| hypothetical protein JCGZ_04356 [Jatropha curcas]
Length=504

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  MA+K GPI+ I+LG  +  +VS+ ++ KECFTTNDK+ A R KAL  ++
Sbjct  61   GSQPPHITLEKMAEKIGPIYSIKLGVHRALIVSSWEMVKECFTTNDKAFAYRPKALFLDV  120

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            M Y+Y +F  +PYG YWR++RK   LELLS RR++ L+  RE
Sbjct  121  MSYDYAMFGASPYGDYWREMRKIATLELLSVRRLELLKHVRE  162



>ref|XP_003618361.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74579.1| cytochrome P450 family protein [Medicago truncatula]
Length=533

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH +L  +ADKYGP+F I+LG +   +++N ++AKECFTTND  +++R K +A+E 
Sbjct  58   GTQSPHRVLGTLADKYGPLFTIKLGTKHALILNNWEMAKECFTTNDTVVSSRPKLVATEH  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRI  290
            +GYN  +F +APYGPYWRQ+RK V LE+L+ RR+
Sbjct  118  LGYNGAMFGLAPYGPYWRQLRKIVTLEVLTNRRV  151



>ref|XP_006443548.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 gb|ESR56788.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=381

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G +P   IL A+ADKYGPI+ +RLG     +VS+ +I K+CFTTND+ LATR K +A +
Sbjct  55   NGQEPICKILGALADKYGPIYSLRLGKHPILIVSSWEIVKDCFTTNDRILATRAKIVAGK  114

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +MGY+  IFA+APYGPYWR IRK    ELLS  R++ L+  R
Sbjct  115  LMGYDNAIFALAPYGPYWRDIRKIATTELLSSHRLELLKHVR  156



>gb|KJB63757.1| hypothetical protein B456_010G014300 [Gossypium raimondii]
Length=526

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  MAD+YG +  I+LGA++  VVS+ +IAK+C T +DK+ ATR KA+A E+
Sbjct  58   GPQPPHISLGNMADQYGRMLTIKLGARRALVVSSWEIAKDCLTIHDKAFATRPKAVAQEL  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + YN+ + A APYGPYWRQ+RK   +ELLS  R++ L+  RE
Sbjct  118  LSYNHAMIATAPYGPYWRQMRKFATVELLSNHRLNLLKHVRE  159



>gb|KEH30997.1| cytochrome P450 family protein [Medicago truncatula]
Length=510

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYGPIF  R G  +T V+S+ ++AK+CFT ND++ A+R K++A EI
Sbjct  57   GSQPPHVTLGKLADKYGPIFTFRFGVHKTLVISSCEMAKQCFTVNDRAFASRPKSIAFEI  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +GYN+++   +PYG YWR +RK   + +LS  RID L+
Sbjct  117  LGYNFSMIGFSPYGSYWRTVRKISTIHVLSATRIDMLK  154



>ref|XP_007151144.1| hypothetical protein PHAVU_004G021500g [Phaseolus vulgaris]
 gb|ESW23138.1| hypothetical protein PHAVU_004G021500g [Phaseolus vulgaris]
Length=519

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +  K PH  L A+ADKYGPIF I+LGA+   V++N + AKECFTTND  +++R K +A+E
Sbjct  49   SASKRPHRTLGALADKYGPIFTIKLGAKSALVINNWETAKECFTTNDIVVSSRPKLVAAE  108

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
             M YN  +F VAPYGPYWR+IRK  V E+LS  R+  LR
Sbjct  109  HMSYNQAMFVVAPYGPYWRKIRKITVSEILSPLRVKQLR  147



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  12   GKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIM  191
             +P H   A MAD YGPIF +RLG     +VSN +IA+ECFTTNDK  A+R K +AS+++
Sbjct  61   NEPAHKTFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFASRPKLVASKLL  120

Query  192  GYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            GY+Y +F ++PYGP+WR +RK  +LELLS  R++ L+  R
Sbjct  121  GYDYAMFGLSPYGPHWRHVRKLAMLELLSNYRLEKLQHIR  160



>ref|XP_002510314.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52501.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G +PPH++L  MADK  PIF I++G  +T V+SN ++AKECFTTND++ A R   LA +
Sbjct  54   VGPQPPHIVLGNMADKCAPIFSIKMGVHRTLVLSNWEVAKECFTTNDRAFANRPNILAMD  113

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            ++GY  +IF  + YG YWRQIRK    ELLS  R+   +  RE+
Sbjct  114  LLGYGRSIFGFSSYGNYWRQIRKISTPELLSNHRLQMFKHVREF  157



>ref|XP_003554857.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=866

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G   PH  L  +ADKYGPIF I+LG ++  V+SN +IAKECFTTND  +++R K +A E
Sbjct  55   NGSHIPHRALGDLADKYGPIFTIKLGVKKALVISNWEIAKECFTTNDIFVSSRPKLVAVE  114

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
             MGYN  +   APYGPYWR++RK   LE+LS RR++ L+  R
Sbjct  115  YMGYNQAMLGFAPYGPYWRELRKVATLEILSNRRVEQLQDVR  156



>ref|XP_011042272.1| PREDICTED: cytochrome P450 82A4-like [Populus euphratica]
Length=318

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH +L +MA+KYGPIF I++G  +  VVSN + A ECFTT+DK+ + R K LASE+
Sbjct  51   GAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETA-ECFTTHDKAFSGRPKTLASEL  109

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            + Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE
Sbjct  110  LTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE  151



>ref|XP_003554118.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=548

 Score =   117 bits (294),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G + P  +L A+ADKYGPIF I  G ++  V+SN +IAKECFT ND  +++R K LA E
Sbjct  78   SGSETPDRVLGALADKYGPIFTINYGVKKALVISNWEIAKECFTKNDIVVSSRPKLLAIE  137

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +M YN  +F  APYGPYWR+ RK   LE+L+ RR++ L+  R
Sbjct  138  LMCYNQAMFGFAPYGPYWREQRKITTLEILTSRRVEQLQHVR  179


 Score = 33.9 bits (76),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +2

Query  320  VRKSIKRMFEHWSDNKDAATGAVTVEMKQTFDR  418
            V+ SIK +F  WS NK+  +G   +E+KQ F +
Sbjct  183  VQSSIKELFNVWSSNKNNESGYALLELKQWFSQ  215



>ref|XP_010060879.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW67757.1| hypothetical protein EUGRSUZ_F01492 [Eucalyptus grandis]
Length=536

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            K PH  LAAMAD++GPIF +RLG+  T V+S+S+IAKECFT +D +L++R  +L+SEI+G
Sbjct  61   KLPHKTLAAMADEFGPIFTLRLGSFPTMVLSSSEIAKECFTKHDLALSSRWPSLSSEILG  120

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            Y+  +F +AP  PYWR++RK   LELLS RRI SL
Sbjct  121  YDGALFGLAPCSPYWREVRKIATLELLSNRRIKSL  155



>ref|XP_010028535.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H ILA MAD+YGP F IRLG  +  VVSN ++AKECFT+ND+   TR ++L+ ++MGY++
Sbjct  62   HRILAVMADQYGPAFSIRLGILRVLVVSNWEVAKECFTSNDRVFPTRPRSLSIKLMGYDH  121

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
             +   APYGPYWR +RK  V+ELLS  R+DS +  R+
Sbjct  122  AMLGFAPYGPYWRGMRKLAVVELLSNHRLDSFKHVRD  158



>ref|XP_008388076.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=497

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPHL L AMADKYGPIF IRLG   + V+S+S+IAKECFTT D S+ +R + +  + 
Sbjct  57   GSIPPHLTLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECFTTKDLSIISRPRMVVLDH  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + Y+Y +F   P GP+WR+IRK V LELLS R+++ L+  R
Sbjct  117  VSYDYAMFGFGPGGPFWREIRKLVTLELLSVRKVELLKHIR  157



>ref|XP_006432705.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
 gb|ESR45945.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
Length=452

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MAD+YGPIF+I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+GYN+++F  +
Sbjct  1    MADEYGPIFKIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFS  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            PYG YWR+ RK   LELLS  R+  LR  REY
Sbjct  61   PYGSYWRETRKIATLELLSNHRLGKLRHVREY  92



>ref|XP_009336944.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+IL AMADKYGPIF IRLG   + V+S+S+ AKEC+TT D S+ +R K    + 
Sbjct  57   GSTPPHIILGAMADKYGPIFTIRLGFHPSLVISSSESAKECYTTKDLSVLSRPKMAVVDH  116

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + YNY +F   P GPYWR+IRK V LELLS R+++ L+  R
Sbjct  117  VSYNYAMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHIR  157



>sp|O49859.1|C82A4_SOYBN RecName: Full=Cytochrome P450 82A4; AltName: Full=Cytochrome 
P450 CP9 [Glycine max]
 emb|CAA71877.1| putative cytochrome P450 [Glycine max]
Length=525

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G K PH  L A+A+K+GP+F I+LGA++  VVS+ ++A+ECFTTND +++ R K L +E+
Sbjct  58   GSKSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEMARECFTTNDVAVSARPKLLVAEL  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            M YN  +  VAPYGPYWR++RK +V E+LS  R++ L+  R
Sbjct  118  MCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQDVR  158



>ref|XP_003517019.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=526

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G K PH  L A+A+K+GP+F I+LGA++  VVS+ ++A+ECFTTND +++ R K L +E+
Sbjct  58   GSKSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEMARECFTTNDVAVSARPKLLVAEL  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            M YN  +  VAPYGPYWR++RK +V E+LS  R++ L+  R
Sbjct  118  MCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQDVR  158



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            K PH  L  MADKYGPIF I LG ++  VVS+ ++AKEC+TTNDK  ATR ++LA ++MG
Sbjct  60   KLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECYTTNDKVFATRPRSLAVKLMG  119

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            Y++ +   APYGPYWR +RK  ++ELLS R+++ L+
Sbjct  120  YDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLK  155



>sp|H2DH23.1|C7H23_PANGI RecName: Full=Cytochrome P450 CYP82H23, partial [Panax ginseng]
 gb|AEY75220.1| cytochrome P450 CYP82H23, partial [Panax ginseng]
Length=245

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MADKYGPIF ++LG  +T VVS+  +AKECFTT+DK   TR K+LA + MGY++++F   
Sbjct  1    MADKYGPIFSLQLGIHKTIVVSSWAVAKECFTTHDKVFLTRPKSLAGKHMGYDHSVFLFL  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
             YGPYWR  RK +++ELLS RR+D L+  RE
Sbjct  61   AYGPYWRDTRKLLIVELLSNRRLDVLKHVRE  91



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADK+GP F IRLG++  FVVS+ ++ KECFT NDK+LA+R K  A++ MGY+Y +F
Sbjct  37   LGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGYDYAVF  96

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR+++L+  R
Sbjct  97   GFAPYTPFWREMRKIATLELLSNRRLEALKHVR  129



>emb|CAN81092.1| hypothetical protein VITISV_004720 [Vitis vinifera]
Length=496

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            K PH  L  MADKYGPIF I LG ++  VVS+ ++AKEC+TTNDK  ATR ++LA ++MG
Sbjct  60   KLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECYTTNDKVFATRPRSLAVKLMG  119

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            Y++ +   APYGPYWR +RK  ++ELLS R+++ L+
Sbjct  120  YDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLK  155



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMAD+YGP F IRLG++  FVVS+ ++AKECFT NDK+LA+R   +A++ MGYNY +F
Sbjct  65   LGAMADEYGPAFTIRLGSRCAFVVSSWELAKECFTINDKALASRPTTVAAKHMGYNYAVF  124

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR++ L+  R
Sbjct  125  GFAPYSPFWREMRKIATLELLSNRRLEMLKHVR  157



>gb|KHG16624.1| Cytochrome P450 [Gossypium arboreum]
Length=358

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +  H  L  MADKYGP+F +RLG+ +  V+++ ++AKECFT +DK  +TR    AS+I
Sbjct  55   GQQLTHKTLGGMADKYGPVFSLRLGSHEVLVLNSWEMAKECFTVHDKVFSTRPIITASKI  114

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GY++ +F  APYGPYWR+IRK   +ELLS  RID L+  R
Sbjct  115  LGYDFAMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIR  155



>gb|KJB43594.1| hypothetical protein B456_007G208800 [Gossypium raimondii]
Length=585

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +  H  L  MADKYGP+F +RLG+ +  V+++S++AKECFT +DK  +TR    AS+I
Sbjct  114  GQQLTHKTLGGMADKYGPVFSLRLGSHEVLVLNSSEMAKECFTVHDKVFSTRPIITASKI  173

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GY++ +F  APYGPYWR+IRK   +ELLS  RID L+  R
Sbjct  174  LGYDFAMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIR  214



>gb|KJB58366.1| hypothetical protein B456_009G207100 [Gossypium raimondii]
Length=525

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADK+GP F IRLGA++ FVVS+ ++ KECFT NDK+LA+R   +A++ MGYNY +F
Sbjct  63   LGAMADKHGPAFTIRLGARRAFVVSSWEVVKECFTINDKALASRPTTVAAKHMGYNYAVF  122

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR++ L+  R
Sbjct  123  GFAPYTPFWREMRKIATLELLSNRRLEMLKHVR  155



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADK+GP F IRLG++  FVVS+ ++ KECFT NDK+LA+R K  A++ MGY+Y +F
Sbjct  59   LGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGYDYAVF  118

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR+++L+  R
Sbjct  119  GFAPYTPFWREMRKIATLELLSNRRLEALKHVR  151



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADK+GP F IRLG++  FVVS+ ++ KECFT NDK+LA+R K  A++ MGY+Y +F
Sbjct  66   LGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGYDYAVF  125

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR+++L+  R
Sbjct  126  GFAPYTPFWREMRKIATLELLSNRRLEALKHVR  158



>ref|XP_002519132.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43343.1| cytochrome P450, putative [Ricinus communis]
Length=320

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +3

Query  3    STGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  182
            S   +  H  L +MAD+ GPIF IRLG  Q  V+SN ++AKECFT NDK   TR ++LA 
Sbjct  56   SDSNQLLHRTLGSMADELGPIFSIRLGVHQAVVISNWELAKECFTINDKVFQTRPESLAV  115

Query  183  EIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            +IMGY+  +F  APYG YWR +RK   +ELLS RR++ L+  R+
Sbjct  116  KIMGYDQVMFGFAPYGKYWRDVRKLATVELLSNRRLELLKHVRD  159



>gb|KEH30995.1| cytochrome P450 family protein [Medicago truncatula]
Length=376

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + P++ L  +ADKYG IF +RLG  +T VVS+ +IA++CFT NDK+ A+R K++A EI
Sbjct  62   GSQQPYITLGNLADKYGAIFTVRLGVHRTLVVSSWEIARQCFTVNDKAFASRPKSIAFEI  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            MGYN ++F ++PYG YWR +RK   + +LS +RID L+   E
Sbjct  122  MGYNSSMFGMSPYGSYWRTLRKIATVHVLSAQRIDMLKHVME  163



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PHL+   MADKYGP+F IRLG ++  VV++ ++AKECFTT+D +LA+R +  A++ +GYN
Sbjct  61   PHLLFGTMADKYGPVFSIRLGLKRAVVVNSWEMAKECFTTHDLALASRPEVEAAKYLGYN  120

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            Y +FA +P+G YWR++RK   LELLS RR++ L+  R
Sbjct  121  YAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVR  157



>ref|XP_009336429.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IRLG   + V+S+S+IAKEC+TT D S+ +R K +  + 
Sbjct  62   GSTPPHITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECYTTQDLSILSRPKMVVLDH  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + Y+Y +F   P GP+WR+IRK V LELLS R+++ L+  R
Sbjct  122  VSYDYAMFGFGPGGPFWREIRKLVTLELLSVRKVELLKHIR  162



>gb|KHN22283.1| Cytochrome P450 82C4 [Glycine soja]
Length=462

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MADKYGPIF +RLG  +T VVSN ++AK+CFT NDK+ A+R K++A E++GYN+++   +
Sbjct  1    MADKYGPIFTLRLGVHKTLVVSNWEMAKQCFTVNDKAFASRPKSVAFEVLGYNFSMIGFS  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            PYG YWR +RK   LELLS  RID ++   E
Sbjct  61   PYGSYWRHVRKIATLELLSSHRIDMIKHVME  91



>ref|XP_009364774.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  PPH+ L AMADKYGPIF IRLG   + V+S+S+IAKEC+TT D S+ +R K +  + 
Sbjct  62   GSTPPHITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECYTTQDLSILSRPKMVVLDH  121

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            + Y+Y +F   P GP+WR+IRK V LELLS R+++ L+  R
Sbjct  122  VSYDYAMFGFGPGGPFWREIRKLVTLELLSVRKVELLKHIR  162



>gb|KCW67755.1| hypothetical protein EUGRSUZ_F01490 [Eucalyptus grandis]
Length=476

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H  LA++AD+ GPIF +R G  Q  VVS S+IAKECFT ND +++TR + LA EI+GY+Y
Sbjct  61   HKTLASLADQCGPIFNVRCGTFQALVVSGSEIAKECFTKNDIAVSTRPRYLAQEILGYSY  120

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRI  290
             +F  APYGPYWRQ+RK   LELLS RR+
Sbjct  121  AMFPFAPYGPYWRQVRKMATLELLSSRRL  149



>gb|KDO40895.1| hypothetical protein CISIN_1g038677mg [Citrus sinensis]
Length=186

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MADKYGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA+EI+GYN+++F  +
Sbjct  1    MADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAAEILGYNFSMFGFS  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            PY  YWR+  K   LELLS  R++ L+  REY
Sbjct  61   PYDFYWRETHKIATLELLSNYRLEKLKHVREY  92



>ref|XP_002264464.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  P    L AMADK GP+F IRLG  +T VVSN + AKECFTTNDK  A+R  + A++I
Sbjct  56   GKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDKIFASRPNSSAAKI  115

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            +GYNY  FA AP+GPYWR++RK  +LE+LS RR+  L
Sbjct  116  LGYNYAAFAFAPHGPYWREMRKLSMLEILSTRRLGDL  152



>ref|XP_007151143.1| hypothetical protein PHAVU_004G021400g [Phaseolus vulgaris]
 gb|ESW23137.1| hypothetical protein PHAVU_004G021400g [Phaseolus vulgaris]
Length=520

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +G K PH  L A+ADKYGPIF I+LGA++  V++N +IAKECFTTND  +  R K ++ E
Sbjct  54   SGSKSPHRTLGALADKYGPIFTIKLGAKRAVVINNWEIAKECFTTNDTVVFGRPKLVSVE  113

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +M YN  +FA+APYGPYWR+IRK  + E+LS +++   R
Sbjct  114  LMSYNQAMFALAPYGPYWRKIRKLTISEILSPQQVRQQR  152



>emb|CDP15065.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADKYGP+F +RLG +QT VVS+ +  KECFTTNDK+ + R  +  +E +GYNY   
Sbjct  64   LGAMADKYGPVFSLRLGMRQTLVVSSWEAVKECFTTNDKAFSYRPPSSFNEYVGYNYAAI  123

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYT*EN  329
              APYGPYWR+IRK V+LELLS RR++ L+  R    EN
Sbjct  124  GFAPYGPYWREIRKIVMLELLSNRRLERLKHVRISEIEN  162



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PHL+   MADKYGP+F IRLG ++  VVS+ ++AKECFTT+D +LA+R + +A++ +GYN
Sbjct  589  PHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLGYN  648

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            Y +FA +P+G YWR++RK   LELLS RR++ L+  R
Sbjct  649  YAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVR  685


 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH+ L  MADKYGP+F IR+G  +  VVS+ ++AKEC T ND+  ++R + LAS+++GYN
Sbjct  62   PHITLGNMADKYGPVFTIRIGLHRAVVVSSWEMAKECSTANDQVSSSRPELLASKLLGYN  121

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            Y +F  +PYG YWR++RK + LELLS  R++ L+  R
Sbjct  122  YAMFGFSPYGSYWREMRKIISLELLSNSRLELLKDVR  158



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H  L AMADKYGP+F IRLG  +  V+S+S++A+ECFTT+D+  +TR    AS+I+GY++
Sbjct  63   HKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFTTHDRVFSTRPSVTASKILGYDF  122

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
             +F  APYG YWR++RK V +ELLS  R+D L+  R
Sbjct  123  AMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIR  158



>ref|XP_004147803.1| PREDICTED: cytochrome P450 82C4-like [Cucumis sativus]
Length=532

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  12   GKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIM  191
             +P H+  A MAD YGPIF +RLG     +VSN +IA+ECFTTNDK  A+R K +AS+++
Sbjct  61   NEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFASRPKLVASKLL  120

Query  192  GYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            GY+Y +  ++PYGP+WR +RK  +LELL+  R+  L+  R
Sbjct  121  GYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQHIR  160



>ref|XP_006443549.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 ref|XP_006479223.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
 gb|ESR56789.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=525

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
             G +P   IL A+ADKYGPI+ +RLG     +VS+ +I K+CFTTND+ LATR K +A +
Sbjct  55   NGQEPICKILGALADKYGPIYSLRLGKHPILIVSSWEIVKDCFTTNDRILATRAKIVAGK  114

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +MGY+  IFA+APYGPYWR IRK    ELLS  R++ L+  R
Sbjct  115  LMGYDNAIFALAPYGPYWRDIRKIATTELLSSHRLELLKHVR  156



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  P    L AMADK GP+F IRLG  +  VVSN + AKECFTTNDK  A+R  + AS+I
Sbjct  56   GKVPVFRTLGAMADKVGPVFVIRLGMYRALVVSNHEAAKECFTTNDKVFASRPSSSASKI  115

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            +GYNY  F +APYGP WR+IRK  +LE+LS RR+  L
Sbjct  116  LGYNYVAFGLAPYGPLWREIRKLCMLEILSTRRLSDL  152



>gb|KGN59914.1| hypothetical protein Csa_3G852630 [Cucumis sativus]
Length=538

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  12   GKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIM  191
             +P H+  A MAD YGPIF +RLG     +VSN +IA+ECFTTNDK  A+R K +AS+++
Sbjct  67   NEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFASRPKLVASKLL  126

Query  192  GYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            GY+Y +  ++PYGP+WR +RK  +LELL+  R+  L+  R
Sbjct  127  GYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQHIR  166



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  203
            H  L AMADKYGP+F IRLG  +  V+S+S++A+ECFTT+D+  +TR    AS+I+GY++
Sbjct  92   HKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFTTHDRVFSTRPSVTASKILGYDF  151

Query  204  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
             +F  APYG YWR++RK V +ELLS  R+D L+  R
Sbjct  152  AMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIR  187



>gb|KDO37275.1| hypothetical protein CISIN_1g012878mg [Citrus sinensis]
Length=454

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MADKYGPIF ++LG +Q  +VSN +IAKECFTTNDK+ A+R K +A E++ YN+++ + A
Sbjct  1    MADKYGPIFTMKLGVKQALMVSNWEIAKECFTTNDKAFASRPKTMAMELLEYNFSVISFA  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            PYG YWRQ  K   +ELLS  R++ L+  REY
Sbjct  61   PYGNYWRQSLKIATIELLSSHRLEKLKHVREY  92



>ref|XP_004154826.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Cucumis 
sativus]
Length=532

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  12   GKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIM  191
             +P H+  A MAD YGPIF +RLG     +VSN +IA+ECFTTNDK  A+R K +AS+++
Sbjct  61   NEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFASRPKLVASKLL  120

Query  192  GYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            GY+Y +  ++PYGP+WR +RK  +LELL+  R+  L+  R
Sbjct  121  GYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQHIR  160



>emb|CAN65890.1| hypothetical protein VITISV_018868 [Vitis vinifera]
Length=670

 Score =   120 bits (301),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  15   KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  194
            KP H    AMAD+YGPIF IRLG +   VVS+S++AKEC+TT DK+LATR ++LA ++MG
Sbjct  453  KPLHRTFGAMADEYGPIFSIRLGLRTALVVSSSEVAKECYTTKDKALATRPRSLAVKLMG  512

Query  195  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKRE  314
            Y++ +FA   +GPYWR +R+  ++ELLS R+ + L+  R+
Sbjct  513  YDHAMFAFERHGPYWRDVRRLAMVELLSNRQHEMLKHVRD  552


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  24   HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  182
            H  L  MADKYGPIF I LG ++  VVS  ++AKEC+TTNDK  A R+   +S
Sbjct  328  HQKLGDMADKYGPIFCIHLGFRKALVVSRWEVAKECYTTNDKREAMRSDTESS  380



>ref|XP_006435894.1| hypothetical protein CICLE_v10033457mg [Citrus clementina]
 gb|ESR49134.1| hypothetical protein CICLE_v10033457mg [Citrus clementina]
Length=454

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MADKYGPIF ++LG +Q  +VSN +IAKECFTTNDK+ A+R K +A E++ YN+++ + A
Sbjct  1    MADKYGPIFTMKLGVKQALMVSNWEIAKECFTTNDKAFASRPKTMAMELLEYNFSVISFA  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREY  317
            PYG YWRQ  K   +ELLS  R++ L+  REY
Sbjct  61   PYGNYWRQSLKIATIELLSSHRLEKLKHVREY  92



>gb|AFK38862.1| unknown [Lotus japonicus]
Length=534

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +PPH+ L  +ADKYGPIF +RLG  +T VVSN ++AKECFT NDK+ ATR K LA+EI
Sbjct  60   GSQPPHITLGNIADKYGPIFTLRLGVHRTLVVSNWEMAKECFTVNDKAFATRPKTLANEI  119

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
            +  N+  F   PYG YWR ++K   +E+LS +R + L+
Sbjct  120  VAKNF--FGFVPYGSYWRDVKKIATVEVLSAKRTEMLK  155



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L  MAD+YGP F I LG ++ FVVS+ ++AKECFTTNDK+LA+R   +A++ MGYNY +F
Sbjct  67   LGTMADQYGPAFNIWLGTRRAFVVSSWEVAKECFTTNDKALASRPTTVAAKHMGYNYAVF  126

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR++ L+  R
Sbjct  127  GFAPYSPFWREMRKIATLELLSNRRLEMLKHVR  159



>gb|KJB43593.1| hypothetical protein B456_007G208700 [Gossypium raimondii]
Length=525

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G +  H  L  MADKYGP+F +RLG+ +  V+++ ++AKECFT +DK  +TR    AS+I
Sbjct  55   GQQLTHKTLGGMADKYGPVFSLRLGSHEVLVLNSWEMAKECFTVHDKVFSTRPSITASKI  114

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GY++ +F  APYGPYWR+IRK   +ELLS  RID L+  R
Sbjct  115  LGYDFAMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIR  155



>emb|CAN65652.1| hypothetical protein VITISV_016780 [Vitis vinifera]
Length=473

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  P    L AMADK GP+F IRLG  +T VVSN + AKECFTTNDK  A+R  + A++I
Sbjct  56   GKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDKIFASRPNSSAAKI  115

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRI  290
            +GYNY  FA AP+GPYWR++RK  +LE+LS RR+
Sbjct  116  LGYNYAAFAFAPHGPYWREMRKXSMLEILSTRRL  149



>ref|XP_011025653.1| PREDICTED: cytochrome P450 CYP82H23-like [Populus euphratica]
Length=324

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +3

Query  9    GGKP-PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            GGK   H IL AMADKYGP+F I+LG+ +  VV++ ++A++CFT +D++ ++R    AS+
Sbjct  58   GGKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCFTVHDRAFSSRPSIAASK  117

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            ++GY+  +F  APYGPYWR++RK   +ELLS  RID LR  R
Sbjct  118  LLGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIR  159



>gb|KHN44000.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G K PH  L A+A+K+GP+F I+LG ++  VVS+ ++A+ECFTTND +++ R K L +E+
Sbjct  58   GSKSPHKALGALAEKHGPLFTIKLGVKKALVVSDWEMARECFTTNDVAVSARPKLLVAEL  117

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            M YN  +  VAPYGPYWR++RK +V E+LS  R++ L+  R
Sbjct  118  MCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQDVR  158



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMADKYG  F IRLG+++ FVVS+ ++AKECFT NDK+LA+R   +A++ MGYNY +F
Sbjct  53   LGAMADKYGSAFNIRLGSRRAFVVSSWEVAKECFTFNDKALASRPTTVAAKHMGYNYAVF  112

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   +ELLS RR++ L+  R
Sbjct  113  GFAPYSPFWREMRKIATIELLSNRRLEMLKHVR  145



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMAD YGP F IRLG+++ FVV++  +AK+CFT NDK+LA+R   +A++ MGYNY +F
Sbjct  68   LGAMADNYGPAFNIRLGSRRAFVVNSWDVAKDCFTANDKALASRPTTVAAKHMGYNYAVF  127

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
              APY P+WR++RK   LELLS RR++ L+  R
Sbjct  128  GFAPYSPFWREMRKIATLELLSNRRLEMLKHVR  160



>ref|XP_007151142.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
 gb|ESW23136.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
Length=519

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
            +  K PH  L A+ADKYGPIF I+LGA++  V++N + AKECFTTND  +++R K +A+E
Sbjct  49   SASKSPHRTLGALADKYGPIFTIKLGAKKALVINNWETAKECFTTNDIVVSSRPKLVAAE  108

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYT*ENPSNACSN  350
             M YN  +FA+AP GPYW++IRK  V E+LS +R+  LR   E   E      SN
Sbjct  109  HMSYNKAMFALAPCGPYWQKIRKITVSEILSPQRVKQLRHVFESEVEESIKELSN  163



>ref|XP_004489342.1| PREDICTED: cytochrome P450 82A1-like [Cicer arietinum]
Length=539

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PH  L A+ADKYGPIF I+LGA+   V+SN ++AKECFT ND  +++R K +A E+M YN
Sbjct  59   PHKTLGALADKYGPIFTIKLGAKHALVLSNWELAKECFTKNDTVVSSRPKPIAVELMSYN  118

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
                  APYG YWRQ+RK V LE+LS RRI+ L
Sbjct  119  QAFIGWAPYGTYWRQLRKIVTLEILSNRRIELL  151



>emb|CAN74206.1| hypothetical protein VITISV_031128 [Vitis vinifera]
Length=284

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MADKYGP+F IRLG  +  VVS+ ++AKEC TTND++ ++R + LAS+ +GYNY +F  +
Sbjct  1    MADKYGPVFTIRLGVHRALVVSSWEMAKECLTTNDQAASSRPELLASKHLGYNYAMFGFS  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            PYG YWR++RK + LELLS RR++ L+  R
Sbjct  61   PYGSYWREVRKIISLELLSNRRLELLKDVR  90



>emb|CBI29738.3| unnamed protein product [Vitis vinifera]
Length=727

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G  P    L AMADK GP+F IRLG  +T VVSN + AKECFTTNDK  A+R  + A++I
Sbjct  56   GKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDKIFASRPNSSAAKI  115

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSL  299
            +GYNY  FA AP+GPYWR++RK  +LE+LS RR+  L
Sbjct  116  LGYNYAAFAFAPHGPYWREMRKLSMLEILSTRRLGDL  152



>gb|KHN22284.1| Cytochrome P450 82A3 [Glycine soja]
Length=452

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  42   MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  221
            MADKYGP+F +RLGA +T VVSN ++AK+CFT NDK+ A+R K+++ E++GYNY++    
Sbjct  1    MADKYGPVFTLRLGAHKTLVVSNWEMAKQCFTVNDKAFASRPKSVSFELLGYNYSMIGFI  60

Query  222  PYGPYWRQIRKTVVLELLSGRRIDSLR  302
            PYG YWR +RK + LELLS   ID L+
Sbjct  61   PYGSYWRHVRKIITLELLSTHCIDMLK  87



>ref|XP_010106082.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07352.1| Cytochrome P450 82A3 [Morus notabilis]
Length=532

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  9    GGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  188
            G + PH+ LA +ADK+GPIF IR+G+ +  VVS+S++AKECFT ND + A+R   LA++ 
Sbjct  59   GSQLPHITLANLADKWGPIFTIRIGSYRGLVVSSSEMAKECFTINDLASASRPNLLAAKH  118

Query  189  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            +GY Y +F +AP+GP+WR+IRK   ++LLS RR++ L+  R
Sbjct  119  LGYKYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIR  159



>ref|XP_004252778.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=527

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  33   LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  212
            L AMAD YGP F +RLG ++ FVVS+ ++AKECFT NDK+LA+R   +A++ MGY Y +F
Sbjct  59   LGAMADNYGPAFNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVF  118

Query  213  AVAPYGPYWRQIRKTVVLELLSGRRIDSLR  302
              APY P+WR++RK  + ELLS RR+D+L+
Sbjct  119  GFAPYSPFWREMRKIAMFELLSNRRLDTLK  148



>ref|XP_004154825.1| PREDICTED: cytochrome P450 82C4-like isoform 2 [Cucumis sativus]
Length=242

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    TGGKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASE  185
               +P H+ LA MAD YGPIF  R G ++  +VSN +IAKECFTTND+  A+R K LAS+
Sbjct  54   NASEPIHITLAKMADVYGPIFTFRFGTKRALIVSNWEIAKECFTTNDRIFASRPKQLASK  113

Query  186  IMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            ++ Y+Y + A +PY P+WR +RK  +L L + +RI+ L   R
Sbjct  114  LLAYDYAMMAFSPYNPHWRYVRKLAMLGLFTNQRIEQLEHVR  155



>emb|CAN76287.1| hypothetical protein VITISV_027433 [Vitis vinifera]
Length=538

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  21   PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  200
            PHL+   MADKYGP+F IRLG ++   VS+ ++AKECFTT+D +LA+R + +A++ +GYN
Sbjct  50   PHLLFGTMADKYGPVFSIRLGLKRAVXVSSWEMAKECFTTHDLALASRPZLVAAKYLGYN  109

Query  201  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKR  311
            Y +F  +P+G YWR++RK   LELLS RR++ L+  R
Sbjct  110  YXMFXXSPHGAYWREVRKIATLELLSNRRLELLKNVR  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780