BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF038B15

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339396.1|  PREDICTED: basic 7S globulin-like                  186   1e-52   Solanum tuberosum [potatoes]
ref|XP_009611838.1|  PREDICTED: basic 7S globulin-like                  181   1e-50   Nicotiana tomentosiformis
ref|XP_004229435.1|  PREDICTED: basic 7S globulin-like                  179   5e-50   Solanum lycopersicum
ref|XP_011090791.1|  PREDICTED: basic 7S globulin                       146   2e-37   Sesamum indicum [beniseed]
emb|CDO98999.1|  unnamed protein product                                133   1e-32   Coffea canephora [robusta coffee]
gb|KJB46995.1|  hypothetical protein B456_008G005100                    125   6e-30   Gossypium raimondii
ref|XP_003518926.1|  PREDICTED: basic 7S globulin                       124   1e-29   Glycine max [soybeans]
ref|XP_011020124.1|  PREDICTED: basic 7S globulin-like                  124   1e-29   Populus euphratica
ref|XP_010255900.1|  PREDICTED: basic 7S globulin 2-like                124   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008390829.1|  PREDICTED: basic 7S globulin-like                  124   2e-29   Malus domestica [apple tree]
ref|XP_002308984.2|  hypothetical protein POPTR_0006s06820g             122   8e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009342182.1|  PREDICTED: basic 7S globulin 2-like                121   9e-29   
ref|XP_002520766.1|  conserved hypothetical protein                     119   2e-28   
ref|XP_007144622.1|  hypothetical protein PHAVU_007G170900g             120   3e-28   Phaseolus vulgaris [French bean]
ref|XP_011026191.1|  PREDICTED: basic 7S globulin-like                  120   3e-28   Populus euphratica
ref|XP_002302122.1|  hypothetical protein POPTR_0002s05580g             120   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006419833.1|  hypothetical protein CICLE_v10006689mg             120   6e-28   Citrus clementina [clementine]
ref|XP_011082548.1|  PREDICTED: basic 7S globulin-like                  119   7e-28   Sesamum indicum [beniseed]
emb|CAN80378.1|  hypothetical protein VITISV_038701                     119   9e-28   Vitis vinifera
ref|XP_002272235.1|  PREDICTED: basic 7S globulin                       119   9e-28   Vitis vinifera
ref|XP_006489581.1|  PREDICTED: basic 7S globulin-like                  119   1e-27   
gb|AAP84703.1|  putative xyloglucanase inhibitor                        118   2e-27   Solanum tuberosum [potatoes]
ref|XP_003590665.1|  Xyloglucan-specific endoglucanase inhibitor ...    118   2e-27   Medicago truncatula
gb|ADD71503.1|  xyloglucanase inhibitor 1                               118   2e-27   Humulus lupulus [common hop]
ref|XP_010278291.1|  PREDICTED: basic 7S globulin-like                  118   2e-27   Nelumbo nucifera [Indian lotus]
gb|AFK46427.1|  unknown                                                 118   2e-27   Medicago truncatula
gb|KJB23117.1|  hypothetical protein B456_004G081800                    118   3e-27   Gossypium raimondii
ref|NP_001234746.1|  xyloglucan-specific fungal endoglucanase inh...    117   4e-27   
gb|EYU38145.1|  hypothetical protein MIMGU_mgv1a006647mg                117   4e-27   Erythranthe guttata [common monkey flower]
ref|NP_001234249.1|  xyloglucan-specific fungal endoglucanase inh...    117   4e-27   
gb|KDO74788.1|  hypothetical protein CISIN_1g036132mg                   117   5e-27   Citrus sinensis [apfelsine]
gb|ACM68431.1|  xyloglucan-specific endoglucanase inhibitor protein     117   7e-27   Capsicum annuum
gb|EYU41534.1|  hypothetical protein MIMGU_mgv1a008121mg                116   8e-27   Erythranthe guttata [common monkey flower]
gb|KDP40112.1|  hypothetical protein JCGZ_02110                         115   2e-26   Jatropha curcas
ref|XP_009356759.1|  PREDICTED: basic 7S globulin                       115   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_002517163.1|  basic 7S globulin 2 precursor small subunit,...    115   3e-26   
ref|XP_009773897.1|  PREDICTED: basic 7S globulin-like                  114   4e-26   Nicotiana sylvestris
ref|XP_004495219.1|  PREDICTED: basic 7S globulin-like                  114   5e-26   Cicer arietinum [garbanzo]
gb|KDP21480.1|  hypothetical protein JCGZ_21951                         114   8e-26   Jatropha curcas
gb|AIL30493.1|  xyloglucan-specific fungal endoglucanase inhibito...    114   8e-26   Nicotiana tabacum [American tobacco]
gb|KDP25943.1|  hypothetical protein JCGZ_22848                         113   9e-26   Jatropha curcas
ref|XP_008222987.1|  PREDICTED: basic 7S globulin-like                  113   9e-26   Prunus mume [ume]
ref|XP_008235257.1|  PREDICTED: basic 7S globulin 2-like                114   9e-26   Prunus mume [ume]
ref|XP_009757289.1|  PREDICTED: basic 7S globulin-like                  113   9e-26   Nicotiana sylvestris
ref|XP_010038107.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    113   1e-25   
gb|ADG23123.1|  xyloglucan specific endoglucanase inhibitor             113   1e-25   Solanum melongena [aubergine]
ref|XP_007222421.1|  hypothetical protein PRUPE_ppa006071mg             113   1e-25   
ref|XP_004290668.1|  PREDICTED: basic 7S globulin 2-like                112   2e-25   Fragaria vesca subsp. vesca
ref|XP_008355568.1|  PREDICTED: basic 7S globulin-like                  112   2e-25   Malus domestica [apple tree]
dbj|BAA03413.1|  EDGP precursor                                         112   2e-25   Daucus carota [carrots]
ref|XP_002517162.1|  basic 7S globulin 2 precursor small subunit,...    112   3e-25   Ricinus communis
ref|XP_009595035.1|  PREDICTED: basic 7S globulin-like                  112   3e-25   Nicotiana tomentosiformis
ref|XP_002277699.1|  PREDICTED: basic 7S globulin-like                  112   4e-25   Vitis vinifera
ref|XP_010038106.1|  PREDICTED: basic 7S globulin 2-like                111   4e-25   Eucalyptus grandis [rose gum]
gb|KDP40108.1|  hypothetical protein JCGZ_02106                         111   5e-25   Jatropha curcas
ref|XP_002280508.1|  PREDICTED: basic 7S globulin                       111   6e-25   Vitis vinifera
ref|XP_007034629.1|  Eukaryotic aspartyl protease family protein ...    111   6e-25   
ref|XP_004495218.1|  PREDICTED: basic 7S globulin 2-like                111   6e-25   Cicer arietinum [garbanzo]
ref|XP_002517164.1|  basic 7S globulin 2 precursor small subunit,...    111   7e-25   Ricinus communis
ref|XP_011462765.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    111   7e-25   Fragaria vesca subsp. vesca
dbj|BAK57511.1|  extracellular dermal glycoprotein                      111   7e-25   Nicotiana benthamiana
ref|XP_006345120.1|  PREDICTED: basic 7S globulin-like                  110   8e-25   Solanum tuberosum [potatoes]
ref|XP_010522713.1|  PREDICTED: basic 7S globulin-like                  110   8e-25   Tarenaya hassleriana [spider flower]
gb|AAX81588.1|  nectarin IV                                             110   9e-25   Nicotiana langsdorffii x Nicotiana sanderae
emb|CAN61502.1|  hypothetical protein VITISV_011733                     110   1e-24   Vitis vinifera
ref|XP_004229433.1|  PREDICTED: basic 7S globulin-like                  110   2e-24   Solanum lycopersicum
ref|XP_002311834.1|  hypothetical protein POPTR_0008s20730g             110   2e-24   Populus trichocarpa [western balsam poplar]
gb|KCW49914.1|  hypothetical protein EUGRSUZ_K03381                     109   3e-24   Eucalyptus grandis [rose gum]
gb|ACM68432.1|  xyloglucanase-specific endoglucanase inhibitor pr...    108   5e-24   Petunia x hybrida [garden petunia]
ref|XP_002517165.1|  basic 7S globulin 2 precursor small subunit,...    108   5e-24   Ricinus communis
gb|KDO74795.1|  hypothetical protein CISIN_1g037976mg                   108   5e-24   Citrus sinensis [apfelsine]
pdb|3VLB|A  Chain A, Crystal Structure Of Xeg-edgp                      108   6e-24   Aspergillus aculeatus
ref|XP_006489309.1|  PREDICTED: basic 7S globulin-like                  108   6e-24   Citrus sinensis [apfelsine]
emb|CDO98879.1|  unnamed protein product                                108   6e-24   Coffea canephora [robusta coffee]
pdb|3VLA|A  Chain A, Crystal Structure Of Edgp                          107   8e-24   Daucus carota [carrots]
ref|XP_011014389.1|  PREDICTED: basic 7S globulin-like                  108   9e-24   Populus euphratica
ref|XP_006345119.1|  PREDICTED: basic 7S globulin-like                  107   1e-23   Solanum tuberosum [potatoes]
gb|KDO74789.1|  hypothetical protein CISIN_1g014679mg                   107   1e-23   Citrus sinensis [apfelsine]
ref|XP_006419822.1|  hypothetical protein CICLE_v10007187mg             107   1e-23   Citrus clementina [clementine]
ref|XP_007201544.1|  hypothetical protein PRUPE_ppa017430mg             107   2e-23   
ref|XP_009611839.1|  PREDICTED: basic 7S globulin-like                  107   2e-23   Nicotiana tomentosiformis
ref|XP_006489578.1|  PREDICTED: basic 7S globulin-like                  107   2e-23   Citrus sinensis [apfelsine]
gb|ADD71505.1|  xyloglucanase inhibitor 3                               106   3e-23   Humulus lupulus [common hop]
gb|KCW84283.1|  hypothetical protein EUGRSUZ_B01135                     106   3e-23   Eucalyptus grandis [rose gum]
ref|XP_010035593.1|  PREDICTED: basic 7S globulin-like                  106   4e-23   Eucalyptus grandis [rose gum]
ref|XP_007143872.1|  hypothetical protein PHAVU_007G109000g             106   4e-23   Phaseolus vulgaris [French bean]
ref|XP_007034626.1|  Eukaryotic aspartyl protease family protein,...    105   4e-23   
ref|XP_006419831.1|  hypothetical protein CICLE_v10006962mg             105   5e-23   Citrus clementina [clementine]
ref|XP_006419832.1|  hypothetical protein CICLE_v10005038mg             105   5e-23   Citrus clementina [clementine]
ref|XP_006489313.1|  PREDICTED: basic 7S globulin-like                  105   6e-23   Citrus sinensis [apfelsine]
ref|XP_003590668.1|  Basic 7S globulin                                  105   8e-23   Medicago truncatula
gb|KJB70565.1|  hypothetical protein B456_011G080800                    105   9e-23   Gossypium raimondii
ref|XP_006419823.1|  hypothetical protein CICLE_v10005035mg             104   1e-22   Citrus clementina [clementine]
ref|XP_006489307.1|  PREDICTED: basic 7S globulin-like                  104   1e-22   Citrus sinensis [apfelsine]
ref|XP_004236054.1|  PREDICTED: basic 7S globulin-like                  104   2e-22   Solanum lycopersicum
gb|AFK42416.1|  unknown                                                 104   2e-22   Lotus japonicus
gb|KCW49915.1|  hypothetical protein EUGRSUZ_K03382                     103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_008222998.1|  PREDICTED: basic 7S globulin 2                     103   2e-22   Prunus mume [ume]
ref|XP_010256207.1|  PREDICTED: basic 7S globulin 2-like                103   3e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009591595.1|  PREDICTED: basic 7S globulin-like                  103   3e-22   
ref|XP_010556788.1|  PREDICTED: basic 7S globulin-like                  103   3e-22   Tarenaya hassleriana [spider flower]
ref|XP_003591797.1|  Xyloglucan-specific endoglucanase inhibitor ...    103   4e-22   Medicago truncatula
ref|XP_006419809.1|  hypothetical protein CICLE_v10004993mg             103   5e-22   Citrus clementina [clementine]
ref|XP_006419811.1|  hypothetical protein CICLE_v10004995mg             102   6e-22   
ref|XP_006489297.1|  PREDICTED: basic 7S globulin-like                  102   6e-22   
ref|XP_006419826.1|  hypothetical protein CICLE_v10006501mg             102   7e-22   
gb|ADD71504.1|  xyloglucanase inhibitor 2                               102   7e-22   Humulus lupulus [common hop]
gb|AES60912.2|  xyloglucanase-specific endoglucanase inhibitor pr...    102   8e-22   Medicago truncatula
emb|CBI32364.3|  unnamed protein product                                102   9e-22   Vitis vinifera
gb|KDP40110.1|  hypothetical protein JCGZ_02108                         102   9e-22   Jatropha curcas
ref|XP_007224886.1|  hypothetical protein PRUPE_ppa022337mg             102   1e-21   
ref|XP_004229432.1|  PREDICTED: basic 7S globulin-like                  102   1e-21   Solanum lycopersicum
ref|XP_006489306.1|  PREDICTED: basic 7S globulin-like                  101   1e-21   Citrus sinensis [apfelsine]
ref|XP_003590661.1|  Basic 7S globulin                                  102   1e-21   
ref|XP_003556387.1|  PREDICTED: basic 7S globulin                       101   2e-21   Glycine max [soybeans]
ref|XP_011015096.1|  PREDICTED: basic 7S globulin-like isoform X1       101   2e-21   Populus euphratica
ref|XP_010667343.1|  PREDICTED: basic 7S globulin-like                  101   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006419821.1|  hypothetical protein CICLE_v10005127mg             100   2e-21   Citrus clementina [clementine]
ref|XP_003536212.1|  PREDICTED: basic 7S globulin-like                  101   2e-21   Glycine max [soybeans]
gb|KDO74797.1|  hypothetical protein CISIN_1g044303mg                   100   2e-21   Citrus sinensis [apfelsine]
gb|KHN30567.1|  Basic 7S globulin                                       101   2e-21   Glycine soja [wild soybean]
ref|XP_006489308.1|  PREDICTED: basic 7S globulin-like                  100   3e-21   Citrus sinensis [apfelsine]
ref|XP_004229434.1|  PREDICTED: basic 7S globulin-like                  100   3e-21   Solanum lycopersicum
ref|XP_004134152.1|  PREDICTED: basic 7S globulin-like                  100   3e-21   Cucumis sativus [cucumbers]
ref|XP_010522709.1|  PREDICTED: basic 7S globulin-like                  100   3e-21   
gb|KDO74801.1|  hypothetical protein CISIN_1g040581mg                   100   5e-21   Citrus sinensis [apfelsine]
ref|XP_010111673.1|  Basic 7S globulin                                  100   5e-21   Morus notabilis
ref|XP_010255899.1|  PREDICTED: basic 7S globulin-like                  100   5e-21   Nelumbo nucifera [Indian lotus]
ref|XP_011011196.1|  PREDICTED: basic 7S globulin-like isoform X1       100   6e-21   Populus euphratica
ref|XP_011090790.1|  PREDICTED: basic 7S globulin-like                  100   6e-21   Sesamum indicum [beniseed]
ref|XP_006429864.1|  hypothetical protein CICLE_v10013399mg           99.0    7e-21   
ref|XP_006380060.1|  hypothetical protein POPTR_0008s20740g           99.8    8e-21   
ref|XP_006489295.1|  PREDICTED: basic 7S globulin-like                99.8    8e-21   Citrus sinensis [apfelsine]
emb|CBI26189.3|  unnamed protein product                              98.2    9e-21   Vitis vinifera
ref|XP_006419808.1|  hypothetical protein CICLE_v10006987mg           99.4    9e-21   Citrus clementina [clementine]
ref|XP_010938774.1|  PREDICTED: basic 7S globulin-like                99.4    1e-20   Elaeis guineensis
ref|XP_006489296.1|  PREDICTED: basic 7S globulin-like                99.4    1e-20   Citrus sinensis [apfelsine]
gb|KDO74796.1|  hypothetical protein CISIN_1g038219mg                 99.0    1e-20   Citrus sinensis [apfelsine]
ref|XP_006349245.1|  PREDICTED: basic 7S globulin-like                98.6    2e-20   Solanum tuberosum [potatoes]
ref|XP_006850763.1|  hypothetical protein AMTR_s00025p00079140        98.6    2e-20   Amborella trichopoda
ref|XP_006419827.1|  hypothetical protein CICLE_v10005000mg           98.2    2e-20   Citrus clementina [clementine]
ref|XP_009597883.1|  PREDICTED: basic 7S globulin-like                97.8    4e-20   Nicotiana tomentosiformis
gb|KJB61114.1|  hypothetical protein B456_009G341600                  97.1    5e-20   Gossypium raimondii
ref|XP_002517173.1|  pepsin A, putative                               97.4    6e-20   
ref|XP_002517171.1|  basic 7S globulin 2 precursor small subunit,...  97.1    6e-20   Ricinus communis
ref|XP_004170542.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  97.1    8e-20   
ref|XP_004134153.1|  PREDICTED: basic 7S globulin-like                97.1    8e-20   Cucumis sativus [cucumbers]
ref|XP_006387875.1|  hypothetical protein POPTR_0509s00200g           96.3    1e-19   
ref|XP_009411762.1|  PREDICTED: basic 7S globulin-like                96.7    1e-19   
ref|XP_008810759.1|  PREDICTED: basic 7S globulin-like                96.3    1e-19   
ref|XP_009111159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  96.3    1e-19   Brassica rapa
ref|XP_011015097.1|  PREDICTED: basic 7S globulin-like isoform X2     95.9    2e-19   Populus euphratica
ref|XP_008438715.1|  PREDICTED: basic 7S globulin-like                95.9    2e-19   Cucumis melo [Oriental melon]
emb|CDP10858.1|  unnamed protein product                              95.5    3e-19   Coffea canephora [robusta coffee]
gb|KDO74790.1|  hypothetical protein CISIN_1g035972mg                 94.4    3e-19   Citrus sinensis [apfelsine]
gb|KFK42683.1|  hypothetical protein AALP_AA1G026300                  97.4    3e-19   Arabis alpina [alpine rockcress]
ref|XP_006349243.1|  PREDICTED: basic 7S globulin-like                95.1    4e-19   
ref|XP_006349244.1|  PREDICTED: basic 7S globulin-like                94.7    4e-19   Solanum tuberosum [potatoes]
gb|EAZ44805.1|  hypothetical protein OsJ_29439                        94.7    6e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011011197.1|  PREDICTED: basic 7S globulin-like isoform X2     94.4    6e-19   Populus euphratica
gb|KDP40109.1|  hypothetical protein JCGZ_02107                       94.0    6e-19   Jatropha curcas
ref|NP_001274964.1|  xyloglucan-specific endoglucanase inhibitor ...  94.4    6e-19   Solanum tuberosum [potatoes]
dbj|BAD33624.1|  putative dermal glycoprotein precursor, extracel...  94.4    7e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010039912.1|  PREDICTED: basic 7S globulin-like                94.4    7e-19   Eucalyptus grandis [rose gum]
ref|XP_009590387.1|  PREDICTED: basic 7S globulin 2-like              92.8    9e-19   Nicotiana tomentosiformis
ref|XP_003568479.1|  PREDICTED: basic 7S globulin-like                93.6    1e-18   Brachypodium distachyon [annual false brome]
ref|NP_171821.1|  aspartyl protease-like protein                      93.2    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654379.1|  PREDICTED: basic 7S globulin-like                92.8    2e-18   
gb|AAM61574.1|  EDGP precursor                                        92.8    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364261.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  92.4    3e-18   Pyrus x bretschneideri [bai li]
ref|NP_001174419.1|  Os05g0403000                                     92.4    3e-18   
dbj|BAJ94733.1|  predicted protein                                    92.0    4e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006419825.1|  hypothetical protein CICLE_v10007108mg           91.7    4e-18   
ref|XP_002284868.1|  PREDICTED: basic 7S globulin-like                92.0    5e-18   Vitis vinifera
emb|CAN68736.1|  hypothetical protein VITISV_030193                   91.7    6e-18   Vitis vinifera
ref|XP_004229564.1|  PREDICTED: basic 7S globulin-like                91.7    7e-18   Solanum lycopersicum
ref|XP_004298169.1|  PREDICTED: basic 7S globulin-like                91.3    7e-18   Fragaria vesca subsp. vesca
ref|XP_006304586.1|  hypothetical protein CARUB_v10011636mg           91.3    7e-18   Capsella rubella
ref|XP_007034627.1|  Eukaryotic aspartyl protease family protein,...  91.7    8e-18   
ref|XP_010457449.1|  PREDICTED: basic 7S globulin-like                91.3    9e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008340919.1|  PREDICTED: basic 7S globulin                     90.9    9e-18   
ref|XP_010475063.1|  PREDICTED: basic 7S globulin-like                90.9    1e-17   Camelina sativa [gold-of-pleasure]
gb|KDO74798.1|  hypothetical protein CISIN_1g029782mg                 88.2    1e-17   Citrus sinensis [apfelsine]
ref|XP_009118711.1|  PREDICTED: basic 7S globulin-like                90.5    1e-17   Brassica rapa
ref|XP_010483190.1|  PREDICTED: basic 7S globulin-like                90.5    1e-17   Camelina sativa [gold-of-pleasure]
emb|CDY37436.1|  BnaC08g45740D                                        89.0    1e-17   Brassica napus [oilseed rape]
ref|XP_003626314.1|  Basic 7S globulin                                90.5    2e-17   Medicago truncatula
gb|EAY97993.1|  hypothetical protein OsI_19910                        88.2    2e-17   Oryza sativa Indica Group [Indian rice]
emb|CBI26188.3|  unnamed protein product                              89.7    2e-17   Vitis vinifera
gb|EEC84612.1|  hypothetical protein OsI_31447                        91.3    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002889446.1|  EDGP precursor                                   90.1    2e-17   
ref|XP_006654380.1|  PREDICTED: basic 7S globulin-like                90.1    2e-17   Oryza brachyantha
emb|CDY32500.1|  BnaA09g50960D                                        89.7    3e-17   Brassica napus [oilseed rape]
gb|KDO70938.1|  hypothetical protein CISIN_1g041364mg                 88.2    3e-17   Citrus sinensis [apfelsine]
gb|KHN03449.1|  Basic 7S globulin                                     89.4    3e-17   Glycine soja [wild soybean]
ref|XP_003550008.2|  PREDICTED: basic 7S globulin 2-like              89.4    3e-17   
ref|XP_006296506.1|  hypothetical protein CARUB_v10025694mg           89.4    4e-17   Capsella rubella
ref|XP_008649625.1|  PREDICTED: basic 7S globulin-like                89.4    4e-17   Zea mays [maize]
gb|EPS72958.1|  hypothetical protein M569_01796                       89.0    5e-17   Genlisea aurea
ref|NP_001055497.1|  Os05g0403300                                     89.0    6e-17   
ref|XP_008438716.1|  PREDICTED: basic 7S globulin-like isoform X1     88.6    6e-17   
ref|XP_008222995.1|  PREDICTED: basic 7S globulin-like                88.6    8e-17   Prunus mume [ume]
ref|NP_001055496.1|  Os05g0402900                                     88.6    8e-17   
ref|XP_008246503.1|  PREDICTED: basic 7S globulin-like                87.8    1e-16   Prunus mume [ume]
gb|EYU20619.1|  hypothetical protein MIMGU_mgv1a026442mg              87.8    1e-16   Erythranthe guttata [common monkey flower]
gb|KCW84282.1|  hypothetical protein EUGRSUZ_B01133                   87.8    2e-16   Eucalyptus grandis [rose gum]
gb|EAY97992.1|  hypothetical protein OsI_19909                        87.8    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010045852.1|  PREDICTED: basic 7S globulin-like                87.8    2e-16   Eucalyptus grandis [rose gum]
ref|XP_004495384.1|  PREDICTED: basic 7S globulin-like                87.4    2e-16   Cicer arietinum [garbanzo]
gb|KHN03053.1|  Basic 7S globulin                                     87.0    2e-16   Glycine soja [wild soybean]
ref|NP_001239980.1|  uncharacterized protein LOC100806719 precursor   87.0    2e-16   Glycine max [soybeans]
ref|XP_010035585.1|  PREDICTED: basic 7S globulin                     87.0    2e-16   Eucalyptus grandis [rose gum]
ref|XP_009625013.1|  PREDICTED: basic 7S globulin-like                87.0    3e-16   
gb|KEH36784.1|  xyloglucanase-specific endoglucanase inhibitor pr...  87.0    3e-16   Medicago truncatula
ref|XP_006418255.1|  hypothetical protein EUTSA_v10007672mg           86.7    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_006654378.1|  PREDICTED: basic 7S globulin-like                86.7    3e-16   Oryza brachyantha
emb|CAN68737.1|  hypothetical protein VITISV_030194                   86.7    4e-16   Vitis vinifera
ref|XP_010659830.1|  PREDICTED: basic 7S globulin-like                86.7    4e-16   
ref|XP_011091050.1|  PREDICTED: basic 7S globulin 2-like              85.9    4e-16   Sesamum indicum [beniseed]
ref|XP_009342159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  86.3    5e-16   Pyrus x bretschneideri [bai li]
ref|XP_007205231.1|  hypothetical protein PRUPE_ppa006032mg           85.9    5e-16   Prunus persica
ref|XP_004962140.1|  PREDICTED: basic 7S globulin-like                85.9    6e-16   Setaria italica
ref|XP_004486304.1|  PREDICTED: basic 7S globulin 2-like              85.9    6e-16   Cicer arietinum [garbanzo]
ref|XP_009342158.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  85.5    7e-16   Pyrus x bretschneideri [bai li]
ref|XP_004494958.1|  PREDICTED: basic 7S globulin 2-like              85.5    8e-16   Cicer arietinum [garbanzo]
ref|XP_002517167.1|  basic 7S globulin 2 precursor small subunit,...  85.5    8e-16   Ricinus communis
ref|XP_010481702.1|  PREDICTED: basic 7S globulin-like                85.5    8e-16   Camelina sativa [gold-of-pleasure]
ref|XP_007224945.1|  hypothetical protein PRUPE_ppa021451mg           85.5    1e-15   Prunus persica
ref|XP_010457326.1|  PREDICTED: basic 7S globulin-like                84.7    1e-15   
ref|XP_008438718.1|  PREDICTED: basic 7S globulin-like                84.3    2e-15   Cucumis melo [Oriental melon]
ref|XP_006844967.1|  hypothetical protein AMTR_s00058p00179910        84.3    2e-15   Amborella trichopoda
gb|KFK42681.1|  hypothetical protein AALP_AA1G026100                  84.3    2e-15   Arabis alpina [alpine rockcress]
ref|XP_008458562.1|  PREDICTED: basic 7S globulin-like                83.6    3e-15   Cucumis melo [Oriental melon]
gb|AAB03390.1|  7S seed globulin precursor                            83.2    5e-15   Glycine max [soybeans]
gb|EYU20618.1|  hypothetical protein MIMGU_mgv1a018279mg              83.2    5e-15   Erythranthe guttata [common monkey flower]
pdb|3AUP|A  Chain A, Crystal Structure Of Basic 7s Globulin From ...  82.8    6e-15   Glycine max [soybeans]
gb|EYU20615.1|  hypothetical protein MIMGU_mgv1a006692mg              82.8    7e-15   Erythranthe guttata [common monkey flower]
ref|XP_004134154.1|  PREDICTED: basic 7S globulin-like                82.8    8e-15   Cucumis sativus [cucumbers]
emb|CAA34489.1|  unnamed protein product                              82.8    8e-15   Glycine max [soybeans]
ref|XP_003521716.1|  PREDICTED: basic 7S globulin                     82.8    8e-15   
ref|XP_004233956.1|  PREDICTED: basic 7S globulin-like                82.4    1e-14   Solanum lycopersicum
ref|XP_004170412.1|  PREDICTED: basic 7S globulin-like                82.0    1e-14   
ref|NP_563679.1|  aspartyl protease-like protein                      82.0    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004151001.1|  PREDICTED: basic 7S globulin-like                82.0    1e-14   Cucumis sativus [cucumbers]
pdb|4PPH|A  Chain A, Crystal Structure Of Conglutin Gamma, A Uniq...  82.0    1e-14   Lupinus angustifolius
ref|XP_010278299.1|  PREDICTED: basic 7S globulin-like                82.0    1e-14   Nelumbo nucifera [Indian lotus]
gb|AAB53771.1|  conglutin gamma                                       82.0    1e-14   Lupinus angustifolius
emb|CDX86682.1|  BnaC08g00210D                                        82.0    1e-14   
ref|XP_002517174.1|  conserved hypothetical protein                   81.6    2e-14   Ricinus communis
ref|XP_011099700.1|  PREDICTED: basic 7S globulin-like                81.6    2e-14   
emb|CDP19874.1|  unnamed protein product                              81.3    2e-14   Coffea canephora [robusta coffee]
ref|XP_002877156.1|  hypothetical protein ARALYDRAFT_484681           81.3    2e-14   
ref|XP_007154121.1|  hypothetical protein PHAVU_003G092100g           80.9    3e-14   Phaseolus vulgaris [French bean]
gb|EYU20620.1|  hypothetical protein MIMGU_mgv1a006733mg              80.5    4e-14   Erythranthe guttata [common monkey flower]
ref|XP_010474940.1|  PREDICTED: basic 7S globulin-like                80.5    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004246189.2|  PREDICTED: basic 7S globulin-like                80.5    5e-14   Solanum lycopersicum
ref|XP_009349976.1|  PREDICTED: basic 7S globulin-like                80.5    5e-14   Pyrus x bretschneideri [bai li]
gb|KDP40115.1|  hypothetical protein JCGZ_02113                       80.1    6e-14   Jatropha curcas
emb|CAC16394.1|  conglutin gamma                                      80.1    6e-14   Lupinus albus
ref|XP_009373976.1|  PREDICTED: basic 7S globulin-like                80.1    6e-14   Pyrus x bretschneideri [bai li]
gb|EYU41536.1|  hypothetical protein MIMGU_mgv1a024772mg              79.7    7e-14   Erythranthe guttata [common monkey flower]
emb|CDY15456.1|  BnaA08g27400D                                        79.7    7e-14   Brassica napus [oilseed rape]
gb|EYU41535.1|  hypothetical protein MIMGU_mgv1a007318mg              79.3    9e-14   Erythranthe guttata [common monkey flower]
ref|XP_006349246.1|  PREDICTED: basic 7S globulin-like                79.3    1e-13   Solanum tuberosum [potatoes]
gb|AGT17598.1|  xyloglucan-specific endoglucanase inhibitor 11        79.3    1e-13   Solanum tuberosum [potatoes]
ref|XP_011091047.1|  PREDICTED: basic 7S globulin 2-like              79.0    1e-13   Sesamum indicum [beniseed]
ref|XP_010255898.1|  PREDICTED: basic 7S globulin-like                79.0    1e-13   
emb|CDX88901.1|  BnaA03g07480D                                        78.6    1e-13   
ref|XP_008366845.1|  PREDICTED: basic 7S globulin-like                79.0    2e-13   
ref|NP_001237167.1|  basic 7S globulin 2 precursor                    78.6    2e-13   Glycine max [soybeans]
ref|XP_006850764.1|  hypothetical protein AMTR_s00025p00079520        78.2    2e-13   
ref|XP_009786807.1|  PREDICTED: basic 7S globulin-like                78.2    3e-13   Nicotiana sylvestris
ref|XP_011091048.1|  PREDICTED: basic 7S globulin-like                77.8    4e-13   Sesamum indicum [beniseed]
ref|XP_007147069.1|  hypothetical protein PHAVU_006G093600g           77.4    5e-13   Phaseolus vulgaris [French bean]
gb|AEB33720.1|  conglutin gamma 2                                     77.4    5e-13   Lupinus angustifolius
ref|XP_010086743.1|  Basic 7S globulin                                77.4    5e-13   
ref|XP_010693887.1|  PREDICTED: basic 7S globulin-like                77.0    6e-13   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX70865.1|  BnaC03g09490D                                        77.0    6e-13   
ref|NP_197413.1|  aspartyl protease family protein                    76.6    6e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99306.1|  conglutin gamma - like protein                       76.6    6e-13   
gb|KDO59528.1|  hypothetical protein CISIN_1g0364391mg                75.1    9e-13   
ref|XP_009596039.1|  PREDICTED: basic 7S globulin-like                76.6    9e-13   
gb|AAT85211.1|  hypothetical protein                                  76.6    9e-13   
gb|KCW84284.1|  hypothetical protein EUGRSUZ_B01136                   76.3    1e-12   
ref|XP_002439768.1|  hypothetical protein SORBIDRAFT_09g019770        76.3    1e-12   
ref|XP_006400469.1|  hypothetical protein EUTSA_v10013774mg           75.9    1e-12   
gb|ACU20443.1|  unknown                                               74.3    1e-12   
gb|EYU20616.1|  hypothetical protein MIMGU_mgv1a026206mg              76.3    1e-12   
ref|XP_011091049.1|  PREDICTED: basic 7S globulin 2-like              75.9    1e-12   
gb|EEE63673.1|  hypothetical protein OsJ_18491                        75.9    2e-12   
emb|CDP03611.1|  unnamed protein product                              72.8    2e-12   
ref|XP_004246190.2|  PREDICTED: basic 7S globulin-like                75.5    2e-12   
emb|CAC17729.2|  conglutin gamma                                      75.5    3e-12   
ref|XP_009111160.1|  PREDICTED: basic 7S globulin-like                75.1    3e-12   
ref|XP_002517175.1|  pepsin A, putative                               74.7    5e-12   
ref|XP_009615960.1|  PREDICTED: basic 7S globulin-like                74.3    5e-12   
ref|XP_009769391.1|  PREDICTED: basic 7S globulin-like                74.3    5e-12   
gb|KFK26154.1|  hypothetical protein AALP_AA8G210500                  73.9    6e-12   
ref|XP_010546839.1|  PREDICTED: basic 7S globulin                     73.2    1e-11   
ref|XP_010420702.1|  PREDICTED: basic 7S globulin 2-like              73.2    1e-11   
ref|XP_003546133.1|  PREDICTED: basic 7S globulin                     73.2    1e-11   
gb|KCW45639.1|  hypothetical protein EUGRSUZ_L005901                  70.1    2e-11   
emb|CDY15455.1|  BnaA08g27390D                                        72.4    2e-11   
emb|CDY59021.1|  BnaCnng34100D                                        72.4    2e-11   
ref|XP_009760543.1|  PREDICTED: basic 7S globulin-like                72.4    2e-11   
ref|XP_009120915.1|  PREDICTED: basic 7S globulin 2                   72.0    2e-11   
ref|XP_010242827.1|  PREDICTED: basic 7S globulin-like                72.0    3e-11   
gb|KFK42682.1|  hypothetical protein AALP_AA1G026200                  72.0    3e-11   
ref|XP_004305011.1|  PREDICTED: basic 7S globulin-like                71.6    4e-11   
emb|CDX92553.1|  BnaA10g15920D                                        70.9    6e-11   
ref|XP_010454178.1|  PREDICTED: basic 7S globulin 2-like              70.9    7e-11   
ref|XP_006352950.1|  PREDICTED: basic 7S globulin-like                70.9    8e-11   
ref|XP_003542884.1|  PREDICTED: basic 7S globulin                     70.5    1e-10   
gb|ACU24232.1|  unknown                                               70.5    1e-10   
ref|XP_007154122.1|  hypothetical protein PHAVU_003G092200g           70.1    1e-10   
ref|XP_003637703.1|  Basic 7S globulin                                70.1    2e-10   
gb|KDP21481.1|  hypothetical protein JCGZ_21952                       70.1    2e-10   
gb|AFK34779.1|  unknown                                               69.7    2e-10   
ref|XP_006346986.1|  PREDICTED: basic 7S globulin-like                70.1    2e-10   
ref|XP_010045855.1|  PREDICTED: basic 7S globulin-like                69.3    2e-10   
ref|XP_006349239.1|  PREDICTED: basic 7S globulin-like                68.9    3e-10   
ref|XP_008363982.1|  PREDICTED: basic 7S globulin-like                68.9    3e-10   
ref|XP_002871863.1|  pepsin A                                         68.6    3e-10   
ref|XP_006289450.1|  hypothetical protein CARUB_v10002965mg           68.6    4e-10   
ref|XP_002272199.2|  PREDICTED: basic 7S globulin 2-like              68.6    4e-10   
gb|KJB45207.1|  hypothetical protein B456_007G295400                  68.6    5e-10   
ref|XP_009613161.1|  PREDICTED: basic 7S globulin-like                68.2    6e-10   
emb|CDY13979.1|  BnaC09g38470D                                        67.8    7e-10   
ref|NP_001241217.1|  uncharacterized protein LOC100818868 precursor   67.8    8e-10   
ref|XP_006361904.1|  PREDICTED: basic 7S globulin-like                67.8    8e-10   
gb|KHN43271.1|  Basic 7S globulin 2                                   67.0    1e-09   
gb|AER26945.1|  xyloglucan-specific endoglucanase inhibitor 9         67.4    1e-09   
ref|XP_007147764.1|  hypothetical protein PHAVU_006G153200g           67.4    1e-09   
ref|XP_010677554.1|  PREDICTED: basic 7S globulin-like                67.0    2e-09   
ref|XP_010024400.1|  PREDICTED: basic 7S globulin 2-like              66.6    2e-09   
ref|XP_010676965.1|  PREDICTED: basic 7S globulin 2-like              66.6    2e-09   
ref|XP_010322595.1|  PREDICTED: basic 7S globulin-like isoform X1     66.2    3e-09   
ref|XP_006433276.1|  hypothetical protein CICLE_v10003944mg           65.9    3e-09   
ref|XP_007030900.1|  Eukaryotic aspartyl protease family protein,...  65.9    3e-09   
ref|XP_010694712.1|  PREDICTED: basic 7S globulin-like                65.5    4e-09   
ref|XP_010325564.1|  PREDICTED: basic 7S globulin-like                65.9    4e-09   
gb|KEH36785.1|  eukaryotic aspartyl protease family protein           65.5    5e-09   
ref|XP_010492960.1|  PREDICTED: basic 7S globulin 2-like              65.5    5e-09   
gb|AHG54973.1|  xyloglucan-specific endoglucanase inhibitor 10        65.1    6e-09   
ref|XP_010322603.1|  PREDICTED: basic 7S globulin-like isoform X2     65.1    6e-09   
gb|EPS64749.1|  hypothetical protein M569_10034                       65.1    6e-09   
gb|KJB25917.1|  hypothetical protein B456_004G215700                  65.1    7e-09   
gb|KJB26454.1|  hypothetical protein B456_004G242400                  65.1    7e-09   
ref|XP_011078750.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  64.7    9e-09   
ref|XP_004231264.1|  PREDICTED: basic 7S globulin-like                64.3    1e-08   
gb|KJB26455.1|  hypothetical protein B456_004G242500                  63.9    1e-08   
gb|KDP40113.1|  hypothetical protein JCGZ_02111                       63.9    2e-08   
gb|EYU22657.1|  hypothetical protein MIMGU_mgv1a022346mg              63.5    2e-08   
gb|EEE63670.1|  hypothetical protein OsJ_18488                        63.2    2e-08   
ref|XP_004508379.1|  PREDICTED: basic 7S globulin-like                62.8    4e-08   
gb|EYU22654.1|  hypothetical protein MIMGU_mgv1a026561mg              62.0    6e-08   
gb|AFF60302.1|  xyloglucanase-specific endoglucanase inhibitor        62.0    8e-08   
emb|CBI37209.3|  unnamed protein product                              60.1    1e-07   
ref|XP_004486144.1|  PREDICTED: basic 7S globulin-like                61.2    1e-07   
ref|NP_001274908.1|  xyloglucan-specific endoglucanase inhibitor ...  60.1    3e-07   
gb|EEE63672.1|  hypothetical protein OsJ_18490                        59.7    4e-07   
gb|KDO74800.1|  hypothetical protein CISIN_1g036447mg                 59.3    4e-07   
ref|XP_007050654.1|  Eukaryotic aspartyl protease family protein,...  59.7    4e-07   
ref|XP_003520561.1|  PREDICTED: basic 7S globulin-like                58.9    7e-07   
gb|KCW60850.1|  hypothetical protein EUGRSUZ_H03588                   58.9    8e-07   
gb|AFK42891.1|  unknown                                               58.9    8e-07   
gb|ACJ84219.1|  unknown                                               58.2    8e-07   
dbj|BAJ98298.1|  predicted protein                                    58.9    8e-07   
ref|XP_006349257.1|  PREDICTED: basic 7S globulin-like                58.9    9e-07   
ref|XP_009597882.1|  PREDICTED: basic 7S globulin-like                58.5    9e-07   
gb|KCW60844.1|  hypothetical protein EUGRSUZ_H03581                   58.5    1e-06   
gb|KCW60847.1|  hypothetical protein EUGRSUZ_H03585                   57.8    2e-06   
ref|XP_010024401.1|  PREDICTED: basic 7S globulin 2-like              57.8    2e-06   
ref|XP_010026985.1|  PREDICTED: basic 7S globulin-like                57.8    2e-06   
gb|KCW60840.1|  hypothetical protein EUGRSUZ_H03578                   57.4    2e-06   
ref|XP_004229430.1|  PREDICTED: basic 7S globulin-like                57.4    3e-06   
gb|KEH36787.1|  extracellular dermal glycoprotein                     57.4    3e-06   
gb|ADX66725.1|  xyloglucan-specific endoglucanase inhibitor prote...  57.4    3e-06   
emb|CDY72428.1|  BnaUnng05140D                                        54.7    3e-06   
ref|XP_006645300.1|  PREDICTED: basic 7S globulin 2-like              56.6    4e-06   
ref|XP_004229431.1|  PREDICTED: basic 7S globulin-like                56.6    4e-06   
ref|XP_009126299.1|  PREDICTED: basic 7S globulin 2-like              56.6    4e-06   
ref|XP_006349258.1|  PREDICTED: basic 7S globulin-like                56.6    5e-06   
ref|XP_006349240.1|  PREDICTED: basic 7S globulin-like                56.6    5e-06   
ref|NP_001274881.1|  xyloglucan-specific endoglucanase inhibitor 8    56.2    6e-06   
ref|XP_004229562.1|  PREDICTED: basic 7S globulin-like                56.2    6e-06   
ref|XP_006371346.1|  hypothetical protein POPTR_0019s09300g           56.2    6e-06   
ref|XP_009790668.1|  PREDICTED: basic 7S globulin-like                53.9    7e-06   
ref|XP_007034624.1|  Eukaryotic aspartyl protease family protein,...  55.8    7e-06   
ref|XP_006371344.1|  hypothetical protein POPTR_0019s09280g           55.8    8e-06   
ref|XP_007162407.1|  hypothetical protein PHAVU_001G149500g           55.8    9e-06   
ref|XP_006388043.1|  hypothetical protein POPTR_0382s00210g           55.1    1e-05   
ref|XP_006371348.1|  hypothetical protein POPTR_0019s09320g           55.1    1e-05   
emb|CDX83218.1|  BnaA03g22880D                                        55.1    1e-05   
dbj|BAJ98089.1|  predicted protein                                    55.1    2e-05   
ref|XP_010524795.1|  PREDICTED: basic 7S globulin-like                54.7    2e-05   
ref|XP_006371347.1|  hypothetical protein POPTR_0019s09310g           54.7    2e-05   
ref|XP_010524799.1|  PREDICTED: basic 7S globulin-like                54.7    2e-05   
ref|XP_003542883.1|  PREDICTED: basic 7S globulin-like                54.3    3e-05   
gb|KHN37577.1|  Basic 7S globulin                                     54.3    3e-05   
emb|CDY47198.1|  BnaAnng08680D                                        54.3    3e-05   
ref|XP_007034630.1|  Eukaryotic aspartyl protease family protein ...  53.9    3e-05   
gb|KHN04011.1|  Basic 7S globulin                                     53.5    4e-05   
gb|AEG74550.1|  xyloglucan specific endoglucanase inhibitor           53.5    5e-05   
gb|AFH67006.1|  xyloglucan-specific endo-beta-1,4-glucanase inhib...  53.5    6e-05   
emb|CDX86683.1|  BnaC08g00200D                                        52.0    6e-05   
ref|XP_007147760.1|  hypothetical protein PHAVU_006G152800g           53.1    8e-05   
gb|AED02502.1|  xyloglucan-specific endoglucanase inhibitor           52.8    8e-05   
ref|XP_006850766.1|  hypothetical protein AMTR_s00025p00080690        52.8    9e-05   
ref|XP_010026235.1|  PREDICTED: basic 7S globulin-like                52.8    1e-04   
gb|ABU55395.1|  xylanase inhibitor 602OS                              52.4    1e-04   
ref|XP_009414183.1|  PREDICTED: basic 7S globulin 2-like              52.4    1e-04   
ref|XP_006419829.1|  hypothetical protein CICLE_v100071811mg          52.0    1e-04   
gb|ACJ83356.1|  unknown                                               51.6    1e-04   
ref|XP_010524797.1|  PREDICTED: basic 7S globulin-like                52.0    2e-04   
emb|CDY21504.1|  BnaC03g26930D                                        51.6    2e-04   
ref|XP_010999511.1|  PREDICTED: basic 7S globulin-like                51.6    2e-04   
gb|EEE55968.1|  hypothetical protein OsJ_04697                        52.0    3e-04   
gb|KCW58887.1|  hypothetical protein EUGRSUZ_H01513                   51.2    3e-04   
ref|XP_009133965.1|  PREDICTED: basic 7S globulin-like                51.2    3e-04   
gb|KEH36786.1|  extracellular dermal glycoprotein                     50.8    4e-04   
ref|XP_010524796.1|  PREDICTED: basic 7S globulin-like                50.8    4e-04   
ref|XP_007147763.1|  hypothetical protein PHAVU_006G153100g           50.4    5e-04   
gb|KEH36774.1|  eukaryotic aspartyl protease family protein           50.4    6e-04   
gb|KEH36779.1|  extracellular dermal glycoprotein                     50.1    7e-04   
ref|XP_006369525.1|  hypothetical protein POPTR_0001s24740g           50.1    7e-04   
gb|KHN22268.1|  Basic 7S globulin 2                                   50.1    8e-04   
gb|KDP40111.1|  hypothetical protein JCGZ_02109                       49.7    9e-04   
ref|XP_003527698.1|  PREDICTED: basic 7S globulin 2                   50.1    9e-04   
emb|CDP03610.1|  unnamed protein product                              49.7    0.001   



>ref|XP_006339396.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=416

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 136/189 (72%), Gaps = 7/189 (4%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYN-LAPLKLVVDVGGPFLWADWA---  321
            + S++  PF P+AI++PV+KD  T QYV QL MG N LAP+KLVV++GG FLWAD     
Sbjct  18   SFSVSHGPFLPKAIILPVNKDPSTFQYVTQLYMGANHLAPIKLVVNLGGSFLWADCGLTS  77

Query  322  -SSSQGSIPCGSLKCSMANPKGCTS-NEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
             SSSQ  +PC SLKCSMA P GCT+ N+IC L+ ENP +++A +G L ED  AVE IDE 
Sbjct  78   DSSSQKLVPCNSLKCSMAKPNGCTNDNKICGLKSENPFTRLAATGELAEDMFAVEFIDEL  137

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
              GS  S +  FLFS   S L QGL  G  G+LGLGNSRI+LPSQL++TFG  RK A+CL
Sbjct  138  KTGSVAS-IHQFLFSCTSSTLLQGLARGAKGMLGLGNSRIALPSQLSDTFGFQRKFAICL  196

Query  676  SSSNGAIIS  702
            SSSNGAIIS
Sbjct  197  SSSNGAIIS  205



>ref|XP_009611838.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=420

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 130/185 (70%), Gaps = 6/185 (3%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA----SS  327
            S++  PF P+AI++PV+KD  T QYV Q+ MG +L P  LVVD+GG FLW +      SS
Sbjct  21   SVSHGPFLPKAIILPVNKDLSTFQYVTQVYMGAHLVPTNLVVDLGGSFLWTNCGLTSVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  507
            SQ  +PC SLKCSMA P GCT N+IC +Q ENP +K+A +G L ED  AVE IDE   GS
Sbjct  81   SQKLVPCNSLKCSMAKPNGCT-NKICGVQSENPFTKVAATGELAEDMFAVEFIDELKTGS  139

Query  508  FLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSN  687
              S +  FLFS   + L QGL  G  G+LGLGNSRI+LPS+L++TFG  RK A+CLSSSN
Sbjct  140  IAS-IHEFLFSCASTTLLQGLARGAKGMLGLGNSRIALPSKLSDTFGFQRKFALCLSSSN  198

Query  688  GAIIS  702
            GAIIS
Sbjct  199  GAIIS  203



>ref|XP_004229435.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=417

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 132/186 (71%), Gaps = 7/186 (4%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMG-YNLAPLKLVVDVGGPFLWADWA----SS  327
            ++  PF P+AI++PV+KD  T QYV QL MG  + AP+KLVVD+ G FLWAD      SS
Sbjct  21   VSHGPFLPKAIILPVNKDPSTFQYVTQLYMGATHRAPIKLVVDLEGSFLWADCGLTSDSS  80

Query  328  SQGSIPCGSLKCSMANPKGCTS-NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  504
            SQ  +PC SLKCSMA P GCT+ N+IC L+ ENP +++A +G L ED  AVE IDE   G
Sbjct  81   SQKLVPCNSLKCSMAKPNGCTNDNKICGLKSENPFTRLAATGELAEDMFAVEFIDELKTG  140

Query  505  SFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
            S  S +  FLFS   S L QGL  G  G+LGLGNSRI+LPSQL++TFG  RK A+CLSSS
Sbjct  141  SVAS-IHQFLFSCTSSTLLQGLARGAKGMLGLGNSRIALPSQLSDTFGFQRKFAICLSSS  199

Query  685  NGAIIS  702
            NGAIIS
Sbjct  200  NGAIIS  205



>ref|XP_011090791.1| PREDICTED: basic 7S globulin [Sesamum indicum]
Length=417

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 15/193 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADW----ASS  327
            S++Q P  P+A +IPV+KDF T QYVA + +G NLAP+KLVVD+ GPF+W D      S+
Sbjct  20   SVSQNPILPKAGIIPVTKDFSTLQYVADVLVGENLAPVKLVVDLNGPFVWVDCEVHSVSA  79

Query  328  SQGSIPCGSLKCSMANP-KGCT--------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
            SQ  +   SLKCSMA P  GC+         ++IC LQ EN +++M+ S  LKED +A+E
Sbjct  80   SQQPVESCSLKCSMAKPISGCSRPGGGAVHDSKICTLQAENTIARMSTSVELKEDRMAIE  139

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG-IPR  657
              D   +GSF +    FLFS  P+ L +GL NG  G+LGLGNSRIS PSQ ++TFG   R
Sbjct  140  FWDGTGSGSF-ARSEKFLFSCAPNLLLKGLANGAKGMLGLGNSRISFPSQFSSTFGFFQR  198

Query  658  KXAVCLSSSNGAI  696
            K ++CLS S+GA+
Sbjct  199  KFSLCLSPSDGAV  211



>emb|CDO98999.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 124/195 (64%), Gaps = 14/195 (7%)
 Frame = +1

Query  154  TISLAQR-PFFPRAIVIPVSKDFPTSQYVAQLQMGYN-LAPLKLVVDVGGPFLWADWAS-  324
            T+++A+  PF P ++++PV+KD  T QYV Q  +G   LAP KLV+D+ G   W D A  
Sbjct  34   TVTIAKEGPFLPNSVILPVTKDIATHQYVTQTYVGDQPLAPTKLVIDISGSSSWIDSAHL  93

Query  325  -SSQGS---IPCGSLKCSMANPKGCT-----SNEICELQFENPVSKMAGSGVLKEDTIAV  477
             SS G      C SL+CS A    CT     S   C L+ ENP++ M   G L E+ IAV
Sbjct  94   LSSSGHPRPFGCFSLQCSWAEANSCTRPSGTSRNTCTLEAENPITNMVTRGELTEEIIAV  153

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            ++ D    G  L+ VP+FLFS VP+ L +GLG+GV GVLGLGN+RISLPSQ+A+ F   R
Sbjct  154  QVTDGIKTG--LASVPHFLFSCVPALLLRGLGDGVKGVLGLGNTRISLPSQVADAFSFQR  211

Query  658  KXAVCLSSSNGAIIS  702
              ++CLSSSNGA+I+
Sbjct  212  TFSLCLSSSNGALIA  226



>gb|KJB46995.1| hypothetical protein B456_008G005100 [Gossypium raimondii]
Length=436

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 111/192 (58%), Gaps = 15/192 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  327
            SLAQ+ F P+A+VIPV+KD  T QY+  +     L P+ LVVD+GG  +W     D+ SS
Sbjct  20   SLAQQSFRPKALVIPVAKDASTLQYLTTISQRTPLMPIDLVVDLGGRHMWVDCDRDYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     C S +CS+A   GC           +N  C +  +N V+ +A SG + +D +++
Sbjct  80   TYRPARCRSAQCSLAGADGCGDCFSAPRPGCNNNTCGVTPDNSVTHIATSGEVAQDVVSI  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  D  N G  +S VP FLF+  PSFL QGL  GV G+ GLG +RI LPSQ A  F   R
Sbjct  140  QSTDGKNPGRVVS-VPRFLFACAPSFLLQGLATGVVGMAGLGRTRIGLPSQFAAAFSFHR  198

Query  658  KXAVCLSSSNGA  693
            K AVCLSSS  A
Sbjct  199  KFAVCLSSSTSA  210



>ref|XP_003518926.1| PREDICTED: basic 7S globulin [Glycine max]
Length=435

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 113/191 (59%), Gaps = 15/191 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            SLAQ+ F PRA+V+PV KD  T QY+ Q++    L P  LV+D+GG FLW D    + SS
Sbjct  21   SLAQQSFRPRALVVPVKKDASTLQYITQIKQRTPLVPENLVLDIGGQFLWVDCDNNYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     CGS +CS+A    C           +N  C +  +N V+  A SG L +D +++
Sbjct  81   TYRPARCGSAQCSLARSDSCGNCFSAPKPGCNNNTCGVTPDNTVTGTATSGELAQDVVSL  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N     + V  FLFS  P+FL QGL  GV+G+ GLG +RI+LPSQLA+ F   R
Sbjct  141  QSTNGFNPIQN-ATVSRFLFSCAPTFLLQGLATGVSGMAGLGRTRIALPSQLASAFSFRR  199

Query  658  KXAVCLSSSNG  690
            K AVCLSSSNG
Sbjct  200  KFAVCLSSSNG  210



>ref|XP_011020124.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=431

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 119/189 (63%), Gaps = 10/189 (5%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+AQ  F P+A+V+PVSKD  + QY+AQ+     L P+++ +D+GG +LW D    + SS
Sbjct  22   SIAQTTFRPKALVLPVSKDPSSLQYLAQINQRTPLVPVEVTLDLGGQYLWVDCQQGYVSS  81

Query  328  SQGSIPCGSLKCSMA--NPKGCT-SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S+ +  C + +CS+A    K CT   ++C L  +N  ++   S  L +D ++++  D  N
Sbjct  82   SKKNPSCNTAQCSLAVYRLKTCTVDKKLCVLSPDNTATRTGTSDYLTQDVVSIQSTDGSN  141

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
             G  +S VPNFLFS  P+F+ QGL  GV G+ GLG ++ISLPSQ +  F  PRK A+CL+
Sbjct  142  PGRVVS-VPNFLFSCAPTFILQGLAKGVKGMAGLGRTKISLPSQFSAAFSFPRKFAICLT  200

Query  679  SSN--GAII  699
            SSN  G +I
Sbjct  201  SSNAKGVVI  209



>ref|XP_010255900.1| PREDICTED: basic 7S globulin 2-like [Nelumbo nucifera]
Length=434

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 110/187 (59%), Gaps = 15/187 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ+ F P+A+V+PV+KD  T QY+ QL     L  + LVVDVGG FLW D    + SSS 
Sbjct  20   AQQSFRPKALVLPVTKDASTLQYLTQLNQRTPLVAINLVVDVGGQFLWVDCDQGYVSSSY  79

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
                CGS +CS+A    C           +N  C L  +N V+  A SG L +D ++++ 
Sbjct  80   LPARCGSAQCSLAKSTSCGDCNSAPRPGCNNNTCGLLPDNTVTNTATSGELTQDVVSIQS  139

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             D  N G  ++ VP FLF+  P+FL +GL +GV G+ GLG +RI+LPSQ A  F   RK 
Sbjct  140  TDGKNPGRVVT-VPRFLFTCAPTFLLEGLASGVVGMAGLGRTRIALPSQFAAAFSFHRKF  198

Query  664  AVCLSSS  684
            A+CL+SS
Sbjct  199  AICLTSS  205



>ref|XP_008390829.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=438

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 110/183 (60%), Gaps = 15/183 (8%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA---DWASSSQGSIPC  348
            F P+A+V+PV+KD  T QY+  L     L P+KL V +GGPFLW    D+ SS+     C
Sbjct  30   FRPKALVLPVTKDSSTLQYLTTLSQRTPLVPIKLTVHLGGPFLWVECEDYISSTYKPARC  89

Query  349  GSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
             S +CS+AN K CT+           N  C L  +NP+++ AG G L +D ++++  D  
Sbjct  90   NSAQCSLANSKSCTTECYSPPSPGCNNNTCGLLPDNPINRTAGGGDLGQDMVSIQSTDGS  149

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G  +S VPN LF+   +FL +GL +GV G+ GLG ++I LPSQ A+ F   RK A+CL
Sbjct  150  NPGRLVS-VPNLLFTCGSAFLLEGLASGVKGMAGLGRAKIGLPSQFASAFSFRRKFAICL  208

Query  676  SSS  684
            SSS
Sbjct  209  SSS  211



>ref|XP_002308984.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
 gb|EEE92507.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
Length=431

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 118/189 (62%), Gaps = 10/189 (5%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+AQ  F P+A+V+PVSKD  + QY+AQ+     L P+++ +D+GG +LW D    + SS
Sbjct  22   SIAQTTFRPKALVLPVSKDPSSLQYLAQINQRTPLVPVEVTLDLGGQYLWVDCQQGYVSS  81

Query  328  SQGSIPCGSLKCSMA--NPKGCT-SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S+ +  C + +CS+A    K CT   + C L  +N  ++   S  L +D ++++  D  N
Sbjct  82   SKKNPSCNTAQCSLAVYRLKTCTVDKKFCVLSPDNTATRTGTSDYLTQDVVSIQSTDGSN  141

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
             G  +S VPNFLFS  P+F+ QGL  GV G+ GLG ++ISLPSQ +  F  P+K A+CL+
Sbjct  142  PGRVVS-VPNFLFSCAPTFILQGLAKGVKGMAGLGRTKISLPSQFSAAFSFPKKFAICLT  200

Query  679  SSN--GAII  699
            SSN  G +I
Sbjct  201  SSNAKGVVI  209



>ref|XP_009342182.1| PREDICTED: basic 7S globulin 2-like, partial [Pyrus x bretschneideri]
Length=371

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 110/183 (60%), Gaps = 15/183 (8%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA---DWASSSQGSIPC  348
            F P+A+++PV+KD  T QY+  L     L P+KL V +GG FLW    D+ SS+     C
Sbjct  30   FRPKALLLPVTKDSSTLQYLTTLSQRSPLVPIKLTVHLGGQFLWVECEDYISSTYKPARC  89

Query  349  GSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
             S +CS+AN K CT+           N  C L  +NP+++ AG G L +D ++++  D  
Sbjct  90   NSAQCSLANSKSCTTECYSPPSPGCNNNTCGLLPDNPINRTAGGGDLGQDMVSIQSTDGS  149

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G  +S VPN LF+   +FL +GL +GV G+ GLG ++I LPSQ A+ FG  RK A+CL
Sbjct  150  NPGRLVS-VPNLLFTCGYAFLLEGLASGVKGMAGLGRAKIGLPSQFASAFGFRRKFAICL  208

Query  676  SSS  684
            SSS
Sbjct  209  SSS  211



>ref|XP_002520766.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41728.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 105/188 (56%), Gaps = 15/188 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+AQ+ F PRA+V+PVSKD  T QYV Q++    L P+ LVV +GG FLW D    + SS
Sbjct  21   SIAQQSFRPRALVVPVSKDASTLQYVTQVEQRTPLVPINLVVHLGGKFLWIDCEQNYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     CGS  CS+    GC           +N  C +  +NP +  A  G L  D ++V
Sbjct  81   TYRPARCGSALCSLGGSDGCGDCFSGPRPGCNNNTCGVSPDNPFTNTATGGELATDVVSV  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
               +  N G  ++ VP FLF+  P+FL QGL  G  G+ GLG +R + PSQ A+ F + R
Sbjct  141  NSTNGSNPGRAVT-VPRFLFACAPTFLLQGLATGAVGIAGLGRNRAAFPSQFASAFSLHR  199

Query  658  KXAVCLSS  681
            K A+CL S
Sbjct  200  KFAICLGS  207



>ref|XP_007144622.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
 gb|ESW16616.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
Length=435

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 112/193 (58%), Gaps = 15/193 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW----ADWASS  327
            S AQ+ F P+A+V+PV+K   T QYV Q+     L PL LV+D+GG FLW     ++ SS
Sbjct  22   SFAQQSFRPKALVVPVTKHASTLQYVTQINQRTPLVPLNLVLDIGGQFLWVGCQTNYVSS  81

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     C S +CS+A    C           +N  C L  +N ++  A  G L EDT++V
Sbjct  82   TYRPARCRSAQCSLAGATSCGDCFSAPRPGCNNNTCGLTPDNTITHTATVGELAEDTVSV  141

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  ++ V  FLFS  P+FL QGL  GV+G+ GLG ++I+LPSQ A+ F   R
Sbjct  142  QSTNGFNPGRNVT-VSRFLFSCAPTFLLQGLATGVSGMAGLGRTKIALPSQFASAFSFHR  200

Query  658  KXAVCLSSSNGAI  696
            K AVCLSSS G +
Sbjct  201  KFAVCLSSSKGVV  213



>ref|XP_011026191.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=438

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 114/197 (58%), Gaps = 18/197 (9%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+AQ+ F P+A+V+PV++D  T QYV Q++      P+ LVVD+GG FLW D    + SS
Sbjct  21   SIAQQSFRPKALVVPVTRDSATLQYVTQIKQRTPQVPINLVVDLGGQFLWVDCDQSYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     CGS  CS+A   GC           +N  C +  +N V++ A  G L  D ++V
Sbjct  81   TYRPARCGSALCSLARAGGCGDCFSGPRPGCNNNTCGVIPDNTVTRTATGGELATDVVSV  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
               +  N G  +S VP FLFS  P+FL QGL +GV G+ GLG +RI+ PSQ A+ F   R
Sbjct  141  NSTNGSNPGREVS-VPRFLFSCAPTFLLQGLASGVVGMAGLGRTRIAFPSQFASAFSFNR  199

Query  658  KXAVCLSS---SNGAII  699
            K A+CL+S   + G II
Sbjct  200  KFAICLTSPAPAKGVII  216



>ref|XP_002302122.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
 gb|EEE81395.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
Length=438

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 113/197 (57%), Gaps = 18/197 (9%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+AQ+ F P+A+V+PV+KD  T QYV Q++      P+ LVVD+GG FLW D    + SS
Sbjct  21   SIAQQSFRPKALVVPVTKDSATLQYVTQIKQRTPQVPINLVVDLGGQFLWVDCDKNYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     CGS  CS+A   GC           +N  C +  +N V++ A  G L  D ++V
Sbjct  81   TYRPARCGSALCSLARAGGCGDCFSGPRPGCNNNTCGVIPDNTVTRTATGGELATDVVSV  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
               +  N G   S VP FLFS  P+FL QGL +GV G+ GLG +RI+ PSQ A+ F   R
Sbjct  141  NSTNGSNPGREAS-VPRFLFSCAPTFLLQGLASGVVGMAGLGRTRIAFPSQFASAFSFNR  199

Query  658  KXAVCLSS---SNGAII  699
            K A+CL+S   + G II
Sbjct  200  KFAICLTSPAPAKGVII  216



>ref|XP_006419833.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
 gb|ESR33073.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
Length=437

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 115/200 (58%), Gaps = 19/200 (10%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            T SLAQ  F P+A+++PV+KD  T QYV Q+     L P+KL +D+GG FLW D    + 
Sbjct  19   TPSLAQTSFRPKALLLPVTKDASTLQYVTQINQRTPLVPVKLTLDLGGQFLWVDCDQGYV  78

Query  322  SSSQGSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDT  468
            SSS   + C S +C++A  K C            +N+ C    +N ++    SG L  D 
Sbjct  79   SSSYKPVRCRSAQCNLARSKSCVQSCFSPPRPGCNNDTCAHLPDNTITNTGTSGELATDI  138

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++++  D  N G  +S VPN  F+   +FL +GL +GV G+ GLG +RISLPSQ++  F 
Sbjct  139  VSIQSTDGKNLGRVVS-VPNLAFACAATFLLEGLASGVKGMAGLGRTRISLPSQISAAFS  197

Query  649  IPRKXAVCLSSS---NGAII  699
              RK A+CLSSS   NG ++
Sbjct  198  FDRKFAICLSSSSRVNGVVL  217



>ref|XP_011082548.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=432

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 107/196 (55%), Gaps = 15/196 (8%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            +IS AQR F P A+V+ V KD  T QYV  +     L P+ LVV +GG FLW D    + 
Sbjct  17   SISHAQRSFRPDALVLRVRKDVSTLQYVTMINQRTPLVPVNLVVHLGGQFLWVDCDNNYV  76

Query  322  SSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  471
            SSS   + C S +CS A    C           +N  C +  +NP ++ A  G L ED +
Sbjct  77   SSSYRPVRCRSAQCSRAGSTSCGDCFNGPRPGCNNNTCGVIPDNPFTRTATGGELAEDVV  136

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +V+  D  N G  ++ VP F+FS  P+FL QGL +G  G+ GLG +RI  PSQ A  F  
Sbjct  137  SVQSTDGSNPGPLVT-VPRFIFSCAPTFLLQGLASGTTGLAGLGRARIGFPSQFAAAFSF  195

Query  652  PRKXAVCLSSSNGAII  699
             RK A+CLS+S   +I
Sbjct  196  RRKFAICLSASANGVI  211



>emb|CAN80378.1| hypothetical protein VITISV_038701 [Vitis vinifera]
Length=436

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 106/192 (55%), Gaps = 15/192 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S  +  F P A+VIPVSKD  T QY+  +     L P+KLVVD+G  FLW D    + SS
Sbjct  20   SYGKTSFRPDALVIPVSKDASTLQYLTTINQRTPLVPVKLVVDLGAQFLWVDCEQNYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            S     C S +CS+A   GC           +N  C +  +N V++ A SG L ED ++V
Sbjct  80   SYRPARCRSAQCSLARANGCGDCFSAPRPGCNNNTCGVLPDNTVTRTATSGELAEDFVSV  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  D  N G  +S V  FLFS  P+FL +GL +   G+ GLG +RI+ PSQ A+ F   R
Sbjct  140  QSTDGSNPGRVVS-VSKFLFSCAPTFLLEGLASSAMGMAGLGRTRIAFPSQFASAFSFHR  198

Query  658  KXAVCLSSSNGA  693
            K A CLSSS  A
Sbjct  199  KFATCLSSSTTA  210



>ref|XP_002272235.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=436

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 106/192 (55%), Gaps = 15/192 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S  +  F P A+VIPVSKD  T QY+  +     L P+KLVVD+G  FLW D    + SS
Sbjct  20   SYGKTSFRPDALVIPVSKDASTLQYLTTINQRTPLVPVKLVVDLGAQFLWVDCEQNYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            S     C S +CS+A   GC           +N  C +  +N V++ A SG L ED ++V
Sbjct  80   SYRPARCRSAQCSLARANGCGDCFSAPRPGCNNNTCGVLPDNTVTRTATSGELAEDFVSV  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  D  N G  +S V  FLFS  P+FL +GL +   G+ GLG +RI+ PSQ A+ F   R
Sbjct  140  QSTDGSNPGRVVS-VSKFLFSCAPTFLLEGLASSAMGMAGLGRTRIAFPSQFASAFSFHR  198

Query  658  KXAVCLSSSNGA  693
            K A CLSSS  A
Sbjct  199  KFATCLSSSTTA  210



>ref|XP_006489581.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 114/200 (57%), Gaps = 19/200 (10%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            T SLAQ  F P+A+++PV+KD  T QYV Q+     L P+KL +D+GG FLW D    + 
Sbjct  19   TPSLAQTSFRPKALLLPVTKDASTLQYVTQINQRTPLVPVKLTLDLGGQFLWVDCDQGYV  78

Query  322  SSSQGSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDT  468
            SSS   + C S +C++A  K C            +N+ C    +N ++    SG L  D 
Sbjct  79   SSSYKPVRCRSAQCNLARSKSCVQSCFSPPRPGCNNDTCAHLPDNTITNTGTSGELATDI  138

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++++  D  N G  +S VPN  F+   +FL +GL +GV G+ GLG +RISLPSQ +  F 
Sbjct  139  VSIQSTDGKNLGRVVS-VPNLAFACAATFLLEGLASGVKGMAGLGRTRISLPSQFSAAFS  197

Query  649  IPRKXAVCLSSS---NGAII  699
              RK A+CLSSS   NG ++
Sbjct  198  FDRKFAICLSSSSRVNGVVL  217



>gb|AAP84703.1| putative xyloglucanase inhibitor [Solanum tuberosum]
Length=437

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 110/193 (57%), Gaps = 15/193 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +TI+  Q  F P+ ++IPV+KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGY  79

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SSS     C S +CS+    GC           +N  C L  +N V++ A SG L  D 
Sbjct  80   VSSSYKPARCRSAQCSLGGASGCGECFSPPRPGCNNNTCGLLPDNTVTRTATSGELASDI  139

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++V+  +  N G  +S   NFLF    +FL QGL +GV G+ GLG +RISLPSQ +  F 
Sbjct  140  VSVQSTNGKNPGRSVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTRISLPSQFSAEFS  198

Query  649  IPRKXAVCLSSSN  687
             PRK A+CL+SSN
Sbjct  199  FPRKFALCLTSSN  211



>ref|XP_003590665.1| Xyloglucan-specific endoglucanase inhibitor protein [Medicago 
truncatula]
 gb|AES60916.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=435

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 116/195 (59%), Gaps = 16/195 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            + +Q+ F P+A+V+P++KD  T+ QY AQ+     L PL ++VD+GG FLW D    + S
Sbjct  22   TFSQQSFRPKALVLPITKDGATTNQYKAQINQRTPLVPLNVIVDLGGQFLWVDCENKYIS  81

Query  325  SSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S+     C S +CS+AN  GC           +N  C +  +N ++  A SG L ED ++
Sbjct  82   STYRPARCRSAQCSLANSDGCGDCFSSPKPGCNNNTCGVTPDNSITHTATSGELAEDVLS  141

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  +  N G  +  V  FLFS  P+FL +GL  G +G+ GLG ++I+LPSQLA+ F   
Sbjct  142  IQSSNGFNPGQNVV-VSRFLFSCAPTFLLKGLATGASGMAGLGRTKIALPSQLASAFSFA  200

Query  655  RKXAVCLSSSNGAII  699
            RK A+CLSSS G ++
Sbjct  201  RKFAICLSSSKGVVL  215



>gb|ADD71503.1| xyloglucanase inhibitor 1 [Humulus lupulus]
Length=443

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 115/190 (61%), Gaps = 11/190 (6%)
 Frame = +1

Query  157  ISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            ++ A+   FP+A+V+PV+KD  T QY+ Q+        LK+V+DVGG FLW D    + S
Sbjct  23   LATAKTAAFPKALVLPVTKDTTTRQYITQITQRTPPVQLKVVLDVGGEFLWIDCEKGYKS  82

Query  325  SSQGSIPCGSLKCSMANPKGCTSNE------ICELQFENPVSKMAGSGVLKEDTIAVELI  486
            S++  +PCGS +C ++    CT+++      +C +   NP S +  SG L ED + ++  
Sbjct  83   STKRPVPCGSPQCVLSGSGACTTSDNPSDVGVCGVMPNNPFSSVGTSGDLFEDILYIQST  142

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            +  N G  +S VPN LFS  P+ L +GL +G+ G+ G G ++++LPS  ++ F  PRK  
Sbjct  143  NGFNPGKQVS-VPNLLFSCAPNSLLEGLASGIIGMAGFGRNKVALPSLFSSAFSFPRKFG  201

Query  667  VCLSSSNGAI  696
            VCLSSSNG I
Sbjct  202  VCLSSSNGVI  211



>ref|XP_010278291.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=470

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 100/186 (54%), Gaps = 14/186 (8%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q+PF P + ++P++KD PT QYV Q++       + LVVD+GG FLW D    + SSS  
Sbjct  56   QKPFRPHSFILPITKDAPTLQYVTQIRQRTPFVTVDLVVDLGGQFLWVDCESAYFSSSYH  115

Query  337  SIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
             +PC S +CS     GC           SN  C L   N V+K   SG L ED IAV   
Sbjct  116  PVPCNSSQCSATGANGCGQCLLPASPGCSNNTCVLFPGNTVTKTTTSGELTEDMIAVRST  175

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            D  +  + +  VP FLF+    FL + L  GV G+ GLG   I +PSQLA  F  PRK A
Sbjct  176  DGSSPATRIVSVPRFLFTCSARFLLERLAGGVKGMAGLGRGPIGMPSQLAAAFSFPRKFA  235

Query  667  VCLSSS  684
            VCL SS
Sbjct  236  VCLPSS  241



>gb|AFK46427.1| unknown [Medicago truncatula]
Length=435

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 116/195 (59%), Gaps = 16/195 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            + +Q+ F P+A+V+P++KD  T+ QY AQ+     L PL ++VD+GG FLW D    + S
Sbjct  22   TFSQQSFRPKALVLPITKDGATTNQYKAQINQRTPLVPLNVIVDLGGQFLWVDCENKYIS  81

Query  325  SSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S+     C S +CS+AN  GC           +N  C +  +N ++  A SG L ED ++
Sbjct  82   STYRPARCRSAQCSLANSDGCGDCFSSPKPGCNNNTCGVTPDNSITHTATSGELAEDVLS  141

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  +  N G  +  V  FLFS  P+FL +GL  G +G+ GLG ++I+LPSQLA+ F   
Sbjct  142  IQSSNGFNPGQNVV-VSRFLFSCAPTFLLKGLATGASGMAGLGRTKIALPSQLASAFSFA  200

Query  655  RKXAVCLSSSNGAII  699
            RK A+CLSSS G ++
Sbjct  201  RKFAICLSSSKGVVL  215



>gb|KJB23117.1| hypothetical protein B456_004G081800 [Gossypium raimondii]
Length=433

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 109/192 (57%), Gaps = 15/192 (8%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  330
            LAQ+ F P+A+V+PVSKD  T QY+  +       P+++VVD+GG +LW     D+ SS+
Sbjct  21   LAQQSFRPKALVVPVSKDASTLQYLTTINQRTPFVPIRVVVDLGGRYLWVDCERDYVSST  80

Query  331  QGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVE  480
                 C S +CS+A   GC           +N  C +   N V+  AG G + +D ++++
Sbjct  81   YRPARCSSAQCSLAGANGCGDCFDGPRPGCNNNTCAVGPGNTVTNTAGPGEVAQDVVSLQ  140

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              D  N G  ++ VP FLF+  P+ L QGL NGV G+ G G  RI LPSQ +  F   RK
Sbjct  141  STDGRNPGRVVT-VPRFLFACAPTSLLQGLANGVVGMAGFGRYRIGLPSQFSAAFSFRRK  199

Query  661  XAVCLSSSNGAI  696
             A+CLSS+NG I
Sbjct  200  FAICLSSANGVI  211



>ref|NP_001234746.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAY97864.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 108/192 (56%), Gaps = 15/192 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +TI+  Q  F P+ ++IPV+KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGY  79

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SSS     CGS +CS+    GC            N  C L  +N V+  A SG L  D 
Sbjct  80   VSSSYKPARCGSAQCSLGGASGCGECFSPPRPGCDNNTCGLLPDNTVTGTATSGELASDV  139

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++VE  +  N G  +S   NFLF    +FL QGL +GV G+ GLG ++ISLPSQ +  F 
Sbjct  140  VSVESSNGKNPGRSVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTKISLPSQFSAEFS  198

Query  649  IPRKXAVCLSSS  684
             PRK A+CL+SS
Sbjct  199  FPRKSALCLTSS  210



>gb|EYU38145.1| hypothetical protein MIMGU_mgv1a006647mg [Erythranthe guttata]
Length=436

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 107/199 (54%), Gaps = 18/199 (9%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            +I   Q  F P A+V+PV KD  T QYV  +     L P+ LVV +GG FLW D    + 
Sbjct  18   SIIHGQPSFRPSALVLPVRKDISTQQYVTAINQRTPLVPVNLVVHLGGQFLWVDCDNNYI  77

Query  322  SSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  471
            SS+   + C S +CS+A    C           +N  C +  +NP  + A  G L +D +
Sbjct  78   SSTYRPVRCRSAQCSLARSNSCGDCFDGPRPGCNNNTCGVSPDNPFIRTATGGELAQDAV  137

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +V   D  N G F S VP F+F+  P+FL QGL +G  G+ GLG +RI LPSQ A  F  
Sbjct  138  SVRSTDGSNPGRFTS-VPQFIFACAPTFLLQGLASGATGLAGLGRARIGLPSQFAAAFSF  196

Query  652  PRKXAVCL---SSSNGAII  699
             RK A+CL   +SSNG II
Sbjct  197  HRKFAICLTSSTSSNGVII  215



>ref|NP_001234249.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAN87262.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 109/192 (57%), Gaps = 15/192 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +TI+  Q  F P+ ++IPV+KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGY  79

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SSS     CGS +CS+    GC           +N  C L  +N V+  A SG L  D 
Sbjct  80   VSSSYKPARCGSAQCSLGGASGCGECFSPPRPGCNNNTCGLLPDNTVTGTATSGELASDV  139

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++VE  +  N G  +S   NFLF    +FL QGL +GV G+ GLG ++ISLPSQ +  F 
Sbjct  140  VSVESSNGKNPGRSVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTKISLPSQFSAEFS  198

Query  649  IPRKXAVCLSSS  684
             PRK A+CL+SS
Sbjct  199  FPRKFALCLTSS  210



>gb|KDO74788.1| hypothetical protein CISIN_1g036132mg [Citrus sinensis]
Length=437

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 113/199 (57%), Gaps = 19/199 (10%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            T SLAQ  F P+A+++PV+KD  T QYV Q+     L P+K+ +D+GG FLW D    + 
Sbjct  19   TPSLAQTSFRPKALLLPVTKDASTLQYVTQINQRTPLVPVKVTLDLGGQFLWVDCDQGYV  78

Query  322  SSSQGSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDT  468
            SSS   + C S +C++A  K C            +N+ C    +N ++    SG L  D 
Sbjct  79   SSSYKPVRCRSAQCNLARSKSCVQSCFSPPRPGCNNDTCAHLPDNTITNTGTSGELSTDI  138

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++++  D  N G  +S VPN  F+   +FL +GL +GV G+ GLG +RISLPSQ +  F 
Sbjct  139  VSIQSTDGKNLGRVVS-VPNLAFACAATFLLEGLASGVKGMAGLGRTRISLPSQFSAAFS  197

Query  649  IPRKXAVCLSSS---NGAI  696
              RK A+CLSSS   NG +
Sbjct  198  FDRKFAICLSSSSRVNGVV  216



>gb|ACM68431.1| xyloglucan-specific endoglucanase inhibitor protein [Capsicum 
annuum]
Length=437

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 109/192 (57%), Gaps = 15/192 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +TI+  Q  F P+ ++IPV KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVMKDGSTLQYLTQIQQRTPLVPVSLTLDLGGQFLWVDCDQGY  79

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SSS     C S +CS+A   GC           +N  C L  +N V++ A SG L  D 
Sbjct  80   VSSSYKPARCRSAQCSLAGATGCGECFSPPRPGCNNNTCGLFPDNTVTRTATSGELASDV  139

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++V+  +  N G  +S   NFLF    +FL QGL +GV G+ GLG +RISLPSQ +  F 
Sbjct  140  VSVQSSNGKNPGRNVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTRISLPSQFSAEFS  198

Query  649  IPRKXAVCLSSS  684
             PRK AVCLSSS
Sbjct  199  FPRKFAVCLSSS  210



>gb|EYU41534.1| hypothetical protein MIMGU_mgv1a008121mg [Erythranthe guttata]
Length=384

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 113/182 (62%), Gaps = 8/182 (4%)
 Frame = +1

Query  175  PFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS----SQGSI  342
            P  P+A ++P+ KD  T QY+A + MG  LA ++LVVD+ G F+W D  S+    S   I
Sbjct  29   PILPKAAILPLKKDPTTLQYIATVFMGGTLAAVELVVDINGGFVWVDCESNPTLRSHEPI  88

Query  343  PCGSLKCSMA-NP-KGCTS-NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  513
               SLKCSMA NP  GC S ++ C L  EN VS+M+ SG L ED +A+E  +       L
Sbjct  89   KSCSLKCSMAKNPVNGCHSASKNCLLHPENTVSRMSVSGDLNEDRVAMEFWERNIGSRSL  148

Query  514  SHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG-IPRKXAVCLSSSNG  690
            + + NFLFS  P+ L +GL +G  G+LGLGNSRIS PSQ +  FG   RK ++ LSSS G
Sbjct  149  AKIENFLFSCAPNLLMKGLASGAKGMLGLGNSRISFPSQFSTEFGFFRRKFSLRLSSSKG  208

Query  691  AI  696
            +I
Sbjct  209  SI  210



>gb|KDP40112.1| hypothetical protein JCGZ_02110 [Jatropha curcas]
Length=434

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 111/191 (58%), Gaps = 16/191 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+AQ  F P+A+V+PVSKD  T QY+ QL+    L P+KL +D+GG ++W D    + SS
Sbjct  20   SIAQTSFRPKALVLPVSKDASTLQYLTQLKQRTPLVPVKLTLDLGGQYMWVDCDQGYKSS  79

Query  328  SQGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  474
            S     C S +CS+A  K C +           N+ C L  +N V+    SG + +D ++
Sbjct  80   SYKPARCRSAQCSLAKSKSCITECFSSPRPGCNNDTCALLPDNTVTHTGTSGEVGQDLVS  139

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S VP  +F+   +FL  GL +GV G+ GLG ++ISLPSQ +  F   
Sbjct  140  IQSTDGSNPGRVVS-VPKLIFTCGTTFLLGGLASGVKGMAGLGRTKISLPSQFSAAFSFH  198

Query  655  RKXAVCLSSSN  687
            RK A+CL+SSN
Sbjct  199  RKFAICLTSSN  209



>ref|XP_009356759.1| PREDICTED: basic 7S globulin [Pyrus x bretschneideri]
Length=439

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 108/189 (57%), Gaps = 15/189 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            + AQ+ F P+A+V+PVSKD  T QY A++     L P+ LV+D+GG FLW D    + SS
Sbjct  20   TFAQQSFRPKALVVPVSKDASTLQYTARISQRTPLVPINLVLDLGGQFLWVDCEQNFVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     C S +CS+A   GC           +N  C L  +N V+  A  G L  D ++V
Sbjct  80   TYRPARCRSAQCSLAKATGCGDCFSSPKPGCNNNTCGLTPDNTVTHTATGGELASDVVSV  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +     N G  ++ V  FLF+  P+FL QGL  GV+G+ GLG +RISLPSQ A+ F   R
Sbjct  140  QSTTGSNPGPNVT-VSRFLFACAPTFLLQGLAAGVSGMAGLGRTRISLPSQFASAFSFDR  198

Query  658  KXAVCLSSS  684
              A+CLSSS
Sbjct  199  TFAICLSSS  207



>ref|XP_002517163.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45326.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=469

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 112/192 (58%), Gaps = 19/192 (10%)
 Frame = +1

Query  175  PFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSI  342
            PF P+A+V+PV KD  T+QY+ Q++    L P+KL+VD+G  F+W D    + SSS   +
Sbjct  61   PFRPKALVLPVFKDKCTNQYITQIKQRTPLVPVKLIVDLGARFMWVDCEEGYVSSSYTPV  120

Query  343  PCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELID  489
             C SL C +AN   C +           N  C    ENPV ++  SG + +D ++++  +
Sbjct  121  SCDSLLCKLANSLACATECNSTPKPGCHNNTCAHSPENPVIRLGTSGQIGQDVVSLQSFN  180

Query  490  EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAV  669
                   +S VPNF F   P+FL + L +GV G+ GLGNS ISLP+Q ++ FG P+K AV
Sbjct  181  GKTPDRIVS-VPNFPFVCGPTFLLENLADGVTGLAGLGNSNISLPAQFSSAFGFPKKFAV  239

Query  670  CLSS---SNGAI  696
            CLS+   SNG I
Sbjct  240  CLSNSTKSNGLI  251



>ref|XP_009773897.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=433

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 112/196 (57%), Gaps = 19/196 (10%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
             Q  F P+A+++PV+KD  T QY+ Q+     L P+KL + +GG  LW D    + SS+ 
Sbjct  23   GQTSFQPKALLLPVTKDSTTLQYITQIGQRTPLVPIKLTIHLGGQTLWVDCEDGYVSSTY  82

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENP-VSKMAGSGVLKEDTIAVE  480
                CGS +C++A    C           SN  C    ENP +  +   G + ED ++++
Sbjct  83   RPARCGSAQCTLAKVNTCGDCITTPRIGCSNNACYNTPENPFIKTLYDGGEITEDVLSIQ  142

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              D  N G F+  +P+F+F+ VP+FL  GL +GV G +GLG +RI+LPSQLA  F  PRK
Sbjct  143  STDGSNPGKFV-KIPSFIFTCVPTFLTDGLASGVKGTVGLGRNRIALPSQLAEIFSFPRK  201

Query  661  XAVCLSS---SNGAII  699
             A+CLSS   S+G II
Sbjct  202  FAICLSSSTKSSGVII  217



>ref|XP_004495219.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=440

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 114/195 (58%), Gaps = 16/195 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKD-FPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            + +Q+ F P+A+V+PV+KD   T+QY+AQ+     L PL LVVD+GG FLW D    + S
Sbjct  18   TFSQQSFRPKALVLPVTKDTLTTNQYIAQINQRTPLVPLNLVVDLGGQFLWLDCEQHYTS  77

Query  325  SSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S+     C S +CS+A    C           +N  C L  +N V+  A SG L ED ++
Sbjct  78   STYRPARCRSAQCSLAKSTACGDCFSSPKPGCNNNTCGLFPDNTVTHTATSGELAEDVLS  137

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            V+  +  N    ++ V  FLFS  P+ L QGL +G +G+ GLG ++I+ PSQLA+ F   
Sbjct  138  VQSTNGFNPTQNVA-VSRFLFSCAPTSLLQGLASGASGMAGLGRTKIAFPSQLASAFSFD  196

Query  655  RKXAVCLSSSNGAII  699
            RK A+C SSS+G ++
Sbjct  197  RKFAICFSSSDGVVL  211



>gb|KDP21480.1| hypothetical protein JCGZ_21951 [Jatropha curcas]
Length=434

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 107/191 (56%), Gaps = 15/191 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ+ F P+A+V+PVSKD  T QYV Q++    L  + LV+ +GG  LW D    + SS+ 
Sbjct  24   AQQSFRPKALVLPVSKDAATLQYVTQIKQRTPLISINLVLHLGGKILWVDCDQNYISSTY  83

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
                CGS  CS+    GC           +N  C +  +NP++  A  G L  D ++V  
Sbjct  84   RPARCGSALCSLGEANGCGNCFSGPRPGCNNNTCGVSPDNPITNTATGGELATDIVSVNS  143

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             +  N G  ++ VP FLFS  P+FL  GL NGV G+ GLG +R +LPSQ + +F   RK 
Sbjct  144  TNGSNPGRAVT-VPKFLFSCAPTFLLLGLANGVVGIAGLGRTRAALPSQFSASFSFHRKF  202

Query  664  AVCLSSSNGAI  696
            A+CL+S NG I
Sbjct  203  AICLASRNGVI  213



>gb|AIL30493.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Nicotiana tabacum]
Length=437

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 106/186 (57%), Gaps = 15/186 (8%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q  F P+ +++P++KD  T QY+ Q+Q    L P+ L +D+GG FLW D    + SSS  
Sbjct  25   QTSFRPKGLILPITKDASTLQYLTQIQQRTPLVPVSLTLDLGGQFLWVDCDQGYVSSSYK  84

Query  337  SIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
               C S +CS+A   GC           +N+ C L  +N V++ A SG L  DT+ V+  
Sbjct  85   PARCRSAQCSLAGAGGCGQCFSPPKPGCNNDTCGLLPDNTVTRTATSGELASDTVQVQSS  144

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            +  N G  +S   +FLF    +FL +GL  GV G+ GLG +RISLPSQ +  F  PRK A
Sbjct  145  NGKNPGRNVSD-KDFLFVCGSTFLLEGLATGVKGMAGLGRTRISLPSQFSAEFSFPRKFA  203

Query  667  VCLSSS  684
            VCLSSS
Sbjct  204  VCLSSS  209



>gb|KDP25943.1| hypothetical protein JCGZ_22848 [Jatropha curcas]
Length=434

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 110/189 (58%), Gaps = 15/189 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA---DWASSS  330
            SLA+ PF P+ +++ V+KD  TSQY+  ++      PLK+ VD+GG FLW    D+ SSS
Sbjct  21   SLAKTPFRPKGLLLRVTKDSSTSQYLTHIKQRTPFVPLKVTVDLGGKFLWVDCEDYISSS  80

Query  331  QGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAV  477
               + C S  C++AN   CTS           N  C+  F NPVS+++ SG + +D +++
Sbjct  81   YKPVSCDSKLCTLANSHSCTSECYSAPKPGCHNNTCDQLFYNPVSRVSSSGQIGQDILSL  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            E  D  N G  +S VPN  F+   +   + L NGV G+ G G + ISLP QL++ F + +
Sbjct  141  ESTDGRNPGKLVS-VPNLAFTCGYTSSLESLANGVKGIAGFGINNISLPFQLSSAFRLQK  199

Query  658  KXAVCLSSS  684
            K A+CLSSS
Sbjct  200  KFAMCLSSS  208



>ref|XP_008222987.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=438

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 107/185 (58%), Gaps = 16/185 (9%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P+A+V+PV+KD  T QY+        L P+KL VD+GG +LW D    + SS+     
Sbjct  30   FRPKALVLPVTKDPSTLQYLTTFSQRTPLVPIKLTVDLGGQYLWVDCEQGYVSSTYKPAR  89

Query  346  CGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDE  492
            C S +CS++N K CT+           N  C L  +N V++   SG L +D ++++  D 
Sbjct  90   CNSAQCSLSNSKACTTECYSSPKPGCNNNTCSLSPDNTVTRTGTSGDLGQDIVSLQSTDG  149

Query  493  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
               G  +S VPNFLF+   +FL  GL NGV G+ GLG ++I LPSQ ++ F   RK A+C
Sbjct  150  FTPGKVVS-VPNFLFTCGSTFLLDGLANGVKGMAGLGRAKIGLPSQFSSAFSFHRKFAIC  208

Query  673  LSSSN  687
            LSSSN
Sbjct  209  LSSSN  213



>ref|XP_008235257.1| PREDICTED: basic 7S globulin 2-like [Prunus mume]
Length=473

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 105/185 (57%), Gaps = 15/185 (8%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  330
            LAQ+ F P+A+VIPVSKD  T QY   +     L P+ LV+D+GG FLW D    + SS+
Sbjct  58   LAQQSFRPKALVIPVSKDASTLQYTTHITQRTPLVPVNLVLDLGGQFLWVDCEQNYVSST  117

Query  331  QGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVE  480
                 C S +CS+A   GC           +N  C L  +N V++ A  G L  D ++V 
Sbjct  118  YRPARCRSAQCSLARASGCGDCFSSPKPGCNNNTCGLSPDNTVTRTATGGELAYDVVSVP  177

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              +  N G  +S V  FLF+  P+FL +GL  GV+G+ GLG +RISLPSQ A+ F   RK
Sbjct  178  STNGFNPGRNVS-VSQFLFTCAPTFLLEGLAAGVSGMAGLGRTRISLPSQFASAFSFDRK  236

Query  661  XAVCL  675
             A+CL
Sbjct  237  FAICL  241



>ref|XP_009757289.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=437

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 106/186 (57%), Gaps = 15/186 (8%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q  F P+ +++P++KD  T QY+ Q+Q    L P+ L +D+GG FLW D    + SSS  
Sbjct  25   QTSFRPKGLILPITKDASTLQYLTQIQQRTPLVPVSLTLDLGGQFLWVDCDQGYVSSSYK  84

Query  337  SIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
               C S +CS+A   GC           +N+ C L  +N V++ A SG L  DT+ V+  
Sbjct  85   PARCRSAQCSLAGAGGCGQCFSPPKPGCNNDTCGLLPDNTVTRTATSGELASDTVQVQSS  144

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            +  N G  +S   +FLF    +FL +GL  GV G+ GLG +RISLPSQ +  F  PRK A
Sbjct  145  NGKNPGRNVSD-KDFLFVCGSTFLLEGLATGVKGMAGLGRTRISLPSQFSAEFSFPRKFA  203

Query  667  VCLSSS  684
            VCLSSS
Sbjct  204  VCLSSS  209



>ref|XP_010038107.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Eucalyptus 
grandis]
Length=437

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 108/193 (56%), Gaps = 18/193 (9%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q+ F P+A+V+PVSKD  T QYV ++     L P+ LVVD+GG FLW D    + SS+  
Sbjct  24   QQSFRPKALVLPVSKDASTLQYVTRISQRTPLVPVALVVDLGGQFLWVDCEQNYVSSTYL  83

Query  337  SIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
               CGS  CS+A   GC           +N  C +  +N V+     G +  D ++V   
Sbjct  84   PARCGSAVCSLARASGCGDCFSAARPGCNNNTCGVTPDNTVTGXRTGGEVATDLVSVNST  143

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            D  N G  + +V  F+F+  PSFL  GL +GV G+ GLG +RI+LPSQ A+ F   RK A
Sbjct  144  DGSNPGQAV-NVTRFVFACAPSFLLDGLASGVQGMAGLGRTRIALPSQFASAFSFNRKFA  202

Query  667  VCLS---SSNGAI  696
            +CLS   SSNG I
Sbjct  203  ICLSSSPSSNGVI  215



>gb|ADG23123.1| xyloglucan specific endoglucanase inhibitor [Solanum melongena]
Length=437

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 108/193 (56%), Gaps = 15/193 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +TI+  Q  F P+ ++IPV+KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGY  79

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SSS     C S +CS+A    C           +N  C L  +N V+  A  G L  D 
Sbjct  80   VSSSYKPARCRSAQCSLAGASACGECFSPPRPGCNNNTCSLFPDNTVTGTATGGELASDI  139

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++V+  +  N G  +S   NFLF    +FL QGL +GV G+ GLG +RISLPSQ +  F 
Sbjct  140  VSVQSSNGKNPGRNVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTRISLPSQFSAEFS  198

Query  649  IPRKXAVCLSSSN  687
             PRK A+CL+SSN
Sbjct  199  FPRKFALCLTSSN  211



>ref|XP_007222421.1| hypothetical protein PRUPE_ppa006071mg [Prunus persica]
 gb|EMJ23620.1| hypothetical protein PRUPE_ppa006071mg [Prunus persica]
Length=429

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 110/192 (57%), Gaps = 19/192 (10%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P+A+V+PV+KD  T QY+  L     L P+KL VD+GG +LW D    + SS+     
Sbjct  30   FRPKALVLPVTKDPSTLQYLTTLSQRTPLVPIKLTVDLGGQYLWVDCEEGYVSSTYKPAR  89

Query  346  CGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDE  492
            C S +CS++N K CT+           N  C L  +N V++   SG L +D ++++  D 
Sbjct  90   CNSAQCSLSNSKACTTECYSSPKPGCNNNTCSLSPDNTVTRTGTSGDLGQDIVSLQSTDG  149

Query  493  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
               G  +S VPN LF+   +FL  GL NGV G+ GLG ++I LPSQ A+ F   RK A+C
Sbjct  150  FTPGRVVS-VPNLLFTCGSTFLLDGLANGVKGMAGLGRAKIGLPSQFASAFSFHRKFAIC  208

Query  673  LSS---SNGAII  699
            L+S   SNG +I
Sbjct  209  LTSSTNSNGIVI  220



>ref|XP_004290668.1| PREDICTED: basic 7S globulin 2-like [Fragaria vesca subsp. vesca]
Length=439

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 111/192 (58%), Gaps = 15/192 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            + AQ+ F P+A+VIPV+KD  T QY  ++     L P+ LV+D+GG +LW D    + SS
Sbjct  21   AFAQQSFRPKALVIPVTKDASTLQYTTRISQRTPLVPISLVLDLGGQYLWVDCEQNYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     C S +CS+A   GC           +N  C +  +N V++ A  G + +D ++V
Sbjct  81   TYRPARCRSAQCSLAGADGCGDCFSSPKPGCNNNTCGVSPDNTVTRTATGGEIAQDVVSV  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +     N G  ++ V NF+F+  P+FL  GL +GV+G+ GLG ++I+L SQ A+ F   R
Sbjct  141  QSTTGSNPGQNVT-VSNFIFACAPTFLLDGLASGVSGMAGLGRTKIALSSQFASAFSFKR  199

Query  658  KXAVCLSSSNGA  693
            K AVCLSSS  A
Sbjct  200  KFAVCLSSSTSA  211



>ref|XP_008355568.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=439

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 106/189 (56%), Gaps = 15/189 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            + AQ+ F P+A+V+PVSKD  T QY  ++     L P+ LV+D+GG +LW D    + SS
Sbjct  20   TFAQQSFRPKALVVPVSKDASTLQYTTRISQRTPLVPINLVLDLGGQYLWVDCEQNYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     C S +CS+A   GC           +N  C L   N V+  A  G L  D ++V
Sbjct  80   TYRPARCHSAQCSLAKATGCGDCFSSPKPGCNNNTCGLTPGNTVTHTATGGELASDVVSV  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +     N G  ++ V  FLF+  P+FL QGL  GV+G+ GLG +RISLPSQ A+ F   R
Sbjct  140  QSTTGSNPGPNVT-VSQFLFACAPTFLLQGLAAGVSGMAGLGRTRISLPSQFASAFSFDR  198

Query  658  KXAVCLSSS  684
              A+CLSSS
Sbjct  199  TFAICLSSS  207



>dbj|BAA03413.1| EDGP precursor [Daucus carota]
Length=433

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 110/199 (55%), Gaps = 18/199 (9%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            TI+ AQ  F P A+V+PV KD  T QYV  +     L    LVVD+GG FLW D    + 
Sbjct  16   TITQAQPSFRPSALVVPVKKDASTLQYVTTINQRTPLVSENLVVDLGGRFLWVDCDQNYV  75

Query  322  SSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  471
            SS+   + C + +CS++    C           +N  C +  ENPV   A  G + ED +
Sbjct  76   SSTYRPVRCRTSQCSLSGSIACGDCFNGPRPGCNNNTCGVFPENPVINTATGGEVAEDVV  135

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +VE  D  ++G  ++ VP F+FS  P+ L Q L +GV G+ GLG +RI+LPSQ A+ F  
Sbjct  136  SVESTDGSSSGRVVT-VPRFIFSCAPTSLLQNLASGVVGMAGLGRTRIALPSQFASAFSF  194

Query  652  PRKXAVCLS---SSNGAII  699
             RK A+CLS   SSN  II
Sbjct  195  KRKFAMCLSGSTSSNSVII  213



>ref|XP_002517162.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45325.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=411

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 107/185 (58%), Gaps = 8/185 (4%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS--  339
            AQ    P +  +PV+KD  T QY+ ++  G    P  LV+D+ G  LW D ASS Q S  
Sbjct  20   AQISSSPDSFHLPVTKDLSTLQYITRINHGALQIPTNLVIDLDGAHLWLDCASSEQVSSS  79

Query  340  ---IPCGSLKCSMANP--KGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  504
               IP  S++CSMA P  K C  +  C++  +N + ++  +G L ED +A+  +D  N+G
Sbjct  80   LRLIPSCSIQCSMAKPGHKSCNHHSSCDIFTQNGIIQLVKTGELVEDVLAIPSVDGSNSG  139

Query  505  SFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
            +    + NF+ +  P+ L  GL +G  G+LGLG S+I+L SQLA  F   RK A CLSSS
Sbjct  140  TNF-EIENFILACAPATLLDGLASGAQGMLGLGRSKIALQSQLAARFDFHRKFATCLSSS  198

Query  685  NGAII  699
            NG I+
Sbjct  199  NGVIL  203



>ref|XP_009595035.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=436

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 109/189 (58%), Gaps = 16/189 (8%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  330
            + Q  F P+A+++PV+KD  T QY  Q+     L P+KL + +GG  LW D    + SS+
Sbjct  22   IGQTAFQPKALLLPVTKDSSTLQYTTQIGQRTPLVPIKLTIHLGGQTLWVDCEDGYVSST  81

Query  331  QGSIPCGSLKCSMANPKGC----------TSNEICELQFENP-VSKMAGSGVLKEDTIAV  477
                 CGS++C++A    C           SN  C    ENP +  +   G + ED +++
Sbjct  82   YRPARCGSVQCTLAKVNTCGDCNTTPRIGCSNNACYNTPENPFIKTLYDGGEITEDVLSI  141

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  D  N G F+  +P+F+F+ VP+FL +GL +GV G +GLG + I+LPSQLA  F  PR
Sbjct  142  QSTDGSNPGKFV-KIPSFIFTCVPTFLTEGLASGVKGTVGLGRNGIALPSQLAQVFSFPR  200

Query  658  KXAVCLSSS  684
            K A+CLSSS
Sbjct  201  KFALCLSSS  209



>ref|XP_002277699.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=435

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 15/190 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            SLAQ  F P+A+V+PVSKD  + QY+  +    +L  + L +D+GG FLW D    + SS
Sbjct  21   SLAQTSFRPKALVLPVSKDAASLQYITHINQRTHLVSIPLTLDLGGQFLWVDCDQGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            S   + CGS +CS+   K C           +   C L  +N V+  A SG + ED +++
Sbjct  81   SYRPVRCGSAQCSLTRSKACGECFSGPVKGCNYSTCVLSPDNTVTGTATSGEVGEDAVSI  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  D  N G  +S V   LF+   +FL +GL + V G+ GLG SR++LPSQ ++ F   R
Sbjct  141  QSTDGSNPGRVVS-VRRLLFTCGSTFLLEGLASRVKGMAGLGRSRVALPSQFSSAFSFNR  199

Query  658  KXAVCLSSSN  687
            K ++CLSSS 
Sbjct  200  KFSICLSSST  209



>ref|XP_010038106.1| PREDICTED: basic 7S globulin 2-like [Eucalyptus grandis]
Length=438

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 107/193 (55%), Gaps = 18/193 (9%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q+ F P+A+V+PVSKD  T QY+ ++     L P+ LVVD+GG FLW D    + SS+  
Sbjct  25   QQSFRPKALVLPVSKDASTLQYLTRISQRTPLVPVDLVVDLGGQFLWVDCEQNYVSSTYR  84

Query  337  SIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
               CGS  CS+A   GC           +N  C +  +N V+  A  G +  D ++V   
Sbjct  85   PARCGSAVCSLARASGCGDCSSAAGPGCNNNTCGVIPDNTVTHTATGGEVATDLVSVNST  144

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            D  N G  + +V  F+F+  PS L  GL  GV G+ GLG +RI+LPSQ A+ F   RK A
Sbjct  145  DGSNPGRAV-NVTRFVFACAPSSLLGGLAKGVEGMAGLGRTRIALPSQFASAFSFDRKFA  203

Query  667  VCLSS---SNGAI  696
            +CLSS   SNG I
Sbjct  204  ICLSSSTTSNGVI  216



>gb|KDP40108.1| hypothetical protein JCGZ_02106 [Jatropha curcas]
Length=425

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 106/186 (57%), Gaps = 18/186 (10%)
 Frame = +1

Query  193  IVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWAS---SSQGSIPCGSLKC  363
            +++PVSKD  T QY+ Q+  G +  P KLV+D+GGPFLW D +S   S +  IP  S++C
Sbjct  32   VLLPVSKDLATLQYMTQIYHGTSGMPTKLVIDLGGPFLWHDCSSGKVSYEHLIPSCSIQC  91

Query  364  SMANP-----KGCTSN---------EICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            +MA       K C S+           C++   N +++    G L ED IAV  +D   +
Sbjct  92   AMAKKFHTEQKNCFSDTSRSEEQYPSTCDISTRNGITRSRTRGELAEDVIAVRTVDGTKS  151

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  +  + NFLF+   + L  GL  G  G+LGLG + I+LPSQLA  F + +K A CLSS
Sbjct  152  GKIV-EIDNFLFACASTALLDGLAGGAQGMLGLGRTPIALPSQLAAKFDLDKKFAACLSS  210

Query  682  SNGAII  699
            SNG I+
Sbjct  211  SNGVIL  216



>ref|XP_002280508.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=388

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 106/178 (60%), Gaps = 20/178 (11%)
 Frame = +1

Query  190  AIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSL  357
            ++++PV+KD  T QYV Q+  G  L P+KLV+D+G PFLW D      SSS   I CGS+
Sbjct  22   SLLLPVTKDAATLQYVTQIHHGTPLVPIKLVLDLGAPFLWLDCSSGHVSSSNTPILCGSI  81

Query  358  KCSMANPK-----GCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHV  522
            +C  A        G TS   C L  +N ++ +A +G L ED +AVE       GS +   
Sbjct  82   QCLTAKTSDSGHGGGTST--CRLSPKNTITGLAEAGELAEDMVAVE-------GSEMG--  130

Query  523  PNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGAI  696
              FLFS  P  L +GL +G  G+LGLG +RI+LPSQLA + G+ RK AVCLSSS G +
Sbjct  131  SRFLFSCAPKPLLKGLASGTVGMLGLGRTRIALPSQLAASVGLHRKFAVCLSSSEGTV  188



>ref|XP_007034629.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY05555.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=436

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 105/183 (57%), Gaps = 15/183 (8%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q  F P+A+V+PVSKD  T+QYV Q++    L P+KL +D+GG FLW D    + SSS  
Sbjct  24   QASFRPKALVLPVSKDASTNQYVTQIKQRTPLVPVKLTLDLGGEFLWVDCDQGYVSSSYM  83

Query  337  SIPCGSLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELI  486
               C S +CS+A  K C S          N  C L   N V++ A  G + +D ++V+  
Sbjct  84   PARCNSAQCSLARSKSCGSCFDGPKPGCNNNTCGLPPANTVTRTATGGEVAQDVVSVQST  143

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            +  N G  +S VP FLF+   +FL +GL +GV G+ GLG ++IS+ SQ A  F   RK A
Sbjct  144  NGKNPGQVVS-VPKFLFTCGSTFLLEGLASGVKGMAGLGRTKISMSSQFAAAFSFHRKFA  202

Query  667  VCL  675
            VCL
Sbjct  203  VCL  205



>ref|XP_004495218.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=436

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 114/195 (58%), Gaps = 16/195 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            + +Q+ F P+A+V+PV+KD  T+ QY+AQ+     L PL LVVD+GG FLW D    + S
Sbjct  23   TFSQQSFRPKALVLPVTKDTSTTNQYIAQINQRTPLVPLNLVVDLGGQFLWLDCEQHYTS  82

Query  325  SSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S+     C S +CS+A    C           +N  C +  +N V+  A SG L ED ++
Sbjct  83   STYRPARCRSAQCSLAKSTACGDCFSSPKPGCNNNTCSIFPDNTVTHTATSGELAEDVLS  142

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  +  N    ++ V  FLFS  P+ L +GL +G +G+ GLG ++I+ PSQLA+ F   
Sbjct  143  IQSTNGFNPTQNVA-VSRFLFSCAPTSLLEGLASGASGMAGLGRTKIAFPSQLASAFSFD  201

Query  655  RKXAVCLSSSNGAII  699
            RK A+C SSS+G ++
Sbjct  202  RKFAICFSSSDGVVL  216



>ref|XP_002517164.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45327.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=433

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 106/193 (55%), Gaps = 16/193 (8%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  330
            ++Q  F P+A+++PV+KD  T  Y  Q      L P+  ++D+GG +LW D    + SS+
Sbjct  21   ISQTSFRPKALLLPVTKDPSTLLYFTQFNQRTPLVPVHTILDLGGLYLWVDCDRGYVSST  80

Query  331  QGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAV  477
                 C S +C++AN  GC +           N  C L  +N V+ +   G L +D +++
Sbjct  81   YRPARCNSAQCNLANANGCITACFDAPRPGCNNNTCALLVDNTVTNIGTDGELGQDVVSL  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  D  N G  +S V NFLF   PSF+  GL +G  G+ GLG +++SLPSQ A  F   R
Sbjct  141  QSTDGSNPGRVVS-VSNFLFVCAPSFILNGLPSGTEGMAGLGRTKVSLPSQFAAAFSFNR  199

Query  658  KXAVCLSSSNGAI  696
            K A+CLSSS G +
Sbjct  200  KFAICLSSSKGVV  212



>ref|XP_011462765.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 110/194 (57%), Gaps = 17/194 (9%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DW  318
            AT SLA+  F P+A+V+PV+K  PT QY+  ++    L P++L +D+GG FLW     D+
Sbjct  21   ATPSLAKTSFRPKALVLPVAKHSPTHQYLTSIKQRTPLVPVRLTLDLGGQFLWVDCQQDY  80

Query  319  ASSSQGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGS-GVLKE  462
             SS+     C S +CS+AN K CT+           N  C +  +N V   AG+ G + +
Sbjct  81   VSSTYKPARCNSAQCSLANSKACTTECNSSPRPGCNNNTCSVLPDNSVIPTAGNGGEVGQ  140

Query  463  DTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANT  642
            D +++   D  N  + +S VPNFLF+   +FL   L +GV G+ GLG + I LPS  A+ 
Sbjct  141  DVVSLHSTDGSNPTTLVS-VPNFLFACAETFLLDRLASGVKGMAGLGRANIGLPSLFASA  199

Query  643  FGIPRKXAVCLSSS  684
            F   RK A+CL SS
Sbjct  200  FSFKRKFAICLPSS  213



>dbj|BAK57511.1| extracellular dermal glycoprotein [Nicotiana benthamiana]
Length=440

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 108/192 (56%), Gaps = 15/192 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +T +  Q  F P+ +++P++KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  22   STTAQNQTSFRPKGLILPITKDASTFQYLTQIQQRTPLVPVSLTLDLGGQFLWVDCDQGY  81

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SSS     C S +CS+A   GC           +N+ C L  +N V++ A SG L  DT
Sbjct  82   VSSSYKPARCRSAQCSLARAGGCGQCFSPPKPGCNNDTCGLIPDNTVTQTATSGELASDT  141

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            + V+  +  N G  +    +FLF    +FL + L +GV G+ GLG +RISLPSQ +  F 
Sbjct  142  VQVQSSNGKNPGRNVVD-KDFLFVCGSTFLLKRLASGVKGMAGLGRTRISLPSQFSAEFS  200

Query  649  IPRKXAVCLSSS  684
             PRK AVCLSSS
Sbjct  201  FPRKFAVCLSSS  212



>ref|XP_006345120.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=437

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 106/183 (58%), Gaps = 19/183 (10%)
 Frame = +1

Query  187  RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGS  354
            +A ++PV+KD  T QY+ Q+     L P+KL + +GG  LW D    + SS+   + CGS
Sbjct  32   KAFILPVTKDSSTLQYITQIGQRTPLVPIKLTIHLGGQTLWVDCENGYVSSTYQPLLCGS  91

Query  355  LKCSMAN-----------PK-GCTSNEICELQFENP-VSKMAGSGVLKEDTIAVELIDEP  495
             +C++A            PK GC  N  C    ENP +  +   G L ED ++++  D  
Sbjct  92   TQCTIAKVDTCANCSTSAPKIGCNDNA-CYNTPENPFIKTLYSGGQLNEDVLSIQSTDGS  150

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G F+  +PNF+F+  P+FL +GL + V G +GLG +RI+LPSQLA  F  PRK AVCL
Sbjct  151  NPGKFV-KIPNFIFTCAPTFLTEGLASEVKGTVGLGRNRIALPSQLAEIFSFPRKFAVCL  209

Query  676  SSS  684
            SSS
Sbjct  210  SSS  212



>ref|XP_010522713.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=429

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            + AQ+ F P+A+V+PV+KD  T QY+A +     L P+KLVVD+GG F W D    + SS
Sbjct  20   TFAQQSFRPKALVLPVTKDASTLQYLATINQRTPLVPVKLVVDLGGQFQWVDCDKGYISS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     C S  CS+A    C           +N  C +  +N V++ A SG L +D +++
Sbjct  80   TYRPARCRSAVCSLARSTSCGDCFSAPRPGCNNNTCGVFPDNTVTRTATSGELAQDVVSI  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            E  D  N G  ++ VP F+ +   +FL  GL NG  G+ GLG + I+LPSQ A  F   R
Sbjct  140  ESTDGSNPGRVVT-VPRFVLACGSTFLLDGLANGAMGMAGLGRTNIALPSQFAAAFSFRR  198

Query  658  KXAVCLSSSNGAI  696
            K AVCLSS  G +
Sbjct  199  KFAVCLSSGRGVV  211



>gb|AAX81588.1| nectarin IV [Nicotiana langsdorffii x Nicotiana sanderae]
Length=437

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 108/192 (56%), Gaps = 15/192 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +T +  Q  F P+ +++P++KD  T QY+ Q+    +L P+ L +D+GG FLW D    +
Sbjct  19   STTAQNQTSFRPKGLILPITKDASTLQYLTQIHQRTHLVPVSLTLDLGGQFLWVDCDQGY  78

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SSS     C S +CS+A   GC           +N  C L  +N +++ A SG L  D 
Sbjct  79   VSSSYKPARCRSAQCSLAGAGGCGQCFSPPKPGCNNNTCSLLPDNTITRTATSGELASDI  138

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            + V+  +  N G  ++   +FLF    +FL +GL +GV G+ GLG +RISLPSQ +  F 
Sbjct  139  VQVQSSNGKNPGRNVTD-KDFLFVCGSTFLLEGLASGVKGMAGLGRTRISLPSQFSAEFS  197

Query  649  IPRKXAVCLSSS  684
             PRK AVCLSSS
Sbjct  198  FPRKFAVCLSSS  209



>emb|CAN61502.1| hypothetical protein VITISV_011733 [Vitis vinifera]
Length=415

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 102/176 (58%), Gaps = 7/176 (4%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSIP  345
            AQ  F P A+VIPVSKD  T QYV  +     L PL+LVVD+GG FLW D   +   S  
Sbjct  22   AQSSFRPHALVIPVSKDSSTLQYVTSINQRTPLVPLQLVVDLGGQFLWVDCEQNYVSS--  79

Query  346  CGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVP  525
              S +     P GC +N  C +  +N V++ A S  L ED ++V+  D  N G  +S V 
Sbjct  80   --SYRPGAVQP-GC-NNNTCSVLPDNTVTRTASSDELAEDAVSVQSTDGSNPGRSVS-VS  134

Query  526  NFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGA  693
             FLFS  P+ L +GL +G  G+ GLG +RI+LPSQ A+ F   RK A+CLSSS  A
Sbjct  135  KFLFSCAPTSLLEGLASGAKGMAGLGRTRIALPSQFASAFSFHRKFAICLSSSTTA  190



>ref|XP_004229433.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=444

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 106/199 (53%), Gaps = 18/199 (9%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            ++SLA+ P  PRA ++PV+KD  T QYV  +     L P+KL +D+G  FLW D    + 
Sbjct  19   SLSLAKTPTRPRAFLLPVTKDASTKQYVTTIDQRTPLVPIKLTIDLGQRFLWVDCEKGYV  78

Query  322  SSSQGSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDT  468
            SSS   +PCGS+ C  +    C            +N  C     NP  + +  G L +D 
Sbjct  79   SSSYKPVPCGSIPCKRSFSGACVESCIGPPSPGCNNNTCSHIPYNPFIRTSTGGELAQDV  138

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++++  D  N   +LS     +F   P  L QGL  GV G+LGLGN  +  P+QLAN F 
Sbjct  139  VSLQSTDGSNPRKYLSTTNGVVFDCAPHSLLQGLAKGVKGILGLGNGYVGFPTQLANAFS  198

Query  649  IPRKXAVCLSSSN---GAI  696
            IPRK A+CL+SS    GAI
Sbjct  199  IPRKFAICLTSSTTSRGAI  217



>ref|XP_002311834.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
 gb|EEE89201.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
Length=437

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 113/195 (58%), Gaps = 16/195 (8%)
 Frame = +1

Query  160  SLAQRPFFP-RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            S AQ P  P R++V+PV+KD  T Q++  +  G +  P+++V+D+G P LW D      S
Sbjct  23   SCAQIPNSPIRSLVLPVTKDPATFQFLTTIYHGTSREPIRVVLDLGCPSLWLDCSSGRLS  82

Query  325  SSQGSIPCGSLKCSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIA  474
            SS+  IP  S++C+ A P   +              C L  EN +++ A  G L ED + 
Sbjct  83   SSRRLIPSCSIQCAAAKPNNMSCAFSAAMPTRKRTACGLSTENSIARSATRGELVEDILT  142

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            VE +D   AG  ++ V +FLFS  P FL   L  G  G+LGLG SRI+LPSQLA+ FG+ 
Sbjct  143  VESVDGSKAGP-VTTVDHFLFSCAPRFLLNRLARGAQGMLGLGKSRIALPSQLASKFGLQ  201

Query  655  RKXAVCLSSSNGAII  699
            RK A CLSSS+G I+
Sbjct  202  RKFATCLSSSDGLIL  216



>gb|KCW49914.1| hypothetical protein EUGRSUZ_K03381, partial [Eucalyptus grandis]
Length=413

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 106/192 (55%), Gaps = 18/192 (9%)
 Frame = +1

Query  172  RPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGS  339
            + F P+A+V+PVSKD  T QY+ ++     L P+ LVVD+GG FLW D    + SS+   
Sbjct  1    QSFRPKALVLPVSKDASTLQYLTRISQRTPLVPVDLVVDLGGQFLWVDCEQNYVSSTYRP  60

Query  340  IPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELID  489
              CGS  CS+A   GC           +N  C +  +N V+  A  G +  D ++V   D
Sbjct  61   ARCGSAVCSLARASGCGDCSSAAGPGCNNNTCGVIPDNTVTHTATGGEVATDLVSVNSTD  120

Query  490  EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAV  669
              N G  + +V  F+F+  PS L  GL  GV G+ GLG +RI+LPSQ A+ F   RK A+
Sbjct  121  GSNPGRAV-NVTRFVFACAPSSLLGGLAKGVEGMAGLGRTRIALPSQFASAFSFDRKFAI  179

Query  670  CLSS---SNGAI  696
            CLSS   SNG I
Sbjct  180  CLSSSTTSNGVI  191



>gb|ACM68432.1| xyloglucanase-specific endoglucanase inhibitor protein [Petunia 
x hybrida]
Length=436

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 109/195 (56%), Gaps = 15/195 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +TI  AQ  F P+ +++PV+KD  T QY+ Q+     L P+ L +D+GG FLW D    +
Sbjct  19   STIVHAQTSFRPKGLILPVTKDASTLQYLTQISQRTPLVPVSLTLDLGGQFLWVDCDQGY  78

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SSS     C S KCS+A   GC           +N  C    +N +++ A SG L  D 
Sbjct  79   VSSSYIPARCRSAKCSLAGSSGCGDCFSPPSPGCNNNTCGAFPDNSITRTATSGELASDI  138

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            ++V+  +  N G  +S   +FLF    +FL  GL +GV G+ GLG +RISLPSQ +  F 
Sbjct  139  VSVQSSNGKNPGRNVSD-KDFLFVCGATFLLNGLASGVKGMAGLGRTRISLPSQFSAEFS  197

Query  649  IPRKXAVCLSSSNGA  693
             PRK AVCLSS++ +
Sbjct  198  FPRKFAVCLSSTSNS  212



>ref|XP_002517165.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45328.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=434

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 108/192 (56%), Gaps = 16/192 (8%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q  F P+A+V+PVS+D  T QY+  +     L P+KL +D+GG +LW D    + SSS  
Sbjct  23   QTSFRPKALVLPVSRDPSTLQYLTSINQRTPLVPVKLTLDLGGQYLWVDCDQGYVSSSYK  82

Query  337  SIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVEL  483
             + C S +CS+A  K C S           N+ C L  +N V+    SG + +D + V+ 
Sbjct  83   PVRCRSAQCSLAKSKSCISECFSSPRPGCNNDTCALLPDNTVTHSGTSGEVGQDVVTVQS  142

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             D  + G  +S VP  +F+   +FL +GL +GV G+ GLG ++ISLPSQ +  F   RK 
Sbjct  143  TDGFSPGRVVS-VPKLIFTCATTFLLEGLASGVKGMAGLGRTKISLPSQFSAAFSFDRKF  201

Query  664  AVCLSSSNGAII  699
            A+CL+SSN   I
Sbjct  202  AICLTSSNAKGI  213



>gb|KDO74795.1| hypothetical protein CISIN_1g037976mg [Citrus sinensis]
Length=435

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 109/197 (55%), Gaps = 19/197 (10%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+A+  F P+A+V+PV+KD  T QY+ Q++    L P+KL +D+GG FLW D    + SS
Sbjct  20   SIAKTSFRPKALVLPVTKDGSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVDCEKEYVSS  79

Query  328  SQGSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S    PC S  CS+AN           P+    N  C L  EN ++ ++  G +  D  +
Sbjct  80   SYTFAPCHSAPCSLANAPYCFECHGIKPRPGCHNNTCNLLPENTINGISFFGGVSMDVAS  139

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S VP  LF    SFL   L  GV G+ GLG ++ISLPS  ++ F   
Sbjct  140  IQSTDGKNPGKVVS-VPKLLFVCSDSFLLTDLAKGVTGMAGLGRTKISLPSLFSSAFSFK  198

Query  655  RKXAVCLSSS---NGAI  696
            RK A+CLSSS   NGA+
Sbjct  199  RKFAICLSSSTEANGAV  215



>pdb|3VLB|A Chain A, Crystal Structure Of Xeg-edgp
 pdb|3VLB|C Chain C, Crystal Structure Of Xeg-edgp
Length=413

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 106/194 (55%), Gaps = 18/194 (9%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q  F P A+V+PV KD  T QYV  +     L    LVVD+GG FLW D    + SS+  
Sbjct  1    QPSFRPSALVVPVKKDASTLQYVTTINQRTPLVSENLVVDLGGRFLWVDCDQNYVSSTYR  60

Query  337  SIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
             + C + +CS++    C           +N  C +  ENPV   A  G + ED ++VE  
Sbjct  61   PVRCRTSQCSLSGSIACGDCFNGPRPGCNNNTCGVFPENPVINTATGGEVAEDVVSVEST  120

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            D  ++G  ++ VP F+FS  P+ L Q L +GV G+ GLG +RI+LPSQ A+ F   RK A
Sbjct  121  DGSSSGRVVT-VPRFIFSCAPTSLLQNLASGVVGMAGLGRTRIALPSQFASAFSFKRKFA  179

Query  667  VCLS---SSNGAII  699
            +CLS   SSN  II
Sbjct  180  MCLSGSTSSNSVII  193



>ref|XP_006489309.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=435

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 109/197 (55%), Gaps = 19/197 (10%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+A+  F P+A+V+PV+KD  T QY+ Q++    L P+KL +D+GG FLW D    + SS
Sbjct  20   SIAKTSFRPKALVLPVTKDGSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVDCEKEYVSS  79

Query  328  SQGSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S    PC S  CS+AN           P+    N  C L  EN ++ ++  G +  D  +
Sbjct  80   SYTFAPCHSAPCSLANAPYCFECHGIKPRPGCHNNTCNLLPENTINGISFFGGVSMDVAS  139

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S VP  LF    SFL   L  GV G+ GLG ++ISLPS  ++ F   
Sbjct  140  IQSTDGKNPGKVVS-VPKLLFVCSDSFLLTDLAKGVTGMAGLGRTKISLPSLFSSAFSFK  198

Query  655  RKXAVCLSSS---NGAI  696
            RK A+CLSSS   NGA+
Sbjct  199  RKFAICLSSSTEANGAV  215



>emb|CDO98879.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 104/189 (55%), Gaps = 16/189 (8%)
 Frame = +1

Query  160  SLAQRP-FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            S+AQ   F PRA+V+P++KD  T QY+ QL     L  ++L VD+GG FLW D    + S
Sbjct  19   SIAQTTSFRPRALVLPLTKDSATGQYITQLSQRTPLVAIRLTVDLGGQFLWVDCDRNYIS  78

Query  325  SSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  474
            SS     C S  C++AN K C           +N  C L   NP  + + SG L +D ++
Sbjct  79   SSYRPARCRSAVCNLANSKACGQCNGSPRPGCNNNTCGLSPYNPFIRTSTSGELAQDVVS  138

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S  P   F+  P+FL +GL  GV G+ GLG   I LPSQLA+ F  P
Sbjct  139  LQSTDGSNPGRIVS-APRVAFTCGPTFLLEGLAKGVVGMAGLGRGPIGLPSQLASAFSFP  197

Query  655  RKXAVCLSS  681
            RK A+CL S
Sbjct  198  RKFAICLGS  206



>pdb|3VLA|A Chain A, Crystal Structure Of Edgp
Length=413

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 105/191 (55%), Gaps = 18/191 (9%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P A+V+PV KD  T QYV  +     L    LVVD+GG FLW D    + SS+   + 
Sbjct  4    FRPSALVVPVKKDASTLQYVTTINQRTPLVSENLVVDLGGRFLWVDCDQNYVSSTYRPVR  63

Query  346  CGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            C + +CS++    C           +N  C +  ENPV   A  G + ED ++VE  D  
Sbjct  64   CRTSQCSLSGSIACGDCFNGPRPGCNNNTCGVFPENPVINTATGGEVAEDVVSVESTDGS  123

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            ++G  ++ VP F+FS  P+ L Q L +GV G+ GLG +RI+LPSQ A+ F   RK A+CL
Sbjct  124  SSGRVVT-VPRFIFSCAPTSLLQNLASGVVGMAGLGRTRIALPSQFASAFSFKRKFAMCL  182

Query  676  S---SSNGAII  699
            S   SSN  II
Sbjct  183  SGSTSSNSVII  193



>ref|XP_011014389.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=435

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 112/195 (57%), Gaps = 16/195 (8%)
 Frame = +1

Query  160  SLAQRPFFP-RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS---  327
            S AQ P  P R +V+PV+KD  T QY+  +  G +  P+++V+D+G P LW   +S    
Sbjct  23   SCAQIPNSPIRFLVLPVTKDPATFQYLTTIHHGTSREPVRVVLDLGCPSLWLACSSGRLS  82

Query  328  -SQGSIPCGSLKCSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIA  474
             S+  IP  S++C  A P   +           +  C L  EN +++ A  G L ED + 
Sbjct  83   LSRRLIPSCSIQCPAAKPNNMSCAFSAVMPTRKSTACGLSTENCITRSATRGELVEDILT  142

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            V+ +D   +G  ++ V +FLFS VP FL   L  G  G+LGLG SRI+LPSQLA+ FG+ 
Sbjct  143  VQSVDGSKSGP-VTIVDHFLFSCVPRFLLNRLAGGAQGMLGLGKSRIALPSQLASKFGLQ  201

Query  655  RKXAVCLSSSNGAII  699
            RK A CLSSS+G I+
Sbjct  202  RKFATCLSSSDGLIL  216



>ref|XP_006345119.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=436

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 105/182 (58%), Gaps = 17/182 (9%)
 Frame = +1

Query  187  RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGS  354
            +A ++PV+KD  T QYV Q+     L P+KL + +GG   W D    + SS+     CGS
Sbjct  31   KAFILPVTKDSSTLQYVTQIGQRTPLVPIKLTIHLGGQTFWVDCENGYVSSTYRPALCGS  90

Query  355  LKCSMAN-----------PKGCTSNEICELQFENP-VSKMAGSGVLKEDTIAVELIDEPN  498
             +C++A            PK   +N  C    ENP +  +   G + ED ++++  D  N
Sbjct  91   TQCTIAKVNTCGNCSTSAPKIGCNNNACYNTPENPFIKTLYSGGEINEDVLSIQSTDGTN  150

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
             G F+  +P+F+F+ VP+FL +GL +GV G +GLG +RI+LPSQLA  F  PRK AVCLS
Sbjct  151  PGKFV-KIPSFIFTCVPTFLTEGLASGVKGTVGLGRNRIALPSQLAEIFSFPRKFAVCLS  209

Query  679  SS  684
            SS
Sbjct  210  SS  211



>gb|KDO74789.1| hypothetical protein CISIN_1g014679mg [Citrus sinensis]
Length=420

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 109/183 (60%), Gaps = 7/183 (4%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ  F P+A+V+ V+KD  T QYV Q++    L P+KL V +GG  LW D    + SS+ 
Sbjct  23   AQTSFRPKALVLRVAKDTATLQYVTQIKQRTPLVPVKLTVHLGGNILWVDCEKGYVSSTN  82

Query  334  GSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  513
             +  CGS +C++AN K C          +NP+S     G ++ D ++++  D  N G  +
Sbjct  83   KTARCGSAQCNLANAKACGGGICGAGP-DNPISNTGTHGDIRIDVLSIQSTDGRNPGRAV  141

Query  514  SHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS-SNG  690
            + VPNF+F     F+ QGL +GV G+ GLG S+++LPSQLA  F + RK A+CLS   +G
Sbjct  142  T-VPNFIFLCGSEFVLQGLASGVVGIAGLGRSKVALPSQLAAAFSLKRKFALCLSPFDDG  200

Query  691  AII  699
            AI+
Sbjct  201  AIV  203



>ref|XP_006419822.1| hypothetical protein CICLE_v10007187mg [Citrus clementina]
 gb|ESR33062.1| hypothetical protein CICLE_v10007187mg [Citrus clementina]
Length=422

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 109/187 (58%), Gaps = 10/187 (5%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  330
            +AQ  F P+A+V+PV KD  T QY+ Q++    L P+KL V +GG  LW D    + SS+
Sbjct  21   VAQTSFRPKALVLPVQKDAATLQYITQIKQRTPLVPVKLAVHLGGNILWVDCEKGYVSST  80

Query  331  QGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSF  510
              +  CGS +C++AN K      IC     NP+S    SG ++ D ++++  +  N G  
Sbjct  81   NKTARCGSAQCNLANAK-ACGGGICGAGVNNPISNTGTSGDIRIDVLSIQSTNGRNPGRA  139

Query  511  LSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS----  678
            ++ VPNF+F     F+ QGL NGV G+ GLG S+++LP QLA  F   RK A+CLS    
Sbjct  140  VT-VPNFIFLCGSEFVLQGLANGVVGIAGLGRSKVALPLQLAAAFSFDRKFAICLSPAFP  198

Query  679  SSNGAII  699
             +NG II
Sbjct  199  RTNGVII  205



>ref|XP_007201544.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
 gb|EMJ02743.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
Length=412

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 100/180 (56%), Gaps = 15/180 (8%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P+A+VIPVSKD  T QY   +     L P+ LV+D+GG FLW D    + SS+     
Sbjct  2    FRPKALVIPVSKDASTLQYTTHITQRTPLVPINLVLDLGGQFLWVDCEQNYVSSTYRPAR  61

Query  346  CGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            C S +CS+A   GC           +N  C L  +N V+  A  G L  D ++V   +  
Sbjct  62   CRSAQCSLARASGCGDCFSSPKPGCNNNTCGLTPDNTVTGTATGGELAYDVVSVPSTNGF  121

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G  +S V  FLF+  P+FL +GL  GV+G+ GLG +RISLPSQ A+ F   RK A+CL
Sbjct  122  NPGRNVS-VSQFLFTCAPTFLLEGLAAGVSGMAGLGRTRISLPSQFASAFSFDRKFAICL  180



>ref|XP_009611839.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=438

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 108/193 (56%), Gaps = 16/193 (8%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +T +  Q  F P+ +++P++KD  T QY+ Q+     L P+ L +D+GG FLW D    +
Sbjct  19   STTAQNQTSFRPKGLILPITKDASTLQYLTQIHQRTPLVPVSLTLDLGGQFLWLDCDQGY  78

Query  319  ASSSQGSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKED  465
             SSS     C S +CS+A            PK   +N  C L  +N +++ A SG L  D
Sbjct  79   VSSSYKPARCRSAQCSLAGAGSGCGQCFSPPKPGCNNNTCSLLPDNTITRTATSGELASD  138

Query  466  TIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTF  645
            T+ V+  +  N G  ++   +FLF    +FL +GL +GV G+ GLG +RISLPSQ +  F
Sbjct  139  TVQVQSSNGKNPGRNVTD-KDFLFVCGATFLLEGLASGVKGMAGLGRTRISLPSQFSAEF  197

Query  646  GIPRKXAVCLSSS  684
              PRK AVCLSSS
Sbjct  198  SFPRKFAVCLSSS  210



>ref|XP_006489578.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 109/187 (58%), Gaps = 10/187 (5%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  330
            +AQ  F P+A+V+PV KD  T QYV Q++    L P+KL V +GG  LW D    + SS+
Sbjct  21   VAQTSFRPKALVLPVQKDAATLQYVTQIKQRTPLVPVKLAVHLGGNILWVDCEKGYLSST  80

Query  331  QGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSF  510
              +  CGS +C++AN K      IC     NP+S    SG ++ D ++++  +  N G  
Sbjct  81   NKTARCGSAQCNLANAK-ACGGGICGAGVNNPISNTGTSGDIRIDVLSIQSTNGGNPGRA  139

Query  511  LSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS----  678
            ++ VPNF+F     F+ QGL NGV G+ GLG S+++LP QLA  F   RK A+CLS    
Sbjct  140  VT-VPNFIFLCGSEFVLQGLANGVVGIAGLGRSKVALPLQLAAAFSFDRKFAICLSPAFP  198

Query  679  SSNGAII  699
             +NG II
Sbjct  199  RTNGVII  205



>gb|ADD71505.1| xyloglucanase inhibitor 3 [Humulus lupulus]
Length=441

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 106/182 (58%), Gaps = 10/182 (5%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P+A+V+ V+KD  T QY   +        +K+ +D+GG FLW D    + SS++  +P
Sbjct  29   FRPKALVLQVTKDSATHQYYTHITQRTPPVQVKVAIDLGGEFLWVDCEKGFNSSTKKPVP  88

Query  346  CGSLKCSMANPKGCTSN-----EICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSF  510
            C S +C++A  K C++N     ++C     NP    + SG L +D I ++  +    G  
Sbjct  89   CRSAQCNLAKSKACSTNGNPSEDVCGEFPHNPFISTSTSGDLSQDIIYIQSTNGSRPGKV  148

Query  511  LSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNG  690
            +S VP F+F+  P+FL +GL +G  GV GLG ++I+LPS  +  F  P+K AVCLSS+NG
Sbjct  149  VS-VPKFIFTCAPTFLLKGLTSGAVGVAGLGRNKIALPSLFSAAFSFPKKMAVCLSSTNG  207

Query  691  AI  696
             +
Sbjct  208  VV  209



>gb|KCW84283.1| hypothetical protein EUGRSUZ_B01135, partial [Eucalyptus grandis]
Length=375

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 103/184 (56%), Gaps = 15/184 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            +Q  F P+A+V+PV+KD  T QY+  L     L P+KL +D+GG FLW D    ++SSS 
Sbjct  24   SQASFRPKAVVLPVTKDSSTLQYLTTLYQRTPLVPVKLTLDLGGKFLWVDCNRGYSSSSY  83

Query  334  GSIPCGSLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVEL  483
                C S +CS+A  K C S          N  C L  +N V++ +  G +  D + V  
Sbjct  84   SPARCRSTQCSLAGSKICISCFTGPLPGCNNNTCGLSPDNTVTRTSTDGEVARDVVVVGS  143

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             D    G  +S VP FLF+   +FL QGL +GV G+ GLG +RISLPSQ + +F   RK 
Sbjct  144  TDGSIPGPVVS-VPKFLFTCGATFLLQGLPSGVQGMAGLGRTRISLPSQFSASFSFDRKF  202

Query  664  AVCL  675
            A+CL
Sbjct  203  AICL  206



>ref|XP_010035593.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=436

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 103/184 (56%), Gaps = 15/184 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            +Q  F P+A+V+PV+KD  T QY+  L     L P+KL +D+GG FLW D    ++SSS 
Sbjct  24   SQASFRPKAVVLPVTKDSSTLQYLTTLYQRTPLVPVKLTLDLGGKFLWVDCNRGYSSSSY  83

Query  334  GSIPCGSLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVEL  483
                C S +CS+A  K C S          N  C L  +N V++ +  G +  D + V  
Sbjct  84   SPARCRSTQCSLAGSKICISCFTGPLPGCNNNTCGLSPDNTVTRTSTDGEVARDVVVVGS  143

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             D    G  +S VP FLF+   +FL QGL +GV G+ GLG +RISLPSQ + +F   RK 
Sbjct  144  TDGSIPGPVVS-VPKFLFTCGATFLLQGLPSGVQGMAGLGRTRISLPSQFSASFSFDRKF  202

Query  664  AVCL  675
            A+CL
Sbjct  203  AICL  206



>ref|XP_007143872.1| hypothetical protein PHAVU_007G109000g [Phaseolus vulgaris]
 gb|ESW15866.1| hypothetical protein PHAVU_007G109000g [Phaseolus vulgaris]
Length=438

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 105/181 (58%), Gaps = 7/181 (4%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            S+AQ  F P+A+V+PV+KD   S  QYV +++    L P+KL VD+GG + W +    + 
Sbjct  20   SIAQTSFRPKALVLPVTKDVSASAPQYVTRIKQRTPLVPVKLTVDLGGGYFWVNCEKGYV  79

Query  322  SSSQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            SS+     CGS +CS+    GC+  +IC     N V+ ++  G +  D +A    D  N 
Sbjct  80   SSTSKPAHCGSAQCSLFGSNGCSGEKICGRSPSNTVTGVSTYGDIHADVVATNSTDGNNP  139

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
               +S VP FLF    + + +GL +GV G+ GLG +++S PSQ A+ F  PRK A+CLSS
Sbjct  140  VRVVS-VPKFLFICGSNVVQKGLASGVRGMAGLGRTKVSFPSQFASAFSFPRKFAICLSS  198

Query  682  S  684
            S
Sbjct  199  S  199



>ref|XP_007034626.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05552.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=420

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 103/187 (55%), Gaps = 13/187 (7%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F   ++  PV KD  T QYVA++  G    P  LV+D+GGPFLW D      SSS   I 
Sbjct  26   FHSNSVFFPVRKDAATLQYVARISHGTPSGPTNLVIDLGGPFLWMDCDSGHVSSSNRLIS  85

Query  346  CGSLKCSMA--------NPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
              S+ CS A        +  GC  N  C +   N ++ +   G L ED IAV+ +     
Sbjct  86   SCSVNCSKAKFHDHGSKSAGGCLCNTDCNVFSYNGITGLTAMGELVEDIIAVDSVGRSEV  145

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  +  V +FLFS  P+FL QGL NG  G LGLG + +SLPSQ +++ G P+K  +CLSS
Sbjct  146  GQ-IKTVDHFLFSCAPTFLLQGLANGSKGTLGLGKASLSLPSQFSSSIGHPQKFFLCLSS  204

Query  682  SNGAIIS  702
            S+G +++
Sbjct  205  SDGVVLT  211



>ref|XP_006419831.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
 gb|ESR33071.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
Length=435

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 109/197 (55%), Gaps = 19/197 (10%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  327
            S+A+  F P+A+V+PV+KD  T QY+ Q++    L P+KL +D+GG FLW     ++ SS
Sbjct  20   SIAKTSFRPKALVLPVTKDGSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVVCEKEYVSS  79

Query  328  SQGSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S    PC S  CS+AN           P+    N  C L  EN ++ ++ +G +  D  +
Sbjct  80   SYRFAPCHSAPCSLANAPYCFECFGTKPRPGCHNNTCNLLPENTINGISFNGPVSMDVAS  139

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S VP  LF    SF    L  GV G+ GLG ++ISLPS  ++ F   
Sbjct  140  IQSTDGKNPGKVVS-VPKLLFVCADSFHLTDLAKGVTGMAGLGRTKISLPSLFSSAFSFK  198

Query  655  RKXAVCLSSS---NGAI  696
            RK A+CLSSS   NGA+
Sbjct  199  RKFAICLSSSTKANGAV  215



>ref|XP_006419832.1| hypothetical protein CICLE_v10005038mg [Citrus clementina]
 gb|ESR33072.1| hypothetical protein CICLE_v10005038mg [Citrus clementina]
Length=420

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 108/183 (59%), Gaps = 7/183 (4%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ    P+A+V+ V+KD  T QYV Q++    L P+KL V +GG  LW D    + SS+ 
Sbjct  23   AQTSLRPKALVLRVAKDTATLQYVTQIKQRTPLVPVKLTVHLGGNILWVDCEKGYVSSTN  82

Query  334  GSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  513
             +  CGS +C++AN K C          +NP+S     G ++ D ++++  D  N G  +
Sbjct  83   KTARCGSAQCNLANAKACGGGICGAGP-DNPISNTGTHGDIRIDVLSIQSTDGRNPGRAV  141

Query  514  SHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS-SNG  690
            + VPNF+F     F+ QGL +GV G+ GLG S+++LPSQLA  F + RK A+CLS   +G
Sbjct  142  T-VPNFIFLCGSEFVLQGLASGVVGIAGLGRSKVALPSQLAAAFSLKRKFALCLSPFDDG  200

Query  691  AII  699
            AI+
Sbjct  201  AIV  203



>ref|XP_006489313.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=420

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 108/183 (59%), Gaps = 7/183 (4%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ    P+A+V+ V+KD  T QYV Q++    L P+KL V +GG  LW D    + SS+ 
Sbjct  23   AQTSLRPKALVLRVAKDTATLQYVTQIKQRTPLVPVKLTVHLGGNILWVDCEKGYVSSTN  82

Query  334  GSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  513
             +  CGS +C++AN K C          +NP+S     G ++ D ++++  D  N G  +
Sbjct  83   KTARCGSAQCNLANAKACGGGICGAGP-DNPISNTGTHGDIRIDVLSIQSTDGRNPGRAV  141

Query  514  SHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS-SNG  690
            + VPNF+F     F+ QGL +GV G+ GLG S+++LPSQLA  F + RK A+CLS   +G
Sbjct  142  T-VPNFIFLCGSEFVLQGLASGVVGIAGLGRSKVALPSQLAAAFSLKRKFALCLSPFDDG  200

Query  691  AII  699
            AI+
Sbjct  201  AIV  203



>ref|XP_003590668.1| Basic 7S globulin [Medicago truncatula]
 gb|AES60919.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=434

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 116/195 (59%), Gaps = 16/195 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            + +++ F P+A+V+PV+KD  T+ QY AQ+     L PL ++VD+GG FLW D    + S
Sbjct  22   TFSKQSFRPKALVLPVTKDVATTNQYKAQINQRTPLVPLNIIVDLGGLFLWVDCENQYIS  81

Query  325  SSQGSIPCGSLKCSMA----------NPKGCTSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S+     C S +CS+A          +PK   +N  C +   N V++ A SG L ED ++
Sbjct  82   STYRPARCRSAQCSLAKFDDCGVCFSSPKPGCNNNTCSVAPGNSVTQSAMSGELAEDILS  141

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  +  N G  +  V  FLFS   +FL +GL +G +G+ GLG ++++LPSQLA+ F   
Sbjct  142  IQSSNGFNPGQNV-MVSRFLFSCARTFLLEGLASGASGMAGLGRNKLALPSQLASAFSFA  200

Query  655  RKXAVCLSSSNGAII  699
            +K A+CLSSS G ++
Sbjct  201  KKFAICLSSSKGVVL  215



>gb|KJB70565.1| hypothetical protein B456_011G080800 [Gossypium raimondii]
Length=434

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 106/194 (55%), Gaps = 18/194 (9%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q  F P+A+++PVSKD  T QY+ Q++    L P+KL +D+GG +LW D    + SSS  
Sbjct  24   QASFRPKALLLPVSKDASTLQYLTQIKQRTPLVPIKLTLDLGGEYLWVDCDQGYVSSSYK  83

Query  337  SIPCGSLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELI  486
               C S +C++A  K C S          N  C L   N V      G + +D ++++  
Sbjct  84   PARCNSAQCNLARSKACGSCFDGPKPGCNNNTCSLLPSNSVKNSGTIGEVAQDVVSIQST  143

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            +  N G  ++ V  FLF+   SFL  GL  GV G+ GLG ++IS+PSQ A  F  PRK A
Sbjct  144  NGKNPGKEVT-VSKFLFTCGSSFLLDGLAGGVKGMAGLGRTKISMPSQFAAAFSFPRKFA  202

Query  667  VCL---SSSNGAII  699
            VCL   S SNG +I
Sbjct  203  VCLSSSSGSNGVVI  216



>ref|XP_006419823.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
 gb|ESR33063.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
Length=422

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 105/187 (56%), Gaps = 9/187 (5%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            ++AQ  F PRA+V+PV K+    QYV Q++    L P+KL V +GG  LW D    + SS
Sbjct  20   AIAQTSFRPRALVLPVQKNAAVFQYVTQIKQRTPLVPVKLAVHLGGNLLWVDCEKGYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  507
            +  +  CGS +C++  P  C    IC     NP+S     G ++ D ++V+  +  + G 
Sbjct  80   TNKTARCGSAQCNLIGPVAC-GGGICGEFPSNPISNTGTFGSIRIDVVSVQSTNGRHPGR  138

Query  508  FLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS---  678
             ++ VPNF+F     F+ QGL  GV G+  LG ++ +LP QLA  F + RK A+CLS   
Sbjct  139  GVT-VPNFIFLCGSEFVLQGLAPGVTGIAALGRTKTALPLQLAAAFSLNRKFAICLSPSA  197

Query  679  SSNGAII  699
             SNG II
Sbjct  198  RSNGVII  204



>ref|XP_006489307.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 105/187 (56%), Gaps = 9/187 (5%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            ++AQ  F PRA+V+PV K+    QYV Q++    L P+KL V +GG  LW D    + SS
Sbjct  20   AIAQTSFRPRALVLPVQKNAAVFQYVTQIKQRTPLVPVKLAVHLGGNLLWVDCEKGYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  507
            +  +  CGS +C++  P  C    IC     NP+S     G ++ D ++V+  +  + G 
Sbjct  80   TNKTARCGSAQCNLIGPVAC-GGGICGEFPSNPISNTGTFGSIRIDVVSVQSTNGRHPGR  138

Query  508  FLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS---  678
             ++ VPNF+F     F+ QGL  GV G+  LG ++ +LP QLA  F + RK A+CLS   
Sbjct  139  GVT-VPNFIFLCGSEFVLQGLAPGVTGIAALGRTKTALPLQLAAAFSLNRKFAICLSPSA  197

Query  679  SSNGAII  699
             SNG II
Sbjct  198  RSNGVII  204



>ref|XP_004236054.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=436

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 101/183 (55%), Gaps = 19/183 (10%)
 Frame = +1

Query  187  RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGS  354
             A ++PV KD  T QY+ Q+     L P+KL + +GG  LW D    + SS+   + CGS
Sbjct  31   EAFILPVKKDSSTLQYITQIGQRTPLVPIKLTIHLGGQTLWVDCENGYVSSTYQPLLCGS  90

Query  355  LKCSMAN-----------PK-GCTSNEICELQFENP-VSKMAGSGVLKEDTIAVELIDEP  495
             +C++A            PK GC  N  C    ENP +  +   G L ED ++++  D  
Sbjct  91   TQCTIAKVDTCGNCSTSAPKIGCNDNA-CYNTPENPFIKTLYSGGQLNEDVLSIQSTDGS  149

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G F+  +PNF+F+  P+FL  GL + V G +GLG +RI+LPSQLA  F   RK  VCL
Sbjct  150  NPGKFV-KIPNFIFTCAPTFLTDGLASEVKGTVGLGRNRIALPSQLAEIFSFTRKFTVCL  208

Query  676  SSS  684
            SSS
Sbjct  209  SSS  211



>gb|AFK42416.1| unknown [Lotus japonicus]
Length=440

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 109/187 (58%), Gaps = 8/187 (4%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----  315
            T S+AQ  F P+A+ +P++KD  +S  QY+ Q++    L P+KL +D+GG +LW +    
Sbjct  23   TSSIAQTSFRPKALALPITKDVTSSLPQYITQIKQRTPLVPVKLTLDLGGGYLWVNCENR  82

Query  316  -WASSSQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDE  492
             + SS+     CGS +CS+    GC+ ++IC     N V+ ++  G +  D ++V   D 
Sbjct  83   QYVSSTFKPARCGSSQCSLFGLTGCSGDKICGRSPSNTVTGVSSYGDIHSDVVSVNSTDG  142

Query  493  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
                  +S VPNFLF      +  GL  GV G+ GLG +R+SLPSQ ++ F   RK A+C
Sbjct  143  TTPTKVVS-VPNFLFICGSKVVQNGLAKGVTGMAGLGRTRVSLPSQFSSAFSFHRKFAIC  201

Query  673  LSSSNGA  693
            L++++GA
Sbjct  202  LTANSGA  208



>gb|KCW49915.1| hypothetical protein EUGRSUZ_K03382 [Eucalyptus grandis]
Length=422

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 103/193 (53%), Gaps = 33/193 (17%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  336
            Q+ F P+A+V+PVSKD  T QYV ++     L P+ LVVD+GG FLW D    + SS+  
Sbjct  24   QQSFRPKALVLPVSKDASTLQYVTRISQRTPLVPVALVVDLGGQFLWVDCEQNYVSSTYL  83

Query  337  SIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
               CGS  CS+A   GC           +N  CE               +  D ++V   
Sbjct  84   PARCGSAVCSLARASGCGDCFSAARPGCNNNTCE---------------VATDLVSVNST  128

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            D  N G  + +V  F+F+  PSFL  GL +GV G+ GLG +RI+LPSQ A+ F   RK A
Sbjct  129  DGSNPGQAV-NVTRFVFACAPSFLLDGLASGVQGMAGLGRTRIALPSQFASAFSFNRKFA  187

Query  667  VCLS---SSNGAI  696
            +CLS   SSNG I
Sbjct  188  ICLSSSPSSNGVI  200



>ref|XP_008222998.1| PREDICTED: basic 7S globulin 2 [Prunus mume]
Length=411

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 104/181 (57%), Gaps = 9/181 (5%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS--IPCGSL  357
            P  ++   +KD  T QY+  +  G  L P KLVVD+GGPFLW +  SSS  S  I  GS+
Sbjct  32   PNVLIFLATKDVSTLQYMTTIHHGTPLVPTKLVVDLGGPFLWLNCGSSSSSSRVISQGSI  91

Query  358  KCSMANPK----GCTSNEICELQFENPVSKMAGSGVLKEDTIAVELID---EPNAGSFLS  516
            +C  A PK    G   N  C +  EN +++MA  G L +D +AV++ID   +  +GS  +
Sbjct  92   QCLAAKPKTHNQGSNDNNKCHVFPENSITQMATQGDLVQDIMAVQVIDGSSKTESGSITT  151

Query  517  HVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGAI  696
               NFLFS  P FL  GL +   G+LGLG ++IS+ SQ++       +  +CLSSSNG I
Sbjct  152  FDSNFLFSCAPIFLLNGLASSARGLLGLGRTQISMASQISAKLSSKLQFMLCLSSSNGVI  211

Query  697  I  699
            +
Sbjct  212  L  212



>ref|XP_010256207.1| PREDICTED: basic 7S globulin 2-like [Nelumbo nucifera]
Length=439

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 113/203 (56%), Gaps = 22/203 (11%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +T + A++P  P A+VIPV KD  T QYVA ++M   LAP+ + VD+ GPFLW D    +
Sbjct  21   STTATARQPR-PNALVIPVKKDAKTLQYVATIKMRTPLAPVNVFVDLSGPFLWVDCEDGY  79

Query  319  ASSSQGSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSK--MAGSGVLK  459
             SSS    PCGS KC +A   GC            +N  C++  +NP  K  + G G L 
Sbjct  80   VSSSYRPTPCGSPKCEVAKSSGCIVECHSAPRPGCTNNTCDVVLDNPFIKDFLYGGG-LA  138

Query  460  EDTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLAN  639
            ED IA++       G  L+ V  F F+   +   QGL  GV G+LGL  + +SLPSQLA+
Sbjct  139  EDVIALQSSGGRKPGGGLAVVRQFPFACADTRNLQGLAVGVKGMLGLARTPVSLPSQLAS  198

Query  640  TFGIPRKXAVCL---SSSNGAII  699
              G+P   ++CL   ++SNG +I
Sbjct  199  KSGLPHIFSLCLPSSTTSNGVMI  221



>ref|XP_009591595.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=440

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 102/188 (54%), Gaps = 16/188 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A+ P  PRA  +PV+KD  T QYV  ++    L P+KL VD+G  F+W D    + SS+ 
Sbjct  23   AKTPPRPRAFFLPVTKDAATKQYVTVIRQRTPLVPIKLTVDLGQRFMWVDCENGYVSSTY  82

Query  334  GSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
              +PCGS+ C  +    C            +N  C     NP  + +  G L ED ++++
Sbjct  83   KPVPCGSIPCKRSLSGACVESCLDPPSPGCNNNTCSHIPYNPFIRTSTGGELAEDIVSLQ  142

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              D  N G+F+S  P  +F   P  L +GL  GV G++GLGN  +  P+Q++N F +PRK
Sbjct  143  STDGSNPGNFISK-PGVVFDCAPKSLLEGLAKGVKGIIGLGNGFVGFPTQMSNAFRVPRK  201

Query  661  XAVCLSSS  684
             AVCLSSS
Sbjct  202  FAVCLSSS  209



>ref|XP_010556788.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=464

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 104/194 (54%), Gaps = 15/194 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            + AQ  F P+A+V+P +KD  T QYVA +     L P+K+VVD+GG F+W +    + SS
Sbjct  55   TFAQISFRPKALVLPTAKDASTLQYVATINQRTPLVPVKVVVDLGGQFMWVNCDKGYVSS  114

Query  328  SQGSIPCGSLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAV  477
            S  ++ C S  CS+A+   C S          N+ C     N  +     G L +D  ++
Sbjct  115  SYRTVRCRSAACSLAHSSTCASCFAGPKPGCNNDTCSAFPGNTAAHTNTIGELAQDVFSI  174

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
               +  N G  ++ VP F+F    +FL +GL  G  G+ GLG ++I+LPSQ A  F   R
Sbjct  175  NSTNGSNPGRAVT-VPRFVFVCGTTFLVEGLAKGAVGMAGLGRTKIALPSQFAAAFSFRR  233

Query  658  KXAVCLSSSNGAII  699
            K AVCLSS  G +I
Sbjct  234  KFAVCLSSGTGVVI  247



>ref|XP_003591797.1| Xyloglucan-specific endoglucanase inhibitor protein [Medicago 
truncatula]
 gb|AES62048.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=436

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 108/185 (58%), Gaps = 7/185 (4%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            SLAQ  F P+A+V+P+++D   S  QY  Q++    L P+ L +D+GG + W +    + 
Sbjct  21   SLAQTSFRPKALVLPITRDTSASTPQYTTQIKQRTPLVPINLTIDLGGGYFWVNCDKSYV  80

Query  322  SSSQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            SS+   I C S +CS+    GC+  +IC     N V+ ++ SG ++ D ++V+  +   +
Sbjct  81   SSTLKPILCSSSQCSLFGSHGCSDKKICGRSPYNIVTGVSTSGDIQSDIVSVQSTNGNYS  140

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G F+S VPNFLF    + +  GL  GV G+ GLG +++SLPSQ ++ F    K A+CL +
Sbjct  141  GRFVS-VPNFLFICGSNVVQNGLAKGVKGMAGLGRTKVSLPSQFSSAFSFKNKFAICLGT  199

Query  682  SNGAI  696
             NG +
Sbjct  200  QNGVL  204



>ref|XP_006419809.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
 gb|ESR33049.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
Length=437

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 108/196 (55%), Gaps = 19/196 (10%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  330
            +AQ  F P+A+++PV+KD  T QY+ Q+     L P+K  +D+GG FLW     D+ SSS
Sbjct  23   IAQTSFRPKALILPVTKDASTLQYLTQINQRTPLVPVKYTLDLGGQFLWVVCLEDYESSS  82

Query  331  QGSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  477
              S PC S  CS+AN           P+   +N  C L  +N ++ ++ +G L  D  ++
Sbjct  83   FTSPPCHSAPCSLANAPFCWDCSDSQPRPGCNNNTCNLLPDNTINGISFNGPLSMDVASI  142

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  +S VP  LF     F    L NGV G+ GLG + ISLPS  ++ F  PR
Sbjct  143  QSTNGKNPGRVVS-VPKLLFVCADRFHLTDLANGVRGMAGLGRNSISLPSLFSSAFSFPR  201

Query  658  KXAVCLSSS---NGAI  696
            K A+CLSSS   NGA+
Sbjct  202  KFAICLSSSTKANGAV  217



>ref|XP_006419811.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
 gb|ESR33051.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
Length=437

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 108/196 (55%), Gaps = 19/196 (10%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  330
            +AQ  F P+A+++PV+KD  T QY+ Q+     L P+K  +D+GG FLW     D+ SSS
Sbjct  23   IAQTSFRPKALILPVTKDASTLQYLTQINQRTPLVPVKYTLDLGGQFLWVVCLEDYESSS  82

Query  331  QGSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  477
              S PC S  CS+AN           P+   +N  C L  +N ++ ++ +G L  D  ++
Sbjct  83   FTSPPCHSAPCSLANAPFCWDCSDSQPRPGCNNNTCNLLPDNTINGISFNGPLSMDVASI  142

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  +S VP  LF     F    L NGV G+ GLG + ISLPS  ++ F  PR
Sbjct  143  QSTNGKNPGRVVS-VPKLLFVCADRFHLTDLANGVRGMAGLGRNSISLPSLFSSAFSFPR  201

Query  658  KXAVCLSSS---NGAI  696
            K A+CLSSS   NGA+
Sbjct  202  KFAICLSSSTKANGAV  217



>ref|XP_006489297.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 108/196 (55%), Gaps = 19/196 (10%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  330
            +AQ  F P+A+++PV+KD  T QY+ Q+     L P+K  +D+GG FLW     D+ SSS
Sbjct  23   IAQTSFRPKALILPVTKDASTLQYLTQINQRTPLVPVKYTLDLGGQFLWVVCLEDYESSS  82

Query  331  QGSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  477
              S PC S  CS+AN           P+   +N  C L  +N ++ ++ +G L  D  ++
Sbjct  83   FTSPPCHSAPCSLANAPFCWDCSDSQPRPGCNNNTCNLLPDNTINGISFNGPLSMDVASI  142

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  +S VP  LF     F    L NGV G+ GLG + ISLPS  ++ F  PR
Sbjct  143  QSTNGKNPGRVVS-VPKLLFVCADRFHLTDLANGVRGMAGLGRNSISLPSLFSSAFSFPR  201

Query  658  KXAVCLSSS---NGAI  696
            K A+CLSSS   NGA+
Sbjct  202  KFAICLSSSTKANGAV  217



>ref|XP_006419826.1| hypothetical protein CICLE_v10006501mg [Citrus clementina]
 gb|ESR33066.1| hypothetical protein CICLE_v10006501mg [Citrus clementina]
Length=419

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 111/194 (57%), Gaps = 17/194 (9%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S A+  F P+A+V+PV+KD  T QY+ Q+Q    L PLKL +D+GG FLW +    + SS
Sbjct  21   SEAKTSFKPKALVVPVTKDSSTLQYLTQIQQRTPLVPLKLTLDLGGGFLWVNCEQGFVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAV  477
            S     CGS +C +A  + C           +N  C     N VS ++  G L  D +++
Sbjct  81   SYKPARCGSAQCKIAGSESCVESCLPKGPGCNNNTCTHFPGNTVSHVSTFGELATDVVSI  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQL-ANTFGIP  654
            +  D    G  +  VPN +F+   +FL +GL +GV G+ GLG +++SLPSQL A  F + 
Sbjct  141  QSTDGSKPGQVVP-VPNIIFACGATFLLEGLASGVQGMAGLGRNKVSLPSQLSAAAFKLD  199

Query  655  RKXAVCLSSSNGAI  696
            RK ++CL SSNGA+
Sbjct  200  RKFSICL-SSNGAV  212



>gb|ADD71504.1| xyloglucanase inhibitor 2 [Humulus lupulus]
Length=445

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 110/195 (56%), Gaps = 16/195 (8%)
 Frame = +1

Query  154  TISLAQRP-FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            T ++A+ P F P+A+++PV+KD  T QY+ Q+     L P+KL V++GG FLW D    +
Sbjct  20   TPTIAETPSFRPKALLLPVTKDASTKQYLTQINQRTPLVPVKLTVNLGGEFLWVDCEKGY  79

Query  319  ASSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  468
             SS+     C S +C++A  K C           +N  C L   NP  + + SG L +D 
Sbjct  80   VSSTYKPARCRSAQCNLAGSKSCGECFDGPKPGCNNNTCGLFPYNPFIRTSTSGELAQDI  139

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            I+++  +  N    +S  PN +F+   +FL +GL +GV G+ GLG  +I+LPSQ A  F 
Sbjct  140  ISIQSTNGSNPSKVVSF-PNVIFTCGSTFLLEGLASGVTGIAGLGRKKIALPSQFAAAFS  198

Query  649  IPRKXAVCLSSSNGA  693
              RK A+CLSSS  A
Sbjct  199  FKRKFALCLSSSTRA  213



>gb|AES60912.2| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=451

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 103/186 (55%), Gaps = 15/186 (8%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPC  348
            P+ +  PV+KD  T+ QY+AQ+     L PL LVVD+GG FLW D    + SS+   + C
Sbjct  40   PKHLFSPVTKDSATTLQYIAQINQRTPLVPLNLVVDLGGKFLWVDCENHYTSSTYRPVRC  99

Query  349  GSLKCSMANPKGCTS---------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
             S +CS+A    C           N  C L  +N ++  A  G L ED ++++     N 
Sbjct  100  PSAQCSLAKSDSCGDCFSSPKPGCNNTCGLIPDNTITHSATRGDLAEDVLSIQSTSGFNT  159

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  +  V  FLFS  P+ L +GL  G +G+ GLG ++I+LPSQLA+ F   RK A C SS
Sbjct  160  GQNVV-VSRFLFSCAPTSLLRGLAGGASGMAGLGRTKIALPSQLASAFIFKRKFAFCFSS  218

Query  682  SNGAII  699
            S+G II
Sbjct  219  SDGVII  224



>emb|CBI32364.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 98/183 (54%), Gaps = 12/183 (7%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S  +  F P A+VIPVSKD  T QY+  +     L P+KLVVD+G  FLW D    + SS
Sbjct  20   SYGKTSFRPDALVIPVSKDASTLQYLTTINQRTPLVPVKLVVDLGAQFLWVDCEQNYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGV-LKEDTIAVELIDEPNAG  504
            S     C S +CS+A   GC     C   F  P      +   L ED ++V+  D  N G
Sbjct  80   SYRPARCRSAQCSLARANGCGD---C---FSAPRPGCNNNTCGLAEDFVSVQSTDGSNPG  133

Query  505  SFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
              +S V  FLFS  P+FL +GL +   G+ GLG +RI+ PSQ A+ F   RK A CLSSS
Sbjct  134  RVVS-VSKFLFSCAPTFLLEGLASSAMGMAGLGRTRIAFPSQFASAFSFHRKFATCLSSS  192

Query  685  NGA  693
              A
Sbjct  193  TTA  195



>gb|KDP40110.1| hypothetical protein JCGZ_02108 [Jatropha curcas]
Length=437

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 103/191 (54%), Gaps = 18/191 (9%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  330
            +AQ  F P+A+V+PV KD  T QYV Q+     L P+ + +D+GG FLW D    + SSS
Sbjct  22   IAQTTFRPKALVLPVQKDSLTLQYVTQINQRTPLVPVNVTLDLGGLFLWVDCEQGYVSSS  81

Query  331  QGSIPCGSLKCSMANPKGCT-------------SNEICELQFENPVSKMAGSGVLKEDTI  471
                 C S +CS+ N + C+             +N  C    +N V      G + +D +
Sbjct  82   YRPARCNSAQCSLINARRCSNEICLGSSPRPGCNNNTCSRFLDNRVISFGTEGEVGQDVV  141

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +V+  D  N G  L+ V N LF+   +F+ +GL NGV G+ GLG +R SLPSQ ++ F  
Sbjct  142  SVQSTDGSNPG-ILASVSNLLFTCARTFILEGLPNGVKGMAGLGRNRASLPSQFSSAFNF  200

Query  652  PRKXAVCLSSS  684
              K AVCL+SS
Sbjct  201  RNKFAVCLTSS  211



>ref|XP_007224886.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
 gb|EMJ26085.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
Length=400

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 16/188 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS--IPCGSL  357
            P+ ++  V+KD  T QY+  +  G  L P KLVVD+GGPFLW +  SSS  S  I  GS+
Sbjct  12   PKGLIFHVTKDVSTLQYMTTIHHGTPLVPTKLVVDLGGPFLWLNCGSSSSSSRLIAQGSI  71

Query  358  KCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVELID---EP  495
            +C  A PK              +N+ C +  EN +++MA  G L +D +A+++ID   + 
Sbjct  72   QCLAAKPKTHNQGSKNYLSSNDNNKKCHVFPENSITQMATQGELVQDIMAIQVIDGSSKT  131

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
             +GS  +   NFLFS  P FL  GL +G  G+LGLG ++IS+ SQ++       +  +CL
Sbjct  132  ESGSITTLDSNFLFSCAPMFLLNGLASGARGMLGLGRTQISMASQISAKLSSKLQFMLCL  191

Query  676  SSSNGAII  699
            SSSNG I+
Sbjct  192  SSSNGVIL  199



>ref|XP_004229432.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=441

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 99/188 (53%), Gaps = 15/188 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A+ P  PRA ++PV+KD  T Q+V  +     L P+KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPPRPRAFLLPVTKDASTKQFVTTINQRTPLVPVKLTIDLGQRFLWVDCEKGYVSSSY  82

Query  334  GSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
              +PCGS+ C  +    C            +N  C     NP  + +  G L +D ++++
Sbjct  83   KPVPCGSIPCKRSFSGACVESCIGPPSPGCNNNTCSHIPYNPFIRTSTGGELAQDVVSLQ  142

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              D  N   +LS     +F   P  L +GL  GV G+LGLGN  +  P+QLAN F IPRK
Sbjct  143  STDGSNPRKYLSTTNGVVFDCAPHSLLEGLAKGVRGILGLGNGYVGFPTQLANAFSIPRK  202

Query  661  XAVCLSSS  684
             A+CL+SS
Sbjct  203  FAICLTSS  210



>ref|XP_006489306.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=394

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 112/187 (60%), Gaps = 20/187 (11%)
 Frame = +1

Query  187  RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS-------IP  345
             +I IPV KD  T QYVA++  G +  P+ LV+D+GGP  W D  SS+  S       IP
Sbjct  23   NSIAIPVVKDASTLQYVAKIHHGVSQVPINLVLDLGGPLTWVDCDSSADVSSSSSRRLIP  82

Query  346  CGSLKCSMA-------NPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE-LIDEPNA  501
              S++CS +       N    T+N  C +  +N +S +A +G L EDTIAV   +++P+ 
Sbjct  83   SQSIQCSRSGKSPVPRNGSDTTTNT-CGVFTQNGISGLATTGDLAEDTIAVRSELEDPS-  140

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
               ++ V  FLFS  P+FL QGL +GV G+LGLG + ISLPSQLA   G  RK  +CLSS
Sbjct  141  ---ITAVDEFLFSCAPTFLLQGLASGVRGMLGLGRAPISLPSQLATGIGHQRKFFMCLSS  197

Query  682  SNGAIIS  702
            SNG ++S
Sbjct  198  SNGVVLS  204



>ref|XP_003590661.1| Basic 7S globulin [Medicago truncatula]
Length=500

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 103/186 (55%), Gaps = 15/186 (8%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPC  348
            P+ +  PV+KD  T+ QY+AQ+     L PL LVVD+GG FLW D    + SS+   + C
Sbjct  32   PKHLFSPVTKDSATTLQYIAQINQRTPLVPLNLVVDLGGKFLWVDCENHYTSSTYRPVRC  91

Query  349  GSLKCSMANPKGCTS---------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
             S +CS+A    C           N  C L  +N ++  A  G L ED ++++     N 
Sbjct  92   PSAQCSLAKSDSCGDCFSSPKPGCNNTCGLIPDNTITHSATRGDLAEDVLSIQSTSGFNT  151

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  +  V  FLFS  P+ L +GL  G +G+ GLG ++I+LPSQLA+ F   RK A C SS
Sbjct  152  GQNVV-VSRFLFSCAPTSLLRGLAGGASGMAGLGRTKIALPSQLASAFIFKRKFAFCFSS  210

Query  682  SNGAII  699
            S+G II
Sbjct  211  SDGVII  216



>ref|XP_003556387.1| PREDICTED: basic 7S globulin [Glycine max]
 gb|KHN05060.1| Basic 7S globulin [Glycine soja]
Length=438

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 105/180 (58%), Gaps = 8/180 (4%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            AQ  F P+A+V+PV+KD   S  QYV Q++    L  +KL VD+GG +LW +    + SS
Sbjct  22   AQTSFRPKALVLPVTKDVSASVPQYVTQIKQRTPLVAVKLTVDLGGGYLWVNCEKGYVSS  81

Query  328  SQGSIPCGSLKCSMANPKGC-TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  504
            +     CGS +CS+    GC T ++IC     N V+ ++  G +  D +AV   D  N  
Sbjct  82   TSRPARCGSAQCSLFGLYGCSTEDKICGRSPSNTVTGVSTYGDIHADVVAVNSTDGNNPT  141

Query  505  SFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
              +S VP FLF    + + +GL +GV G+ GLG +++SLPSQ A+ F   RK A+CLSSS
Sbjct  142  KVVS-VPKFLFICGSNVVQKGLASGVTGMAGLGRTKVSLPSQFASAFSFHRKFAICLSSS  200



>ref|XP_011015096.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 107/190 (56%), Gaps = 16/190 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            SL++  F P+A+V+PVSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLINQRTPLVPVKLTLDLGGQFQWVDCEEGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  474
            S   + C S +C++A  K C +           N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVTECYSGPRPGCNNNTCSVLPDNTVTSTATSGEVGQDVVS  140

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S V   +F+   +   +GL +GVNG+ G G ++ISLPSQL+  F   
Sbjct  141  IQSTDGSNPGRVVS-VKKLIFACSGTRFLEGLASGVNGMAGFGRTKISLPSQLSAAFSFD  199

Query  655  RKXAVCLSSS  684
            RK A+CL+SS
Sbjct  200  RKFAICLTSS  209



>ref|XP_010667343.1| PREDICTED: basic 7S globulin-like [Beta vulgaris subsp. vulgaris]
Length=432

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 102/191 (53%), Gaps = 19/191 (10%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P+A+V+P+S+D  T QY   L        + L +D+GGPFLW D    + S++  S  
Sbjct  21   FRPKALVLPISRDPSTLQYRINLTQRTPPINIPLTLDLGGPFLWVDCDKNYISTTYRSAR  80

Query  346  CGSLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            C S +CS+AN K C +          N  C L  ENP    A SG L  D I +   D  
Sbjct  81   CNSAQCSLANSKSCGTCNAPPRPGCNNNTCGLFPENPFINTATSGELASDVIRITSTDGS  140

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G  +  VPNFLFS  P+ L +GL   V G+ GLG+++IS PSQ ++ F   RK A+CL
Sbjct  141  NPGPVV-KVPNFLFSCAPTSLLKGLSKSVQGIAGLGSTKISPPSQFSSAFSFARKFAICL  199

Query  676  SS----SNGAI  696
             S     NGA+
Sbjct  200  PSLSEGGNGAL  210



>ref|XP_006419821.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
 gb|ESR33061.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
Length=394

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 112/187 (60%), Gaps = 20/187 (11%)
 Frame = +1

Query  187  RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS-------IP  345
             +I IPV KD  T QYVA++  G +  P+ LV+D+GGP  W D  SS+  S       IP
Sbjct  23   NSIAIPVVKDASTLQYVAKIHHGVSQVPINLVLDLGGPLTWVDCDSSADVSSSSSRRLIP  82

Query  346  CGSLKCSMA-------NPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE-LIDEPNA  501
              S++CS +       N    T+N  C +  +N +S +A +G L EDTIAV   +++P+ 
Sbjct  83   SQSIQCSRSGKSPVPGNGSDTTTNT-CGVFTQNGISGLATTGDLAEDTIAVRSELEDPS-  140

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
               ++ V  FLFS  P+FL QGL +GV G+LGLG + ISLPSQLA   G  RK  +CLSS
Sbjct  141  ---ITAVDEFLFSCAPTFLVQGLASGVRGMLGLGRAPISLPSQLATGIGHQRKFFMCLSS  197

Query  682  SNGAIIS  702
            SNG ++S
Sbjct  198  SNGVVLS  204



>ref|XP_003536212.1| PREDICTED: basic 7S globulin-like [Glycine max]
Length=444

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 105/182 (58%), Gaps = 8/182 (4%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            S+AQ  F P+A+V+PV+KD   S  QYV Q++    L P+KL VD+GG + W +    + 
Sbjct  26   SIAQPSFRPKALVLPVTKDVSASVPQYVTQIKQRTPLVPVKLTVDLGGGYFWVNCEKGYV  85

Query  322  SSSQGSIPCGSLKCSMANPKGC-TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            SS+     CGS +CS+    GC   ++IC     N V+ ++  G +  D +A+   D  N
Sbjct  86   SSTSKPARCGSAQCSLFGLYGCNVEDKICSRSLSNTVTGVSTFGEIHADVVAINATDGNN  145

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
                +S VP FLF    + +  GL +GV G+ GLG +++SLPSQ ++ F   RK A+CLS
Sbjct  146  PVRVVS-VPKFLFICGANVVQNGLASGVTGMAGLGRTKVSLPSQFSSAFSFLRKFAICLS  204

Query  679  SS  684
            SS
Sbjct  205  SS  206



>gb|KDO74797.1| hypothetical protein CISIN_1g044303mg [Citrus sinensis]
Length=428

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 110/194 (57%), Gaps = 17/194 (9%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S A+  F P+A+V+PV+KD  T QY+ Q+Q    L P+KL +D+GG FLW +    + SS
Sbjct  21   SEAKTSFKPKALVVPVTKDSSTLQYLTQIQQRTPLVPVKLTLDLGGGFLWVNCEQGFVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAV  477
            S     CGS +C +A  + C           +N  C     N VS ++  G L  D +++
Sbjct  81   SYKPARCGSAQCKIAGSESCVESCLPKGPGCNNNTCTHFPGNTVSHVSTFGELATDVVSI  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQL-ANTFGIP  654
            +  D    G  +  VPN +F+   +FL +GL +G  G+ GLG +++SLPSQL A  F + 
Sbjct  141  QSTDGSKPGQVVP-VPNIIFACGATFLLEGLASGFQGMAGLGRNKVSLPSQLSAAAFKLD  199

Query  655  RKXAVCLSSSNGAI  696
            RK ++CL SSNGA+
Sbjct  200  RKFSICL-SSNGAV  212



>gb|KHN30567.1| Basic 7S globulin [Glycine soja]
Length=438

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 105/182 (58%), Gaps = 8/182 (4%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            S+AQ  F P+A+V+PV+KD   S  QYV Q++    L P+KL VD+GG + W +    + 
Sbjct  20   SIAQPSFRPKALVLPVTKDVSASVPQYVTQIKQRTPLVPVKLTVDLGGGYFWVNCEKGYV  79

Query  322  SSSQGSIPCGSLKCSMANPKGCT-SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            SS+     CGS +CS+    GC   ++IC     N V+ ++  G +  D +A+   D  N
Sbjct  80   SSTSKPARCGSAQCSLFGLYGCNVEDKICSRSLSNTVTGVSTFGEIHADVVAINATDGNN  139

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
                +S VP FLF    + +  GL +GV G+ GLG +++SLPSQ ++ F   RK A+CLS
Sbjct  140  PVRVVS-VPKFLFICGANVVQNGLASGVTGMAGLGRTKVSLPSQFSSAFSFLRKFAICLS  198

Query  679  SS  684
            SS
Sbjct  199  SS  200



>ref|XP_006489308.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=429

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 110/194 (57%), Gaps = 17/194 (9%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S A+  F P+A+V+PV+KD  T QY+ Q+Q    L P+KL +D+GG FLW +    + SS
Sbjct  21   SEAKTSFKPKALVVPVTKDSSTLQYLTQIQQRTPLVPVKLTLDLGGGFLWVNCEQGFVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAV  477
            S     CGS +C +A  + C           +N  C     N VS ++  G L  D +++
Sbjct  81   SYKPARCGSAQCKIAGSESCVESCLPKGPGCNNNTCTHFPGNTVSHVSTFGELATDVVSI  140

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQL-ANTFGIP  654
            +  D    G  +  VPN +F+   +FL +GL +G  G+ GLG +++SLPSQL A  F + 
Sbjct  141  QSTDGSKPGQVVP-VPNIIFACGATFLLEGLASGFQGMAGLGRNKVSLPSQLSAAAFKLD  199

Query  655  RKXAVCLSSSNGAI  696
            RK ++CL SSNGA+
Sbjct  200  RKFSICL-SSNGAV  212



>ref|XP_004229434.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=437

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 99/188 (53%), Gaps = 15/188 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A+ P  PRA ++P++KD  T Q++  +     L P KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPSKPRAFLLPITKDEATKQFITTIYQRIPLVPAKLTIDLGQRFLWVDCDIGYVSSSY  82

Query  334  GSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
              +PCGS+ C  +    C            +N  C     NP  + + SG L +D ++++
Sbjct  83   KPVPCGSIPCKRSFSGACVESCVGSPSPGCNNNTCGQSIYNPFIRTSTSGELAQDVVSLQ  142

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              D      +LS     +F    +FL + L  GVNG+LGLGN  +  P+QLAN F IPRK
Sbjct  143  STDGSKPRKYLSTTNGVVFGCGSTFLLEKLAKGVNGILGLGNGYVGFPTQLANAFTIPRK  202

Query  661  XAVCLSSS  684
             A+CL+SS
Sbjct  203  FAICLTSS  210



>ref|XP_004134152.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170541.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57019.1| hypothetical protein Csa_3G149990 [Cucumis sativus]
Length=429

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 103/193 (53%), Gaps = 16/193 (8%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            +IS+A   F PR++V+PV+K  P+ QY+ Q+     L P+ L VD+GG  +W D    + 
Sbjct  19   SISIASTSFTPRSLVLPVTKH-PSLQYIIQIHQRTPLVPVNLTVDLGGWLMWVDCDRGFV  77

Query  322  SSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  471
            SSS     C S +CS+A    C           +N  C L   N + +++  G +  D +
Sbjct  78   SSSYKPARCRSAQCSLAKSISCGKCYLPPHPGCNNYTCSLSARNTIIQLSSGGEVTSDLV  137

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +V   +  N+   LS VPNFLF    +FL +GL  GV G+ G G +RISLPSQ A  F  
Sbjct  138  SVSSTNGFNSTRALS-VPNFLFICSSTFLLEGLAGGVTGMAGFGRTRISLPSQFAAAFSF  196

Query  652  PRKXAVCLSSSNG  690
             RK  +CLS S G
Sbjct  197  SRKFTMCLSGSTG  209



>ref|XP_010522709.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=418

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 102/193 (53%), Gaps = 15/193 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  327
            + AQ+ F P+A+V+PV+KD  T QYVA +     L P+KLVVD+GG F W      + SS
Sbjct  20   TFAQQSFRPKALVLPVTKDASTLQYVATINQRTPLVPVKLVVDLGGQFQWVVCDKGYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +     C S  CS+A    C           +N  C     N ++ +  SG L +D +++
Sbjct  80   TYRPARCRSAVCSLARSTSCGDCFSAPRPGCNNNTCGAFPANTITPIVTSGELAQDVVSI  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            E  D  N G  ++ +P F F    +FL  GL NG  G+ GLG + I+LP+Q +  F   R
Sbjct  140  ESTDGSNPGQIVT-LPRFAFVCGSTFLLDGLANGAVGMAGLGRTNIALPAQFSAAFSFRR  198

Query  658  KXAVCLSSSNGAI  696
            K AVCLS+  G I
Sbjct  199  KFAVCLSTGRGVI  211



>gb|KDO74801.1| hypothetical protein CISIN_1g040581mg [Citrus sinensis]
Length=394

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 109/187 (58%), Gaps = 20/187 (11%)
 Frame = +1

Query  187  RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS-------IP  345
             ++ IPV KD  T QYVA++  G +  P+ LV+D+GGP  W D  SS+  S       IP
Sbjct  23   NSVAIPVVKDVSTLQYVAKIHHGVSQVPINLVLDLGGPLTWVDCDSSADVSSSSSRRLIP  82

Query  346  CGSLKCSMA-------NPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE-LIDEPNA  501
              S++CS +       N    T+N  C +  +N +S +  +G L EDTIAV   +++P+ 
Sbjct  83   SQSIQCSRSGKSPVPGNGSDTTTNT-CGVFTQNGISGLVTTGDLAEDTIAVRSELEDPS-  140

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
               ++ V  FLFS  P+FL QGL  G  G+LGLG + ISLPSQLA   G  RK  +CLSS
Sbjct  141  ---ITAVDQFLFSCAPTFLLQGLARGARGMLGLGRAPISLPSQLATGIGHQRKFFMCLSS  197

Query  682  SNGAIIS  702
            SNG ++S
Sbjct  198  SNGVVLS  204



>ref|XP_010111673.1| Basic 7S globulin [Morus notabilis]
 gb|EXC31441.1| Basic 7S globulin [Morus notabilis]
Length=421

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 105/183 (57%), Gaps = 18/183 (10%)
 Frame = +1

Query  196  VIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS---------SQGSIPC  348
            ++P++KD  T QY+  +  G +L P KLV+D+GGPFLW D  S          S+GSI C
Sbjct  35   ILPITKDASTLQYLTSVDHGNSLLPTKLVLDLGGPFLWMDCGSRDLFSPGRLISRGSIRC  94

Query  349  GSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA------GSF  510
             + K S +       +++C +  EN + K+ G G + ED +AV+L+D   A      G +
Sbjct  95   LAAKSS-SRRNSDDKSDVCAIFSENRIGKVRGRGDVAEDILAVDLVDPSKAEEIRTVGKY  153

Query  511  LSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNG  690
            L +  NFLF+     L  GL +G  G+LGLG +RISLPSQ+++      +  +CLSSSNG
Sbjct  154  LHN--NFLFACAEKSLLSGLASGAKGILGLGRARISLPSQISSGLDSKWEFTLCLSSSNG  211

Query  691  AII  699
             ++
Sbjct  212  VVL  214



>ref|XP_010255899.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=448

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 101/191 (53%), Gaps = 16/191 (8%)
 Frame = +1

Query  157  ISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            I ++     P  +VIPV KD  TSQYVA ++M   L P+K+VVD+ G  LW D    + S
Sbjct  28   IPISNAALRPSEVVIPVQKDVETSQYVATIKMRTPLVPVKVVVDLAGTLLWVDCDDGYIS  87

Query  325  SSQGSIPCGSLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIA  474
            SS    PCGS KC +A   GC S          N+ C +   NP+     +G L ED IA
Sbjct  88   SSYRPTPCGSAKCQLAKGIGCLSCNLEPRPGCTNDTCSVFPYNPIKNSLMTGGLSEDVIA  147

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG-I  651
            ++  D  N G+     P F FS   +   +GL  G  G+LGL  S  +LP+QLA+ F   
Sbjct  148  IQSTDGKNPGAVAVIHP-FPFSCATTSHLEGLARGAKGMLGLSRSSTALPTQLASQFSKF  206

Query  652  PRKXAVCLSSS  684
            P+  A+CLSSS
Sbjct  207  PQVFALCLSSS  217



>ref|XP_011011196.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 106/190 (56%), Gaps = 16/190 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            SL++  F P+A+V+PVSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLINQRTPLVPVKLTLDLGGQFQWVDSEEGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  474
            S   + C S +C++A  K C +           N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVTECYSGPRPGCNNNTCSVLPDNTVTSTATSGEVGQDVVS  140

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S V   +F+   +   +GL +GVNG+ G G ++ISLPSQ +  F   
Sbjct  141  IQSTDGSNPGRVVS-VKKLIFACSGTRFLEGLASGVNGMAGFGRTKISLPSQFSAAFSFD  199

Query  655  RKXAVCLSSS  684
            RK A+CL+SS
Sbjct  200  RKFAICLTSS  209



>ref|XP_011090790.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=443

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 100/188 (53%), Gaps = 16/188 (9%)
 Frame = +1

Query  172  RPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW-----ADWASSSQG  336
            +P  P+A+V+ V+KD  TSQY+  ++    L P+KL VDVGG  LW     +++ SS+  
Sbjct  30   KPSRPQALVLAVTKDPSTSQYLTTIRQRTPLRPVKLTVDVGGKALWVACDRSEYISSTYK  89

Query  337  SIPCGSLKCSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
               CGS +C +A  K C           +NE C     N V K    G +  D +A++  
Sbjct  90   PALCGSPQCRLAKSKSCDDCWDGPRPGCNNETCSNVVYNTVEKSGQIGEVATDVLALQST  149

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
            D  N G  L  VPNFLFS    FL + L NG  G+ G G +  SLPS L+   G+ +K A
Sbjct  150  DGSNPGR-LVRVPNFLFSCGSLFLGEKLANGAKGIAGFGRTETSLPSLLSRALGVRKKFA  208

Query  667  VCLSSSNG  690
            +CLSSS G
Sbjct  209  ICLSSSVG  216



>ref|XP_006429864.1| hypothetical protein CICLE_v10013399mg [Citrus clementina]
 gb|ESR43104.1| hypothetical protein CICLE_v10013399mg [Citrus clementina]
Length=347

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 105/180 (58%), Gaps = 9/180 (5%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSI  342
            +AQ  F P+A+VIPV KD  T QYVA+++    L P+KL V +GG      + SS+    
Sbjct  23   IAQTSFRPKALVIPVVKDAATLQYVAEIKQTTPLVPVKLTVHLGG------YVSSTNKIA  76

Query  343  PCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHV  522
             CGS +C++AN K C    IC    ENP+S     G ++ D ++++  +  N G  ++ V
Sbjct  77   RCGSAQCNLANVKAC-GGGICGADPENPISNTGTFGDIRIDVLSIQSTNSRNPGRAVT-V  134

Query  523  PNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS-SNGAII  699
             NF+F     F+ QGL NGV G+ GLG S+++LPSQLA  F +  K A+ LS   NG II
Sbjct  135  LNFIFLCGSEFVLQGLANGVVGIAGLGTSKVALPSQLAAAFSLKTKFALYLSPFGNGVII  194



>ref|XP_006380060.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
 gb|ERP57857.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
Length=439

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 106/190 (56%), Gaps = 16/190 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            SL++  F P+A+V+PVSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLMNQRTPLVPVKLTLDLGGQFQWVDCEEGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIA  474
            S   + C S +C++A  K C            +N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVNECYSSPRPGCNNNTCSVLPDNTVTSTATSGDVGQDAVS  140

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  ++ V   +F+   +   +GL NGV G+ G G ++ISLPSQ +  F + 
Sbjct  141  IQSTDGSNPGR-VASVNKLIFACSETRFLEGLANGVKGMAGFGRTKISLPSQFSAAFSLD  199

Query  655  RKXAVCLSSS  684
            RK A+CL+SS
Sbjct  200  RKFAICLTSS  209



>ref|XP_006489295.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=436

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 106/197 (54%), Gaps = 20/197 (10%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD-----WAS  324
            S A+  F P+A+V+PV+KD  T QYV +++      P+KL +D+GG  LW +     + S
Sbjct  22   STAKTSFRPKALVLPVTKDSSTLQYVTEIKQRTPHVPVKLTIDLGGRSLWVNCDEETYKS  81

Query  325  SSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  474
            SS    PC S  CS+AN + C            N  C +  +NP+  +  +G +  D ++
Sbjct  82   SSYKFAPCHSAPCSLANARICWDCFSEPRQFCQNRTCNILPDNPIRGIFSNGPVSMDVVS  141

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S +P  LF    SF    L  GV G+ GLG ++ISLPS  +  F  P
Sbjct  142  IQSTDGKNPGKVVS-LPQLLF-VCASFDLSDLAKGVTGMAGLGRAKISLPSLFSAAFSFP  199

Query  655  RKXAVCLSSS---NGAI  696
            RK A+CLSSS   NGA+
Sbjct  200  RKFAICLSSSTKANGAV  216



>emb|CBI26189.3| unnamed protein product [Vitis vinifera]
Length=283

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 101/177 (57%), Gaps = 13/177 (7%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS  339
            SLAQ  F P+A+V+PVSKD  + QY+  +    +L  + L +D+GG FLW D     QG 
Sbjct  21   SLAQTSFRPKALVLPVSKDAASLQYITHINQRTHLVSIPLTLDLGGQFLWVD---CDQGY  77

Query  340  IPCGSLKCSMANP--KGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  513
            +       S   P  KGC +   C L  +N V+  A SG + ED ++++  D  N G  +
Sbjct  78   VS------SSYRPVLKGC-NYSTCVLSPDNTVTGTATSGEVGEDAVSIQSTDGSNPGRVV  130

Query  514  SHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
            S V   LF+   +FL +GL + V G+ GLG SR++LPSQ ++ F   RK ++CLSSS
Sbjct  131  S-VRRLLFTCGSTFLLEGLASRVKGMAGLGRSRVALPSQFSSAFSFNRKFSICLSSS  186



>ref|XP_006419808.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
 gb|ESR33048.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
Length=436

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 106/197 (54%), Gaps = 20/197 (10%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD-----WAS  324
            S A+  F P+A+V+PV+KD  T QYV +++      P+KL +D+GG  LW +     + S
Sbjct  22   STAKTSFRPKALVLPVTKDSSTLQYVTEIKQRTPHVPVKLTIDLGGRSLWVNCDEETYKS  81

Query  325  SSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  474
            SS    PC S  CS+AN + C            N  C +  +NP+  +  +G +  D ++
Sbjct  82   SSYKFAPCHSAPCSLANARICWDCFSEPRQFCQNRTCNILPDNPIRGIFSNGPVSMDVVS  141

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S +P  LF    SF    L  GV G+ GLG ++ISLPS  +  F  P
Sbjct  142  IQSTDGKNPGKVVS-LPQLLF-VCASFDLSDLAKGVTGMAGLGRAKISLPSLFSAAFSFP  199

Query  655  RKXAVCLSSS---NGAI  696
            RK A+CLSSS   NGA+
Sbjct  200  RKFAICLSSSTKANGAV  216



>ref|XP_010938774.1| PREDICTED: basic 7S globulin-like [Elaeis guineensis]
Length=431

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+V+PV+KD  T QYV ++        +KLVVD+GG FLW D    + SSS   + C 
Sbjct  25   PHALVVPVAKDAATLQYVTRVDQRTPPVLVKLVVDLGGRFLWVDCENGYHSSSYRPVRCR  84

Query  352  SLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S +CS+A    C           +N  C +  ENP  + +  G L ED +++   D  N 
Sbjct  85   SARCSLAMANACGDCFSAPRPGCNNNTCGVFPENPFIRTSTGGELAEDVLSLPSTDGFNP  144

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  L+    FLFS  P+ L +GL  G  G+ GLG ++I +PSQLA TF   RK A+CLSS
Sbjct  145  GP-LATDRTFLFSCAPTSLLEGLAIGAAGMAGLGRTKIGVPSQLAATFSFHRKFALCLSS  203

Query  682  S  684
            S
Sbjct  204  S  204



>ref|XP_006489296.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 107/196 (55%), Gaps = 19/196 (10%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  330
            +AQ  F P+A+++PV+KD  T QY+ Q+     L P+K  +D+GG FLW     D+ SSS
Sbjct  23   IAQTSFRPKALILPVTKDASTLQYLTQINQRTPLVPVKYTLDLGGQFLWVVCLEDYESSS  82

Query  331  QGSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  477
              S  C S  CS+AN           P+   +N  C L  +N ++ ++ +G L  D  ++
Sbjct  83   FTSPLCHSAPCSLANAPFCWDCSDSQPRPGCNNNTCNLLPDNTINGISFNGPLSMDVASI  142

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  +S VP  LF     F    L NGV G+ GLG + ISLPS  ++ F  PR
Sbjct  143  QSTNGKNPGRVVS-VPKLLFVCADRFHLTDLANGVRGMAGLGRNSISLPSLFSSAFSFPR  201

Query  658  KXAVCLSSS---NGAI  696
            K A+CLSSS   NGA+
Sbjct  202  KFAICLSSSTKANGAV  217



>gb|KDO74796.1| hypothetical protein CISIN_1g038219mg [Citrus sinensis]
Length=435

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 110/204 (54%), Gaps = 24/204 (12%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            T S++     P+A+ + VSKD  T QY+ Q++    L P+KL +D+GG FLW D    + 
Sbjct  21   TTSISNTSSKPKALALLVSKDSSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVDCDQGYV  80

Query  322  SSSQGSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMA-GSGVLKED  465
            S+S     CGS +C +A  K C            +N  C     N +S+ +   G L  D
Sbjct  81   STSYKPARCGSAQCKLARSKSCIDEYSCSPGPGCNNHTCSRFPANSISRESTNRGELATD  140

Query  466  TIAVELIDEPNA----GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQL  633
             ++++ ID        G F+S VPN +FS  P+FL  GL  GV G+ GLG +++SLPSQ 
Sbjct  141  VVSIQSIDIDGKANPPGQFVS-VPNLIFSCGPTFLLDGLATGVKGMAGLGRTQVSLPSQF  199

Query  634  ANTFGIPRKXAVCLSS---SNGAI  696
            +  F   RK ++CLSS   SNGA+
Sbjct  200  SAAFNFDRKFSICLSSSTTSNGAV  223



>ref|XP_006349245.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=440

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 100/188 (53%), Gaps = 16/188 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A+ P  PRA ++P++KD  T Q++  +     L P KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPPKPRAFLLPITKDAATKQFITTIYQRTPLVPAKLTIDLGQRFLWVDCDKGYVSSSY  82

Query  334  GSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
              +PCGS+ C  +    CT           +N  C     NP  + + +G L ED ++++
Sbjct  83   KPVPCGSIPCKRSFSGACTESCVGSPSPGCNNNTCGQTIYNPFIRTSTTGELAEDVVSLQ  142

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              D  N   + S     +F    +FL + L  GVNG+LGLGN  +  P+QLAN F +PRK
Sbjct  143  STDGSNPRKYFS-TNGVVFGCGSTFLLEKLAKGVNGILGLGNGYVGFPTQLANAFSVPRK  201

Query  661  XAVCLSSS  684
             A+CL+SS
Sbjct  202  FAICLTSS  209



>ref|XP_006850763.1| hypothetical protein AMTR_s00025p00079140 [Amborella trichopoda]
 gb|ERN12344.1| hypothetical protein AMTR_s00025p00079140 [Amborella trichopoda]
Length=433

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 95/183 (52%), Gaps = 14/183 (8%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD---WASSSQGSIPC  348
            F P+A+V P+ KD  T QY   L +  +L   +L   +GG FLW D   + SS+   + C
Sbjct  28   FRPKALVAPIVKDPSTLQYYTNLSLKTHLRSERLAFHLGGSFLWIDCDNYVSSTYRPVRC  87

Query  349  GSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
             S +CS A  + C           SN+ C +   NP  + +  G L ED +A+   D   
Sbjct  88   RSAQCSAARSRACGSCFATPRPGCSNDTCGVSPYNPFIRTSTGGDLLEDVLAIRSTDGKT  147

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
             G  ++ VP+FLFS  P+FL +GL    +G+ G G  +I LP QLA  F   RK AVCLS
Sbjct  148  QGPQVT-VPHFLFSCAPAFLTEGLTGSASGLAGFGRGKIGLPEQLAAKFSFRRKFAVCLS  206

Query  679  SSN  687
             S+
Sbjct  207  GSS  209



>ref|XP_006419827.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
 ref|XP_006489579.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
 gb|ESR33067.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
Length=435

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 110/204 (54%), Gaps = 24/204 (12%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            T S++     P+A+ + VSKD  T QY+ Q++    L P+KL +D+GG FLW D    + 
Sbjct  21   TTSISNTSSKPKALALLVSKDSSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVDCDQGYV  80

Query  322  SSSQGSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMA-GSGVLKED  465
            S+S     CGS +C +A  K C            +N  C     N +S+ +   G L  D
Sbjct  81   STSYKPARCGSAQCKLARSKSCIDEYSCSPGPGCNNHTCSRFPANSISRESTNRGELATD  140

Query  466  TIAVELIDEPNA----GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQL  633
             ++++ ID        G F+S VPN +FS  P+FL  GL  GV G+ GLG +++SLPSQ 
Sbjct  141  VVSIQSIDIDGKANPPGPFVS-VPNLIFSCGPTFLLDGLATGVKGMAGLGRTQVSLPSQF  199

Query  634  ANTFGIPRKXAVCLSS---SNGAI  696
            +  F   RK ++CLSS   SNGA+
Sbjct  200  SAAFNFDRKFSICLSSSTTSNGAV  223



>ref|XP_009597883.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=432

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 98/175 (56%), Gaps = 8/175 (5%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            PRA+++PV+KD  T QYV  ++    L P+KL +D+G  FLW D    + SSS   +PC 
Sbjct  29   PRALLLPVTKDAATKQYVTVIRQRTPLVPVKLTIDLGQRFLWVDCEKGYVSSSYKPVPCD  88

Query  352  SLKCSMANPKGC---TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL-SH  519
            S  C  +    C    ++  C     NP    +  G L +D ++++  D  N G F+ S 
Sbjct  89   STPCKRSFSGACAVGNNHSTCVHDPYNPFIHTSTGGELAQDVVSLQSTDGSNPGRFIGSA  148

Query  520  VPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
             P  +F    +FL +GL NGV G+ GLGN  I LPSQLA+ F + RK A+CLSSS
Sbjct  149  RPGVVFGCGATFLLEGLANGVKGIAGLGNGFIGLPSQLADAFHLDRKFAICLSSS  203



>gb|KJB61114.1| hypothetical protein B456_009G341600 [Gossypium raimondii]
Length=403

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 100/178 (56%), Gaps = 10/178 (6%)
 Frame = +1

Query  196  VIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSLKC  363
            + PV+KD  T QYVA++  G  L    LVVD+GG FLW D      SSS   I   S+ C
Sbjct  32   LFPVAKDAATLQYVARISHGAPLGSTDLVVDLGGSFLWMDCNSGHVSSSYRLISSCSVNC  91

Query  364  SMAN-----PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPN  528
            S A         C  N  C +   N V+     G L ED IAV+ +D  + G   + V +
Sbjct  92   SRAKFHDLGSTSCLLNTNCYVSPYNGVTGSTSMGELVEDVIAVDSVDPSDVGQSTT-VDH  150

Query  529  FLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGAIIS  702
            FLF+   +F  QGL +G  G++GLG + ISLPSQL+++ G P+K +VCLSSS G +++
Sbjct  151  FLFACASTFHLQGLASGAKGMMGLGKASISLPSQLSSSIGHPQKFSVCLSSSTGVLLT  208



>ref|XP_002517173.1| pepsin A, putative [Ricinus communis]
 gb|EEF45336.1| pepsin A, putative [Ricinus communis]
Length=449

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 110/201 (55%), Gaps = 22/201 (11%)
 Frame = +1

Query  157  ISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD-----WA  321
            +S+AQ    P+A+++PV+KD  T QYV  L +G  LA    VVD+GG  LW D     + 
Sbjct  20   LSIAQASSKPKALILPVNKDATTLQYVTHLNIGTPLAKKDFVVDLGGAHLWMDCDDGSYV  79

Query  322  SSSQGSIPCGSLKCSMANPK---GCT--------SNEICELQFENPVSKMAGSGVLKEDT  468
            SS+     CGS  CS+A      GC         SNE C +   N +      GV+  D 
Sbjct  80   SSTFRQSLCGSAPCSVAKATCTGGCVPGHHKSGCSNETCYVLSTNTIQGRLEVGVVSRDI  139

Query  469  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
            IA++  D   +GS +S +P+++F+   ++  + L +G  G+LGLG  +I+LP QL+++FG
Sbjct  140  IALQSTDGAKSGSLVS-IPDYIFACANAWDLKSLASGAKGMLGLGREQIALPKQLSSSFG  198

Query  649  --IPRKXAVCL---SSSNGAI  696
                RK A+CL   S SNG +
Sbjct  199  GSFRRKFAICLPSDSKSNGVM  219



>ref|XP_002517171.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45334.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=437

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 104/198 (53%), Gaps = 19/198 (10%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S A+ PF P+A+++PV KD  T QY+ Q+     L P+KL VD+GG  +W +    + SS
Sbjct  21   STARAPFRPKALLLPVFKDKCTRQYITQIDQRTPLVPVKLTVDLGGSLMWINCEEGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  474
            S   + C S  CS++N + C             N  C     N V  +   G L +D +A
Sbjct  81   SYRPLSCDSALCSLSNSQSCNKECYSSPKPGCYNNTCGQSSNNRVVYIGTGGDLGQDVVA  140

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S VPNF F    ++L   L +GV G+ GLG S ISLP+  ++  G  
Sbjct  141  LQSFDGKNLGRIVS-VPNFPFVCGITWLLDDLADGVTGMAGLGRSNISLPAYFSSAIGFS  199

Query  655  RKXAVCLSS---SNGAII  699
            +  ++CLSS   SNG I+
Sbjct  200  KTFSICLSSSTKSNGVIV  217



>ref|XP_004170542.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Cucumis 
sativus]
Length=432

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 106/191 (55%), Gaps = 16/191 (8%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            +IS A   F P+++++PV+K  P+ QY+ Q++    L P+KL VD+GG F+W D    + 
Sbjct  17   SISFAATSFRPKSLLLPVTKH-PSGQYITQIRQRTPLVPVKLTVDLGGQFMWVDCDRGYV  75

Query  322  SSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  471
            SSS   + C S +CS++    C           +N  C     N + +++ SG +  D +
Sbjct  76   SSSYKPVRCRSAQCSLSKSTSCGDCFSPPXPGCNNNTCGHFPGNTIIQLSTSGEVTSDVL  135

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +V   +  N    +S +PNFLF   P+FL +GL  GV+G+ G G + ISLPSQ +  F  
Sbjct  136  SVSSTNGFNPTRAVS-IPNFLFVCGPTFLLEGLAGGVSGMAGFGRTGISLPSQFSAAFSF  194

Query  652  PRKXAVCLSSS  684
             RK AVCLS S
Sbjct  195  NRKFAVCLSGS  205



>ref|XP_004134153.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57018.1| hypothetical protein Csa_3G149980 [Cucumis sativus]
Length=432

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 106/191 (55%), Gaps = 16/191 (8%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            +IS A   F P+++++PV+K  P+ QY+ Q++    L P+KL VD+GG F+W D    + 
Sbjct  17   SISFAATSFRPKSLLLPVTKH-PSGQYITQIRQRTPLVPVKLTVDLGGQFMWVDCDRGYV  75

Query  322  SSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  471
            SSS   + C S +CS++    C           +N  C     N + +++ SG +  D +
Sbjct  76   SSSYKPVRCRSAQCSLSKSTSCGDCFSPPRPGCNNNTCGHFPGNTIIQLSTSGEVTSDVL  135

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +V   +  N    +S +PNFLF   P+FL +GL  GV+G+ G G + ISLPSQ +  F  
Sbjct  136  SVSSTNGFNPTRAVS-IPNFLFVCGPTFLLEGLAGGVSGMAGFGRTGISLPSQFSAAFSF  194

Query  652  PRKXAVCLSSS  684
             RK AVCLS S
Sbjct  195  NRKFAVCLSGS  205



>ref|XP_006387875.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
 gb|ERP46789.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
Length=411

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 101/182 (55%), Gaps = 16/182 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P+A+V+PVSKD  + QYV  +     L P+KL +D+GG F W D    + SSS   + C 
Sbjct  1    PKALVLPVSKDASSLQYVTLMNQRTPLVPVKLTLDLGGQFQWVDCEEGYVSSSYKPVRCT  60

Query  352  SLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S +CS+A  K C            +N  C +  +N V+  A SG + +D ++++  D  N
Sbjct  61   SAQCSLARSKSCVNECYSSPRPGCNNNTCSVLPDNTVTSTATSGDVGQDAVSIQSTDGSN  120

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
             G  ++ V   +F+   +   +GL NGV G+ G G ++ISLPSQ +  F + RK A+CL+
Sbjct  121  PGR-VASVNKLIFACSETRFLEGLANGVKGMAGFGRTKISLPSQFSAAFSLDRKFAICLT  179

Query  679  SS  684
            SS
Sbjct  180  SS  181



>ref|XP_009411762.1| PREDICTED: basic 7S globulin-like [Musa acuminata subsp. malaccensis]
Length=434

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 101/184 (55%), Gaps = 21/184 (11%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAP---LKLVVDVGGPFLWAD----WASSSQGSI  342
            P A+V+PV KD  T QYV ++   Y   P   L+LVVD+GG +LW D    + SS+    
Sbjct  26   PHALVLPVKKDAATLQYVTRV---YQRTPPVLLELVVDLGGRYLWVDCDAGYVSSTYRPA  82

Query  343  PCGSLKCSMAN----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDE  492
             C S +CS+AN          P+   +N  C L  EN   + +  G L  D +++   D 
Sbjct  83   RCRSAQCSLANSFSCGDCSAAPRPGCNNNTCGLAPENLFIRTSTFGELAGDVLSLASTDG  142

Query  493  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
             N G+ L+  P FLFS  P+FL +GL  G  G+ GLG +++ +PSQLA  F   RK A+C
Sbjct  143  SNPGA-LATDPRFLFSCAPTFLLKGLAKGAKGMAGLGRNKVGVPSQLAAAFSFHRKFALC  201

Query  673  LSSS  684
            LSSS
Sbjct  202  LSSS  205



>ref|XP_008810759.1| PREDICTED: basic 7S globulin-like [Phoenix dactylifera]
Length=431

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 108/190 (57%), Gaps = 18/190 (9%)
 Frame = +1

Query  157  ISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  324
            IS AQRP    A+V PV+KD  T QYV ++     L  LKLVVD+GG FLW D    + S
Sbjct  19   ISSAQRP---HALVAPVAKDAATLQYVTRVSQRTPLVLLKLVVDLGGRFLWVDCDNGYTS  75

Query  325  SSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  474
            S+   + C S +CS+A   GC           +N  C +  ENP  + +  G L ED ++
Sbjct  76   STYRPVRCRSAQCSLAMANGCGDCFSAPRPGCNNNTCGVSPENPFIRTSTGGELAEDVLS  135

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            +   D  N G  L+  P+FLFS  P+ L +GL +G  G+ GLG ++I LP+QLA TF   
Sbjct  136  LPSTDGSNPGP-LATDPSFLFSCAPTSLLEGLASGATGMAGLGRTKIGLPTQLAATFSFH  194

Query  655  RKXAVCLSSS  684
            RK A+CLSSS
Sbjct  195  RKFALCLSSS  204



>ref|XP_009111159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Brassica 
rapa]
Length=434

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 97/190 (51%), Gaps = 15/190 (8%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  330
             AQ  F P+A+V+PV+KD  T QY   +     L P  +V D+GG  LW D    + SS+
Sbjct  22   FAQPSFRPKALVLPVTKDQTTLQYTTVINQRTPLVPASVVFDLGGRNLWVDCDRGYVSST  81

Query  331  QGSIPCGSLKCSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
              S  C S  CS A   GC+          +N  C    +N V++ A SG +  D ++++
Sbjct  82   YRSPRCRSAVCSRAGSDGCSQCFSPPRPGCNNNTCSGTPDNTVTRTATSGEIATDVVSIQ  141

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              +  N G  +  +P+ +F    +FL QGL +G  G+ G+G   I LPSQ A  F   RK
Sbjct  142  STNGSNPGRIV-QIPDLVFVCGATFLLQGLASGTVGMAGMGRHNIGLPSQFAAAFSFNRK  200

Query  661  XAVCLSSSNG  690
             AVCL+S  G
Sbjct  201  FAVCLTSGRG  210



>ref|XP_011015097.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 103/190 (54%), Gaps = 26/190 (14%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            SL++  F P+A+V+PVSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLINQRTPLVPVKLTLDLGGQFQWVDCEEGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  474
            S   + C S +C++A  K C +           N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVTECYSGPRPGCNNNTCSVLPDNTVTSTATSGEVGQDVVS  140

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S V   +F+           +GVNG+ G G ++ISLPSQL+  F   
Sbjct  141  IQSTDGSNPGRVVS-VKKLIFA----------CSGVNGMAGFGRTKISLPSQLSAAFSFD  189

Query  655  RKXAVCLSSS  684
            RK A+CL+SS
Sbjct  190  RKFAICLTSS  199



>ref|XP_008438715.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 103/187 (55%), Gaps = 16/187 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A   F P+++V+PV+K  P+ QY+ Q++    L P+KL VD+GG F+W D    + SSS 
Sbjct  25   AATSFRPKSLVLPVTKH-PSGQYITQIRQRTPLVPVKLTVDLGGRFMWVDCDSGYVSSSY  83

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
              + C S +CS++    C           +N  C     N + +++ SG +  D ++V  
Sbjct  84   KPVRCRSAQCSLSKSTSCGECFSPPRPGCNNNTCGHFPGNTIIQLSTSGEVTTDVVSVSS  143

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             +  N    +S VPNF+F   P+FL +GL  GV+G+ G G + ISLPSQ A  F   RK 
Sbjct  144  TNGFNPTRAVS-VPNFIFVCGPTFLLEGLNGGVSGMAGFGRTGISLPSQFAAAFSFNRKF  202

Query  664  AVCLSSS  684
            AVCLS S
Sbjct  203  AVCLSGS  209



>emb|CDP10858.1| unnamed protein product [Coffea canephora]
Length=438

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 100/187 (53%), Gaps = 15/187 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ  F P A+V+PV KD  T QYV ++        L +V+D+GG FLW D    + SS+ 
Sbjct  24   AQSSFRPPALVLPVRKDASTLQYVTKINQRTPSVSLNVVLDLGGQFLWVDCDKNYISSTY  83

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
              + C S +CS+A   GC           +   C +  +N V+  A  G + +D++    
Sbjct  84   RPVRCRSAQCSLAGNDGCGNCTNGPKPGCNTNTCVVFPDNTVTHTATGGEVAQDSLTAAS  143

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             D  N G  ++ VP F+F    +FL +GL +G  G+ GLG +RI LPSQL+  F   +K 
Sbjct  144  TDGSNPGRSVT-VPQFIFGCGSTFLLKGLASGTVGMAGLGRARIGLPSQLSAAFSFHKKF  202

Query  664  AVCLSSS  684
            A+CLS+S
Sbjct  203  AICLSTS  209



>gb|KDO74790.1| hypothetical protein CISIN_1g035972mg, partial [Citrus sinensis]
Length=334

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 102/188 (54%), Gaps = 19/188 (10%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  327
            S+A+  F P+A+V+PV+KD  T QY+ Q++    L P+KL +D+GG FLW     ++ SS
Sbjct  20   SIAKTSFRPKALVLPVTKDGSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVVCEKEYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGCTSNEICELQ--FENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S    PC S  CS+AN   C      + +  F  PVS          D  +++  D  N 
Sbjct  80   SYRFAPCHSAPCSLANAPYCFECFGTKPRPGFNGPVSM---------DVASIQSTDGKNP  130

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  +S VP  LF    SF    L  GV G+ GLG ++ISLPS  ++ F   RK A+CLSS
Sbjct  131  GKVVS-VPKLLFVCADSFHLTDLAKGVTGMAGLGRTKISLPSLFSSAFSFKRKFAICLSS  189

Query  682  S---NGAI  696
            S   NGA+
Sbjct  190  STKANGAV  197



>gb|KFK42683.1| hypothetical protein AALP_AA1G026300 [Arabis alpina]
Length=1016

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 67/190 (35%), Positives = 95/190 (50%), Gaps = 16/190 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQ  333
            A+ PF PRA+++PVSKD  T QY   +     L    +V D+GG  LW     D+ S++ 
Sbjct  25   AESPFRPRALILPVSKDKSTLQYTTVINQRTPLVSASVVFDLGGRNLWVECDKDYVSTTY  84

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
             S  C S  CS A P+GC           +N  C    +N V+    SG +  D ++++ 
Sbjct  85   NSPRCNSAVCSRAGPRGCGQCFSPLRPGCNNNTCNSFPDNTVTGTITSGEIALDVVSIQS  144

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
            I+    G  +  +PNF+F    +FL   L +G  G+ G+G   I LPSQ A  F   RK 
Sbjct  145  INGSKPGRVVK-IPNFIFVCGSTFLLNRLASGTVGMAGIGRHNIGLPSQFATAFNFNRKK  203

Query  664  -AVCLSSSNG  690
             AVCL+S  G
Sbjct  204  FAVCLTSGRG  213



>ref|XP_006349243.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=441

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 102/190 (54%), Gaps = 19/190 (10%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A+ P  PRA ++PV+KD  T Q +  +     L P+KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPPRPRAFLLPVTKDVVTKQLITTISQRTPLVPVKLTIDLGQRFLWLDCGNGYVSSSY  82

Query  334  GSIPCGSLKCSMA----------NPK---GCTSNEICELQFENPVSKMAGSGVLKEDTIA  474
              +PCGS+ C  +          +P+   GC  N    + + NP S+ +  G L +D ++
Sbjct  83   KPVPCGSIPCKRSLSHDCAETCLDPQASPGCNHNTCSHIPY-NPFSRTSTGGELAQDVLS  141

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N   +LS     +F   P  L +GL   V G+LGLGN  +  P+QLAN F +P
Sbjct  142  LQSTDGLNPRKYLS-ANGVVFDCAPKPLLEGLAKSVEGILGLGNGYVGFPTQLANAFRVP  200

Query  655  RKXAVCLSSS  684
            RK A+CL+SS
Sbjct  201  RKFAICLTSS  210



>ref|XP_006349244.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=441

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 97/188 (52%), Gaps = 16/188 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A+ P  PRA ++PV+KD  T QYV  +     L P+KL +D+G  FLW D    + S S 
Sbjct  23   AKTPPRPRAFLLPVTKDASTKQYVTTIYQRTPLVPVKLTIDLGQRFLWVDCEKGYVSKSY  82

Query  334  GSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
              + CGS+ C  +    C            +N  C     NP  + +  G L +D ++++
Sbjct  83   KPVRCGSIPCKRSLSGACVESCVGPPSPGCNNNTCSHTPYNPFIRTSTGGELAQDVVSLQ  142

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              D  N   +LS     +F   P  L +GL  GV G+LGLGN  +  P+QLAN F +PRK
Sbjct  143  STDGSNPRKYLS-TNGVVFDCAPHSLLEGLAKGVKGILGLGNGYVGFPTQLANAFSVPRK  201

Query  661  XAVCLSSS  684
             A+CL+SS
Sbjct  202  FAICLTSS  209



>gb|EAZ44805.1| hypothetical protein OsJ_29439 [Oryza sativa Japonica Group]
Length=453

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 96/200 (48%), Gaps = 23/200 (12%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDV-GGPFLWAD------WASS  327
            QRP  P+A+ +PV +D  T QYVA  Q       +K VVD+ GG  LW D      +ASS
Sbjct  35   QRPTRPKAVAMPVVRDGATRQYVATFQQRTPRVAVKAVVDLSGGATLWVDCDAAAGYASS  94

Query  328  SQGSIPCGSLKCSMANPKGCTS--------------NEICELQFENPVSKMAGSGVLKED  465
            S   +PCGS  C +     C+               N  C    EN V+   G G +  D
Sbjct  95   SYAGVPCGSKPCRLVESPSCSYIASCLGSPPSPACLNRTCTGHAENTVTSSVGRGNVVTD  154

Query  466  TIAVELI--DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLAN  639
             +++       P     L+  P FLF+  P+ L QGL  G  G+  L  +R++LP+QLA 
Sbjct  155  VLSLPTTFPSAPVRQGPLATAPAFLFTCGPTSLTQGLAAGAAGMASLSRARLALPAQLAG  214

Query  640  TFGIPRKXAVCLSSSNGAII  699
            TF   RK A+CL S +  ++
Sbjct  215  TFRFSRKFALCLPSVDAGVV  234



>ref|XP_011011197.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 102/190 (54%), Gaps = 26/190 (14%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            SL++  F P+A+V+PVSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLINQRTPLVPVKLTLDLGGQFQWVDSEEGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  474
            S   + C S +C++A  K C +           N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVTECYSGPRPGCNNNTCSVLPDNTVTSTATSGEVGQDVVS  140

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIP  654
            ++  D  N G  +S V   +F+           +GVNG+ G G ++ISLPSQ +  F   
Sbjct  141  IQSTDGSNPGRVVS-VKKLIFA----------CSGVNGMAGFGRTKISLPSQFSAAFSFD  189

Query  655  RKXAVCLSSS  684
            RK A+CL+SS
Sbjct  190  RKFAICLTSS  199



>gb|KDP40109.1| hypothetical protein JCGZ_02107 [Jatropha curcas]
Length=414

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 99/179 (55%), Gaps = 20/179 (11%)
 Frame = +1

Query  163  LAQRPFFPRAIVIPVSKDFPT-SQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            +AQ  F P+A+V+PV KD  T  QYV Q+     L P+ + +D+GG FLW D    + SS
Sbjct  22   IAQTTFRPKALVLPVQKDSSTLRQYVTQINQRTPLVPVNVTLDLGGLFLWVDCEQDYVSS  81

Query  328  SQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  507
            S     C S +CS+ N + C SNEIC              G + +D ++V+  D  N G 
Sbjct  82   SYRPARCNSAQCSLINARRC-SNEICL-------------GQVGQDVVSVQSTDGSNPGK  127

Query  508  FLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
              S V N LF+   +F+ + L NGV G+ GLG +R SLP+Q ++ F    K AVCL+SS
Sbjct  128  NAS-VSNLLFTCGRTFVLEVLPNGVKGMAGLGRNRASLPTQFSSAFNFRNKFAVCLTSS  185



>ref|NP_001274964.1| xyloglucan-specific endoglucanase inhibitor 4 precursor [Solanum 
tuberosum]
 gb|ADU58605.1| xyloglucan-specific endoglucanase inhibitor 4 [Solanum tuberosum]
Length=440

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 98/188 (52%), Gaps = 16/188 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A+ P  PRA ++PV+KD  T Q+V  +     L P+KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPSKPRAFLLPVTKDASTKQFVTTISQRTPLVPVKLTIDLGQRFLWVDCEKGYVSSSY  82

Query  334  GSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
              +PCGS+ C  +    C            +N  C     N   + +  G L +D ++++
Sbjct  83   KPVPCGSIPCKRSLSGACVESCVGPPSPGCNNNTCSHIPYNHFIRTSTGGELAQDVVSLQ  142

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              D  N   +LS     +F   P  L +GL  GV G+LGLGN  +  P+QLAN F +PRK
Sbjct  143  STDGSNPRKYLS-TNGVVFDCAPHSLLEGLAKGVKGILGLGNGYVGFPTQLANAFSVPRK  201

Query  661  XAVCLSSS  684
             A+CL+SS
Sbjct  202  FAICLTSS  209



>dbj|BAD33624.1| putative dermal glycoprotein precursor, extracellular [Oryza 
sativa Japonica Group]
 dbj|BAD34099.1| putative dermal glycoprotein precursor, extracellular [Oryza 
sativa Japonica Group]
Length=444

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 96/200 (48%), Gaps = 23/200 (12%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDV-GGPFLWAD------WASS  327
            QRP  P+A+ +PV +D  T QYVA  Q       +K VVD+ GG  LW D      +ASS
Sbjct  35   QRPTRPKAVAMPVVRDGATRQYVATFQQRTPRVAVKAVVDLSGGATLWVDCDAAAGYASS  94

Query  328  SQGSIPCGSLKCSMANPKGCTS--------------NEICELQFENPVSKMAGSGVLKED  465
            S   +PCGS  C +     C+               N  C    EN V+   G G +  D
Sbjct  95   SYAGVPCGSKPCRLVESPSCSYIASCLGSPPSPACLNRTCTGHAENTVTSSVGRGNVVTD  154

Query  466  TIAVELI--DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLAN  639
             +++       P     L+  P FLF+  P+ L QGL  G  G+  L  +R++LP+QLA 
Sbjct  155  VLSLPTTFPSAPVRQGPLATAPAFLFTCGPTSLTQGLAAGAAGMASLSRARLALPAQLAG  214

Query  640  TFGIPRKXAVCLSSSNGAII  699
            TF   RK A+CL S +  ++
Sbjct  215  TFRFSRKFALCLPSVDAGVV  234



>ref|XP_010039912.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
 gb|KCW45637.1| hypothetical protein EUGRSUZ_L00588 [Eucalyptus grandis]
Length=453

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 107/191 (56%), Gaps = 25/191 (13%)
 Frame = +1

Query  175  PFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS----I  342
            P   R +V+P+++D  T +YVA +  G +L PL+L VD+GGP LW D ++ S GS    +
Sbjct  21   PSRARTLVLPLARDASTLRYVATVYHGPSLDPLELAVDLGGPSLWLDCSAPSSGSSVRRV  80

Query  343  PCGSLKCSMANP------KGCTS--NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            PC S++C  A        + C S  + +C ++ E        +GVL E  +AV+ +D   
Sbjct  81   PCRSIQCLAATSDASGLRRACPSGPSSVCGVRAEG-----GEAGVLGEGALAVDSVDGSG  135

Query  499  AGSFLSHVPNFLFS---FVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAV  669
              S ++ V  FL S     P F      +GV G LGLG SRISLPSQ+A  FG+ R+  V
Sbjct  136  ERS-VAAVDRFLISCARAAPGF----GASGVGGTLGLGRSRISLPSQVATAFGVRRRFFV  190

Query  670  CLSSSNGAIIS  702
            CLS+S G I++
Sbjct  191  CLSASEGVIVA  201



>ref|XP_009590387.1| PREDICTED: basic 7S globulin 2-like [Nicotiana tomentosiformis]
Length=300

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 96/178 (54%), Gaps = 15/178 (8%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            PRA+++ V+KD  T QYV  ++    L P+KL VD+G  FLW D    + SSS  S+ C 
Sbjct  59   PRALLLRVTKDAATKQYVTVIRQRTPLVPIKLTVDLGQRFLWVDCEKGYVSSSVKSVLCD  118

Query  352  SLKCSMANPKGCTSNEICELQFE----------NPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S  C+++    C+ N  C    E          N +++      LK+D I+++  D   +
Sbjct  119  STPCNLSRSGMCSGNCSCSSIREPGCTCSHLPYNHITRTNTGCELKDDVISLQSTDGSTS  178

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            G  +S   N +F  V +FL +GL  G+ G+  LGN  + LP+QLA  F IPRK A+CL
Sbjct  179  GPIVSS-SNLVFDCVAAFLLEGLAKGIEGIAALGNGFVGLPTQLATAFKIPRKFALCL  235



>ref|XP_003568479.1| PREDICTED: basic 7S globulin-like [Brachypodium distachyon]
Length=441

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 98/187 (52%), Gaps = 18/187 (10%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQ-LQMGYNLAPLKLVVDVGGPFLWAD-----WASSSQGSIP  345
            P A+V+ V KD  T QYVA   +     AP+  V+D+GG  LW D     +ASSS   +P
Sbjct  33   PSAVVLAVQKDDATGQYVAGGFRQRTPQAPVTAVLDLGGATLWVDCDPGQYASSSYARVP  92

Query  346  CGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDE  492
            C S  C +A    C +           N+ C    EN V+++  SG L  D +++     
Sbjct  93   CASKPCRLARTSACATSCVGAPSPGCLNDTCGGFPENTVTRLRTSGNLITDVLSLPTTFR  152

Query  493  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
            P  G  L+  P FLF+   +FL +GL +G  G+  L  +R +LP+QLA+TF  PRK A C
Sbjct  153  PAPGP-LATAPAFLFACGATFLTKGLASGAAGMASLSRARFALPTQLADTFRFPRKFAHC  211

Query  673  LSSSNGA  693
            L  ++GA
Sbjct  212  LPPASGA  218



>ref|NP_171821.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAK17160.1|AF325092_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72119.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|H37281, gb|T44167, 
gb|T21813, gb|N38437, gb|Z26470, gb|R65072, gb|N76373, 
gb|F15470, gb|Z35182, gb|H76373, gb|Z34678 and gb|Z35387 
come from this gene [Arabidopsis thaliana]
 gb|AAK59531.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15204.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27546.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=433

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 94/191 (49%), Gaps = 15/191 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S AQ PF P+A+++PV+KD  T QY   +     L P  +V D+GG  LW D    + SS
Sbjct  20   SSAQTPFRPKALLLPVTKDQSTLQYTTVINQRTPLVPASVVFDLGGRELWVDCDKGYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +  S  C S  CS A    C           SN  C    +N V+  A SG    D +++
Sbjct  80   TYQSPRCNSAVCSRAGSTSCGTCFSPPRPGCSNNTCGGIPDNTVTGTATSGEFALDVVSI  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  +  +PN +F    +FL +GL  G  G+ G+G   I LPSQ A  F   R
Sbjct  140  QSTNGSNPGRVV-KIPNLIFDCGATFLLKGLAKGTVGMAGMGRHNIGLPSQFAAAFSFHR  198

Query  658  KXAVCLSSSNG  690
            K AVCL+S  G
Sbjct  199  KFAVCLTSGKG  209



>ref|XP_006654379.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=440

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 95/185 (51%), Gaps = 16/185 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+V+PVSKD  T QYV   +      P++ V+D+ G  LW D    +ASSS   +PCG
Sbjct  33   PSAVVLPVSKDGATQQYVTVFRQRTPQVPVRAVLDLAGATLWVDCDAGYASSSYARVPCG  92

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S  C +   + C +           N+ C     N V+++   G +  D +++     P 
Sbjct  93   SRPCRLMKYRECFNSCFGEPSPACLNDTCSAFPGNAVTRVTAGGTIITDVLSLPTTFRPA  152

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
             G  L+  P FLF+   ++L +GL  G  G+  L  +R +LP+QLA TFG  R+ A+CL 
Sbjct  153  PGP-LATAPAFLFTCAHTYLTEGLATGATGMASLSRARFALPTQLAKTFGFSRRFALCLP  211

Query  679  SSNGA  693
             ++ A
Sbjct  212  PASAA  216



>gb|AAM61574.1| EDGP precursor [Arabidopsis thaliana]
Length=433

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 94/191 (49%), Gaps = 15/191 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S AQ PF P+A+++PV+KD  T QY   +     L P  +V D+GG  LW D    + SS
Sbjct  20   SSAQTPFRPKALLLPVTKDQSTLQYTTVINQRTPLVPASVVFDLGGRELWVDCDKGYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +  S  C S  CS A    C           SN  C    +N V+  A SG    D +++
Sbjct  80   TYQSPRCNSAVCSRAGSTSCGTCFSPPRPGCSNNTCGGIPDNTVTGTATSGEFALDVVSI  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  +  +PN +F    +FL +GL  G  G+ G+G   I LPSQ A  F   R
Sbjct  140  QSTNGSNPGRVV-KIPNLIFDCGATFLLKGLAKGTVGMAGMGRHNIGLPSQFAAAFSFHR  198

Query  658  KXAVCLSSSNG  690
            K AVCL+S  G
Sbjct  199  KFAVCLTSGKG  209



>ref|XP_009364261.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin, partial [Pyrus 
x bretschneideri]
Length=416

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 98/194 (51%), Gaps = 20/194 (10%)
 Frame = +1

Query  172  RPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQGS  339
            + F P+A+V+PV K+  T QY+   +    L PLKL +D+GG   W     D+ SS+   
Sbjct  1    KSFRPKALVLPVXKNASTLQYLTTFKQRTPLVPLKLTIDLGGELFWVDCEKDFVSSTYKP  60

Query  340  IPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGS-GVLKEDTIAVEL  483
              C S +CS+AN K C            +N  C L   N + +  G+   L  D +A+  
Sbjct  61   SRCHSAQCSLANSKSCHDCNSPPVRPGCNNNTCVLMPANTIIRXGGNFNQLGLDRVALHS  120

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             D    G  +SH  N LF    +FL   L +GV G+ GLG ++I LPSQ A+ F   RK 
Sbjct  121  TDGSQPGRLVSH-RNVLFVCGETFLLTQLADGVTGMAGLGRAKIGLPSQFASAFSFHRKF  179

Query  664  AVCLS---SSNGAI  696
            A CLS   SSNG +
Sbjct  180  AFCLSSSTSSNGVV  193



>ref|NP_001174419.1| Os05g0403000 [Oryza sativa Japonica Group]
 gb|AAT85210.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEE63671.1| hypothetical protein OsJ_18489 [Oryza sativa Japonica Group]
 dbj|BAH93147.1| Os05g0403000 [Oryza sativa Japonica Group]
Length=437

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 98/189 (52%), Gaps = 18/189 (10%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            PRA+V+PVSKD  T QY    +      P+K V+D+ G  LW D    + SSS   +PCG
Sbjct  32   PRAVVLPVSKDDATQQYATVFRQRTPQVPVKAVLDLAGATLWVDCDTGYVSSSYARVPCG  91

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S  C +    GC +           N  C    +N V+++   G +  D +++       
Sbjct  92   SKPCRLTKTGGCFNSCFGAPSPACLNGTCSGFPDNTVTRVTAGGNIITDVLSLPTTFRTA  151

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL-  675
             G F + VP FLF+   +FL +GL NG  G++ L  +R + P+QLA TFG  R+ A+CL 
Sbjct  152  PGPF-ATVPEFLFTCGHTFLTEGLANGATGMVSLSRARFAFPTQLARTFGFSRRFALCLP  210

Query  676  -SSSNGAII  699
             +S+ G ++
Sbjct  211  PASAAGVVV  219



>dbj|BAJ94733.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 95/187 (51%), Gaps = 16/187 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+V+PV KD  T QY+   +      P+  V+D+GG  LW D    + SSS   +PC 
Sbjct  27   PSAVVLPVRKDSATGQYLTGFRQRTPQVPVTAVLDLGGASLWVDCDAGYVSSSYAGVPCA  86

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S  C +A    C +           N+ C    EN V++++  G L  D ++V     P 
Sbjct  87   SKLCRLAKSVACATSCVGKPSPGCLNDTCSGFPENTVTRVSTGGNLITDVLSVPTTFRPA  146

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
             G  L+  P FLF+   +FL  GL  G  G+  L  +R +LP+QLA TF   RK A+CL+
Sbjct  147  PGP-LATAPAFLFTCGATFLTDGLAAGATGMASLSRARFALPTQLAATFRFSRKFALCLT  205

Query  679  SSNGAII  699
            S++ A +
Sbjct  206  STSAAGV  212



>ref|XP_006419825.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
 gb|ESR33065.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
Length=409

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 97/175 (55%), Gaps = 9/175 (5%)
 Frame = +1

Query  196  VIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSLKC  363
            V+PV K+    QYV Q++    L P+KLVV +GG  LW D    + SS+  +  CGS +C
Sbjct  19   VLPVLKNAAVFQYVTQIKQRTPLVPVKLVVHLGGNLLWVDCEKGYVSSTNKTARCGSAQC  78

Query  364  SMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFSF  543
            ++     C   +  +    NP+S     G ++ D ++V+  +  N G  ++ VPNF+F  
Sbjct  79   NLIGLVACGGGKCGDFS-NNPISNTGTIGDIRIDVVSVQSTNGRNPGRGVT-VPNFIFLC  136

Query  544  VPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS---SSNGAII  699
               F+ QGL +GV G+  LG ++ +LP QLA  F + RK A+CLS    SNG II
Sbjct  137  GSEFVLQGLASGVTGIAALGRTKTALPLQLAAAFSLNRKFAICLSPSARSNGVII  191



>ref|XP_002284868.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=441

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 108/198 (55%), Gaps = 20/198 (10%)
 Frame = +1

Query  160  SLAQRPFF-PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW----ADWAS  324
            S++Q P   P A+V+P++K   T QYV  +     L PL ++VD+GG FLW    +++ S
Sbjct  21   SISQTPLIHPNALVLPLTKHASTLQYVTIISQRTPLVPLNVIVDLGGQFLWVGCGSNYVS  80

Query  325  SSQGSIPCGSLKCSMAN-PKGCT----------SNEICELQFENPVSKMAGSGVLKEDTI  471
            SS     C S +C +A+ PK C           +N  C L  EN  +    +G L ED +
Sbjct  81   SSYRPAQCHSSQCFLAHGPKSCDHCLSRGRPKCNNGTCILFSENVFTSKVSAGDLSEDVL  140

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +++  D  N  S ++ +P+FLFS  P  L QGL  G  G+ GLG+ RI LP+ L++    
Sbjct  141  SLQSTDGLNPRSAVA-IPHFLFSCAPEVLLQGLAGGAEGIAGLGHGRIGLPTLLSSALNF  199

Query  652  PRKXAVCL---SSSNGAI  696
             RK AVCL   ++S+G I
Sbjct  200  TRKFAVCLPPTTTSSGVI  217



>emb|CAN68736.1| hypothetical protein VITISV_030193 [Vitis vinifera]
Length=441

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 108/198 (55%), Gaps = 20/198 (10%)
 Frame = +1

Query  160  SLAQRPFF-PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW----ADWAS  324
            S++Q P   P A+V+P++K   T QYV  +     L PL ++VD+GG FLW    +++ S
Sbjct  21   SISQTPLIHPNALVLPLTKHASTLQYVTIISQRTPLVPLNVIVDLGGQFLWVGCGSNYVS  80

Query  325  SSQGSIPCGSLKCSMAN-PKGCT----------SNEICELQFENPVSKMAGSGVLKEDTI  471
            SS     C S +C +A+ PK C           +N  C L  EN  +    +G L ED +
Sbjct  81   SSYRPARCHSSQCFLAHGPKSCDHCLSRGRPKCNNGTCILFSENVFTSKVSAGDLSEDVL  140

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +++  D  N  S ++ +P+FLFS  P  L QGL  G  G+ GLG+ RI LP+ L++    
Sbjct  141  SLQSTDGLNPRSAVA-IPHFLFSCAPEVLLQGLAGGAEGIAGLGHGRIGLPTLLSSALNF  199

Query  652  PRKXAVCL---SSSNGAI  696
             RK AVCL   ++S+G I
Sbjct  200  TRKFAVCLPPTTTSSGVI  217



>ref|XP_004229564.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=445

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 97/193 (50%), Gaps = 24/193 (12%)
 Frame = +1

Query  193  IVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQGSIPCGSLK  360
            + +PV KD  T QYVAQ+     L P+ L VD+GG FLW     D+ SSS  ++PCGS  
Sbjct  33   LFLPVFKDEITQQYVAQIYQRTPLVPVNLTVDLGGRFLWMDCENDYISSSYKNVPCGSRP  92

Query  361  CSMANPKGC------------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN--  498
            C ++  +GC             +N  C     NP+ + +  G L +D +A+  I      
Sbjct  93   CKLSGSQGCYGSSCPVPPRPGCNNYTCSHIPYNPIKRSSTDGELAQDVVALWSITTTTNR  152

Query  499  ---AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAV  669
               +   LS     +F+    FL + L NGV G+ GLG     LPSQLA  F +PRK A+
Sbjct  153  NNVSKMILSSTSGVMFNCPGDFLLEKLANGVKGMAGLGIGYTGLPSQLARAFHLPRKFAI  212

Query  670  CLS---SSNGAII  699
            CLS    SNG I+
Sbjct  213  CLSGNTKSNGVIL  225



>ref|XP_004298169.1| PREDICTED: basic 7S globulin-like [Fragaria vesca subsp. vesca]
Length=414

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 97/178 (54%), Gaps = 9/178 (5%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW-----ADWASSSQGSIPC  348
            P+  +  V+KD  T QYV Q+  G  L P  LV+D+GGP LW        +SSS+  IP 
Sbjct  30   PKGAISHVTKDISTLQYVIQIHHGTPLHPTNLVIDLGGPSLWLGCSSDSGSSSSKTLIPQ  89

Query  349  GSLKCSMANPKGCTSNEI-CELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVP  525
             S+KC  ANP    S    CE   +N V+ MA  G L +D IA+ ++D        SH  
Sbjct  90   SSIKCLSANPNTQNSKSTKCETFPQNRVTLMATLGDLAQDIIALPVVDGSETEPITSH--  147

Query  526  NFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGAII  699
             FLFS  P  L +GL  G  G+LGLG +R+S+ SQ+A  FG   +  +CLS  NG ++
Sbjct  148  -FLFSCAPKLLLKGLATGARGMLGLGRTRVSVASQIAAAFGSKPQFILCLSPLNGVVL  204



>ref|XP_006304586.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
 gb|EOA37484.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
Length=434

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 92/189 (49%), Gaps = 15/189 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ  F P+A+++PV+KD  + QY   L     L P  +V D+GG  LW D    + SS+ 
Sbjct  24   AQTSFRPKALILPVTKDPSSLQYTTVLNQRTPLVPASVVFDLGGRDLWVDCDRGYVSSTY  83

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
             S  C S  C+ A    C           SN  C    +N V+  A SG L  D ++++ 
Sbjct  84   QSPRCNSAVCTRAGSTSCGQCFSPPRPGCSNNTCGATPDNTVTGTATSGELALDVVSIQS  143

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             D  N G  +  +PN +F    +FL  GL  G  G+ G+G   I LPSQ A  F   RK 
Sbjct  144  TDGSNPGPVV-KIPNLIFVCGSTFLLNGLAKGTVGMAGMGRHNIGLPSQFAAAFSFNRKF  202

Query  664  AVCLSSSNG  690
            AVCL+S  G
Sbjct  203  AVCLTSGRG  211



>ref|XP_007034627.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05553.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=456

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 109/200 (55%), Gaps = 22/200 (11%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWA  321
            +I+LA   F P+A+V+PV K+  + QY+ Q+     L P+ L VD+GG FLW     D+ 
Sbjct  37   SITLAS--FRPKALVLPVWKEPSSLQYLTQIWQRTPLVPVNLTVDLGGQFLWVNCAKDYV  94

Query  322  SSSQGSIPCGSLKCSMANPKGCT------------SNEICELQFENPVSKMAGSGVLKED  465
            SSS     C S +CS+A    C+            +N+ C L  +N V + A    L +D
Sbjct  95   SSSYRPGTCRSSQCSLARALLCSNCSSSATPSPGCNNKTCTLFPDNTVIRAATFAELAQD  154

Query  466  TIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTF  645
              +++  D  N GS +S VP FLFS   +F+ +GL NGV G+ GLG   ISLPS  +  F
Sbjct  155  VFSIQSTDGKNPGSVVS-VPKFLFSCGATFILEGLANGVTGMAGLGRYPISLPSFFSAAF  213

Query  646  GIPRKXAVCLSS---SNGAI  696
               RK A+CLSS   SNG I
Sbjct  214  SFDRKFAICLSSATKSNGVI  233



>ref|XP_010457449.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 91/183 (50%), Gaps = 15/183 (8%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P+A+++P++KD  T QY   +     L P  LV D+GG  LW D    + SS+  S  C 
Sbjct  29   PKALLLPITKDQSTLQYTTVINQRTPLVPASLVFDLGGRDLWVDCDKGYVSSTYRSPRCN  88

Query  352  SLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S  CS+A    C           SN  C    +N V+  A SG L  D ++++  D  N 
Sbjct  89   SAVCSLAGSTSCGTCFSPPRPGCSNNTCGAIPDNTVTGTATSGELALDVVSIQSTDGSNP  148

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  +  +PN +F    +FL +GL  G  G+ G+G   I LPSQ A  F   RK AVCL+S
Sbjct  149  GRVV-KIPNLIFVCGSTFLLEGLAKGAVGMAGMGRHNIGLPSQFAAAFSFNRKFAVCLTS  207

Query  682  SNG  690
              G
Sbjct  208  GKG  210



>ref|XP_008340919.1| PREDICTED: basic 7S globulin [Malus domestica]
Length=406

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 112/190 (59%), Gaps = 8/190 (4%)
 Frame = +1

Query  154  TISLAQ-RPFFP-RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA-S  324
            T S++Q +P+     ++  V KD  T QYV ++  G  L P KLVVD+GGPFLW + A S
Sbjct  16   TFSISQAKPYNQLNGLIFHVKKDXSTLQYVTEIHHGTPLVPTKLVVDLGGPFLWLNCASS  75

Query  325  SSQGSIPCGSLKCSMANPKGCT--SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            SS   I   S++C  A PK     SN+ C++  EN ++++A  G L ED +AV+ + + +
Sbjct  76   SSSRLISQRSIQCLAAKPKXQDQGSNKKCDIFTENRITQVATQGDLLEDIMAVDQVTDGS  135

Query  499  ---AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAV  669
               + S  +   NFLFS  P FL  G+ +G  G+LGLG +++S+ SQ++       +  +
Sbjct  136  KTXSKSITTVGYNFLFSCAPMFLLNGIASGAKGMLGLGRTQMSMASQISAQLSSKLQFII  195

Query  670  CLSSSNGAII  699
            CLSSSNG ++
Sbjct  196  CLSSSNGVVL  205



>ref|XP_010475063.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=434

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 91/185 (49%), Gaps = 15/185 (8%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P+A+++P++KD  T QY   +     L P  LV D+GG  LW D    + SS+  S  
Sbjct  28   FRPKALLLPITKDQSTLQYTTVINQRTPLVPASLVFDLGGRDLWVDCDKGYVSSTYQSPR  87

Query  346  CGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            C S  CS A    C           SN  C    +N V+  A SG L  D ++++  D  
Sbjct  88   CNSAVCSRAGSTSCGTCFSPPRPGCSNNTCGAIPDNTVTGTATSGELALDVVSIQSTDGS  147

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G  +  +PN +F    +FL +GL  G  G+ G+G   I LPSQ A  F   RK AVCL
Sbjct  148  NPGRVV-KIPNLIFVCGSTFLLEGLAKGAVGMAGMGRHNIGLPSQFAAAFSFNRKFAVCL  206

Query  676  SSSNG  690
            +S  G
Sbjct  207  TSGKG  211



>gb|KDO74798.1| hypothetical protein CISIN_1g029782mg [Citrus sinensis]
Length=188

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 94/171 (55%), Gaps = 6/171 (4%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            ++AQ  F P+A+V+PV K+    QYV Q++    L P+KLVV +GG  LW D    + SS
Sbjct  20   AIAQTSFRPKALVLPVLKNAAVFQYVTQIKQRTPLVPVKLVVHLGGNLLWVDCEKGYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  507
            +  +  CGS +C +     C   +  +    NP+S     G ++ D ++V+  +  N G 
Sbjct  80   TNKTARCGSAQCHLIGLVACGGGKCGDFP-NNPISNTGTIGDIRIDVVSVQSTNGRNPGR  138

Query  508  FLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
             ++ VPNF+F     F+ +GL  GV G+  LG ++ +LP QLA  F + RK
Sbjct  139  GVT-VPNFIFLCGSEFVLRGLAPGVTGIAALGRTKTALPLQLAAAFSLNRK  188



>ref|XP_009118711.1| PREDICTED: basic 7S globulin-like [Brassica rapa]
Length=432

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 94/189 (50%), Gaps = 15/189 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQ  333
            AQ+ F P+A+++PV+KD  T+QY   +     L    +V D+GG  LW     D+ SS+ 
Sbjct  21   AQQSFRPKALLLPVTKDKSTNQYTTVINQRTPLVAASVVFDLGGRNLWVDCDKDYVSSTY  80

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
             S  C S  CS     GC           SN  C L  +N V+  A SG +  D ++++ 
Sbjct  81   RSPRCNSAVCSRTGSTGCGTCFSPPRPGCSNNTCSLIPDNTVTGTATSGEVATDVVSIQS  140

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             +  N G  +  +PN +F    +FL +GL  G  G+ G+G     LP Q A+ F   RK 
Sbjct  141  TNGVNPGRVV-KIPNLIFGCGATFLLKGLATGTVGMAGMGRHNSGLPLQFASAFSFNRKF  199

Query  664  AVCLSSSNG  690
            AVCL+S  G
Sbjct  200  AVCLTSGRG  208



>ref|XP_010483190.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 90/183 (49%), Gaps = 15/183 (8%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P+A+++PV+KD  T QY   +     L P  LV D+GG  LW D    + S+S  S  C 
Sbjct  29   PKALILPVTKDQSTLQYTTVINQRTPLVPASLVFDLGGRDLWVDCDKGYVSTSYRSPRCH  88

Query  352  SLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S  CS A    C           SN  C    +N V+  A SG L  D ++++  D  N 
Sbjct  89   SAVCSRAGSTSCGTCFSPPRPGCSNNTCGAIPDNTVTGTATSGELALDAVSIQSTDGSNP  148

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  +  +PN +F    +FL +GL  G  G+ G+G   I LPSQ A  F   RK AVCL+S
Sbjct  149  GRVV-KIPNLIFVCGSTFLLEGLAKGAVGMAGMGRHNIGLPSQFAAAFSFNRKFAVCLTS  207

Query  682  SNG  690
              G
Sbjct  208  GKG  210



>emb|CDY37436.1| BnaC08g45740D [Brassica napus]
Length=296

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 96/193 (50%), Gaps = 15/193 (8%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWA  321
            ++S AQ  F P+A+++PV+KD  T+QY   +     L    +V D+GG  LW     D+ 
Sbjct  18   SLSSAQPSFRPKALLLPVTKDKSTNQYTTVINQRTPLVAASVVFDLGGRNLWVDCDKDYV  77

Query  322  SSSQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  471
            SS+  S  C S  CS A    C           SN  C    +N V+  A SG    D +
Sbjct  78   SSTYRSPRCNSAVCSRAGSTSCGECYSPPRPGCSNNTCGSIPDNTVTGTATSGEFATDVV  137

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            +++  +  N G F+  +P+ +F    +FL  GL  G  G+ G+G   I LPSQ A+ F  
Sbjct  138  SIQSTNGFNPGRFV-QIPDLIFGCGATFLLNGLAPGTVGMAGMGRHNIGLPSQFASAFSF  196

Query  652  PRKXAVCLSSSNG  690
             RK AVCL+S  G
Sbjct  197  NRKFAVCLNSGRG  209



>ref|XP_003626314.1| Basic 7S globulin [Medicago truncatula]
 gb|ABD32384.1| Peptidase A1, pepsin [Medicago truncatula]
 gb|AES82532.1| basic 7S globulin-like protein [Medicago truncatula]
Length=437

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 103/190 (54%), Gaps = 19/190 (10%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P  +V+PV +D  T  + A +     L  + +++D+ G  LW +    +ASS+  +  C 
Sbjct  35   PNLLVLPVQQDASTGLHWANIHKRTPLMQVPVLLDLNGKHLWVNCEQHYASSTYQAPYCH  94

Query  352  SLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S +CS AN   C +          N  C L   NPV++    G L +D +A+  I+ P  
Sbjct  95   STQCSRANAHTCHTCVSSFRPGCHNNTCGLMSANPVTQQTAMGELAQDVLAIYAINGPKP  154

Query  502  GSFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
            G  ++ +P FLFS  PSFL Q    N V GV+GL +S ISL +QL++ FG+ R+  +CLS
Sbjct  155  GPMVT-IPQFLFSCAPSFLAQKGLPNNVQGVVGLAHSPISLQNQLSSHFGLKRQFTMCLS  213

Query  679  ---SSNGAII  699
               +SNGAI+
Sbjct  214  RHPNSNGAIL  223



>gb|EAY97993.1| hypothetical protein OsI_19910 [Oryza sativa Indica Group]
Length=237

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 92/178 (52%), Gaps = 16/178 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P ++V+PVSKD  T QYV   +      P+K V+D+ G  LW D    + SSS   + CG
Sbjct  32   PSSVVLPVSKDDATQQYVTMFRQRTPQVPVKAVLDLAGTMLWVDCDAGYVSSSYAGVRCG  91

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            +  C +    GC             N+ C    +N  + ++ +G +  D +++     P 
Sbjct  92   AKPCRLLKNAGCAITCLDAPSAGCLNDTCSEFPKNTATSVSTAGNIITDVLSLPTTFRPA  151

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
             G  L+  P FLF+   +FL QGL +G  G++ L  +R +LP+QLA+TFG  RK A+C
Sbjct  152  PGP-LATAPAFLFTCAHTFLTQGLADGATGMVSLSRARFALPTQLADTFGFSRKFALC  208



>emb|CBI26188.3| unnamed protein product [Vitis vinifera]
Length=400

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 92/158 (58%), Gaps = 20/158 (13%)
 Frame = +1

Query  190  AIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSL  357
            ++++PV+KD  T QYV Q+  G  L P+KLV+D+G PFLW D      SSS   I CGS+
Sbjct  102  SLLLPVTKDAATLQYVTQIHHGTPLVPIKLVLDLGAPFLWLDCSSGHVSSSNTPILCGSI  161

Query  358  KCSMANPK-----GCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHV  522
            +C  A        G TS   C L  +N ++ +A +G L ED +AVE       GS +   
Sbjct  162  QCLTAKTSDSGHGGGTST--CRLSPKNTITGLAEAGELAEDMVAVE-------GSEMG--  210

Query  523  PNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLA  636
              FLFS  P  L +GL +G  G+LGLG +RI+LPSQLA
Sbjct  211  SRFLFSCAPKPLLKGLASGTVGMLGLGRTRIALPSQLA  248



>gb|EEC84612.1| hypothetical protein OsI_31447 [Oryza sativa Indica Group]
Length=598

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 94/199 (47%), Gaps = 23/199 (12%)
 Frame = +1

Query  172  RPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDV-GGPFLWAD------WASSS  330
            R   P+A+ +PV +D  T QYVA  Q       +K VVD+ GG  LW D      +ASSS
Sbjct  35   RATRPKAVAMPVGRDGATRQYVATFQQRTPRVAMKAVVDLSGGATLWVDCDAAAGYASSS  94

Query  331  QGSIPCGSLKCSMANPKGCTS--------------NEICELQFENPVSKMAGSGVLKEDT  468
               +PCGS  C +     C+               N  C    EN V+   G G +  D 
Sbjct  95   YAGVPCGSKPCRLVESPSCSYIASCLGSPPSPACLNRTCTGHAENTVTSSVGRGNVVTDV  154

Query  469  IAVELI--DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANT  642
            +++       P     L+  P FLF+  P+ L QGL  G  G+  L  +R++LP+QLA T
Sbjct  155  LSLPTTFPSAPVRQGPLATAPAFLFTCGPTSLTQGLAAGATGMASLSRARLALPAQLAGT  214

Query  643  FGIPRKXAVCLSSSNGAII  699
            F   RK A+CL S +  ++
Sbjct  215  FRFSRKFALCLPSVDAGVV  233



>ref|XP_002889446.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65705.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 93/191 (49%), Gaps = 15/191 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  327
            S AQ  F P+A+++PV+KD  T QY   +     L P  +V D+GG  LW     D+ SS
Sbjct  20   SSAQTSFRPKALLLPVTKDQSTLQYTTVINQRTPLVPASVVFDLGGRELWVDCDKDYVSS  79

Query  328  SQGSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  477
            +  S  C S  CS A    C           SN  C    +N V+  A SG    D +++
Sbjct  80   TYQSPRCKSAVCSRAGSNSCGTCFSPPRPGCSNNTCGGIPDNTVTGTATSGEFALDVVSI  139

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  +  +PN +F    +FL +GL  G  G+ G+G   I LPSQ A  F   R
Sbjct  140  QSTNGSNPGRVV-KIPNLIFDCGATFLLKGLATGTVGMAGMGRHNIGLPSQFAAAFSFNR  198

Query  658  KXAVCLSSSNG  690
            K AVCL+S  G
Sbjct  199  KFAVCLTSGRG  209



>ref|XP_006654380.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=457

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 96/183 (52%), Gaps = 16/183 (9%)
 Frame = +1

Query  190  AIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSL  357
            A+V+PV+KD  T QYV   +      P+K V+D+ G  LW D    + SSS   +PCGS 
Sbjct  36   AVVLPVNKDDATQQYVTVFRQRTPQVPVKAVLDLAGAMLWVDCDAGYVSSSYAGVPCGSK  95

Query  358  KCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  504
             C +    GC             N  C    +N V+ ++ +G +  D +++     P  G
Sbjct  96   PCRLLKNAGCAVSCLDAPSSGCLNGTCAEFPKNTVTSVSTAGNVLTDVLSLPTTFRPAPG  155

Query  505  SFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
              L+  P FLF+   +FL +GL  G  G++ L  +R +LP+QLA TF +PRK A+CL ++
Sbjct  156  P-LATAPAFLFTCGRTFLTEGLAAGATGMVSLSRARFALPTQLAGTFRLPRKFALCLPAA  214

Query  685  NGA  693
            + A
Sbjct  215  SAA  217



>emb|CDY32500.1| BnaA09g50960D [Brassica napus]
Length=434

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 94/189 (50%), Gaps = 15/189 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQ  333
            AQ+ F P+A+++PV+KD  T+QY   +     L    +V D+GG  LW     D+ S++ 
Sbjct  23   AQQSFRPKALLLPVTKDKSTNQYTTVINQRTPLVAASVVFDLGGRNLWVDCDKDYVSTTY  82

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
             S  C S  CS     GC           SN  C L  +N V+  A SG +  D ++++ 
Sbjct  83   RSPRCNSAVCSRTGSTGCGTCFSPPRPGCSNNTCSLIPDNTVTGTATSGEVATDVVSIQS  142

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             +  N G  +  +PN +F    +FL +GL  G  G+ G+G     LP Q A+ F   RK 
Sbjct  143  TNGVNPGRVV-KIPNLIFGCGATFLLKGLATGTVGMAGMGRHNSGLPLQFASAFSFNRKF  201

Query  664  AVCLSSSNG  690
            AVCL+S  G
Sbjct  202  AVCLTSGRG  210



>gb|KDO70938.1| hypothetical protein CISIN_1g041364mg, partial [Citrus sinensis]
Length=311

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 97/169 (57%), Gaps = 9/169 (5%)
 Frame = +1

Query  196  VIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSIPCGSLKCSMAN  375
            VIPV KD  T QYVA+++    L P+KL V +GG      + SS+     CGS +C++AN
Sbjct  4    VIPVVKDAATLQYVAEIKQTTPLVPVKLTVHLGG------YVSSTNKIARCGSAQCNLAN  57

Query  376  PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFSFVPSF  555
             K C    IC    ENP+S     G ++ D ++++  +  N G  ++ V NF+F     F
Sbjct  58   VKAC-GGGICGADPENPISNTGTFGDIRIDVLSIQSTNSRNPGRAVT-VLNFIFLCGSEF  115

Query  556  LFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS-SNGAII  699
            + QGL NGV G+ GLG S+++LPSQLA  F +  K A+ LS   NG II
Sbjct  116  VLQGLANGVVGIAGLGRSKVALPSQLAAAFSLKTKFALYLSPFGNGVII  164



>gb|KHN03449.1| Basic 7S globulin [Glycine soja]
Length=410

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 100/190 (53%), Gaps = 20/190 (11%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA-----SSSQGSIPC  348
            P   +IPV+KD  T QY+  L  G  L P KLV+D+GGPFLW   A     SSS  + P 
Sbjct  10   PVWFLIPVTKDASTLQYITTLSYGTPLLPTKLVLDLGGPFLWLHCASRNTPSSSSLTTPH  69

Query  349  GSLKCSMANPKGCTS-------NEI-----CELQFENPVS-KMAGSGVLKEDTIAVELID  489
             SL+C  A     T+       +E+     C++  EN ++  +A  G L ED +A++   
Sbjct  70   RSLQCFTAKTHKSTNSFLSSPVDEVHQYHPCQVFPENSITGTVASEGELVEDLMALQSPQ  129

Query  490  EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAV  669
            E   G  + H    LF+  P+ L  GL  G  G+LGLG SR S PSQ+ + F   RK  +
Sbjct  130  EEEGGQLVEH--QSLFTCSPTTLLNGLARGARGMLGLGRSRSSFPSQVFDNFSTHRKLTL  187

Query  670  CLSSSNGAII  699
            CLSSS G ++
Sbjct  188  CLSSSKGVVL  197



>ref|XP_003550008.2| PREDICTED: basic 7S globulin 2-like [Glycine max]
Length=432

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 80/219 (37%), Positives = 118/219 (54%), Gaps = 23/219 (11%)
 Frame = +1

Query  97   SSMAYNPsllslfslvflATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLK  276
            ++MAY+ +++  F L  ++T+S +  P +    +IPV+KD  T QY+  L  G  L P K
Sbjct  6    ATMAYSFAMIISFLLCLMSTLSHSLSPVW---FLIPVTKDASTLQYITTLSYGTPLLPTK  62

Query  277  LVVDVGGPFLWADWA-----SSSQGSIPCGSLKCSMANPKGCTS-------NEI-----C  405
            LV+D+GGPFLW   A     SSS  + P  SL+C  A     T+       +E+     C
Sbjct  63   LVLDLGGPFLWLHCASRNTPSSSSLTTPHRSLQCFTAKTHKSTNSFLSSPVDEVHQYHPC  122

Query  406  ELQFENPVS-KMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngv  582
            ++  EN ++  +A  G L ED +A++   E   G  + H    LF+  P+ L  GL  G 
Sbjct  123  QVFPENSITGTVASEGELVEDLMALQSPQEEEGGQLVEH--QSLFTCSPTTLLNGLARGA  180

Query  583  ngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGAII  699
             G+LGLG SR S PSQ+ + F   RK  +CLSSS G ++
Sbjct  181  RGMLGLGRSRSSFPSQVFDNFSTHRKLTLCLSSSKGVVL  219



>ref|XP_006296506.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
 gb|EOA29404.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
Length=437

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 94/189 (50%), Gaps = 15/189 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A+  F P+A+++P++KD  T QY   ++    L P+ +V D+GG  LW D    + SSS 
Sbjct  27   AKTSFRPKALILPITKDPSTLQYTTVIKQRTPLVPVSVVFDLGGRDLWVDCDKGYVSSSY  86

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
             S  C S  CS A    C           SN  C    +N V+  A SG    D ++++ 
Sbjct  87   HSPRCNSAVCSRAGSTSCGTCFSPPKPGCSNNTCGSIPDNTVTGWATSGEYALDVVSIQS  146

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             +  N G F+  +P+F+FS     + +GL  G  G+  +G   I LPSQ A  F   RK 
Sbjct  147  TNGSNPGRFV-KIPSFIFSCGSDNILKGLAKGTVGMAAMGRHNIGLPSQFAAAFSFKRKF  205

Query  664  AVCLSSSNG  690
            AVCL+S  G
Sbjct  206  AVCLTSGKG  214



>ref|XP_008649625.1| PREDICTED: basic 7S globulin-like [Zea mays]
 gb|AFW77950.1| hypothetical protein ZEAMMB73_390094 [Zea mays]
Length=438

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 92/174 (53%), Gaps = 16/174 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+++PVSKD  T QYV   +    L P+K V+D+ G  LW D    +AS++   +PCG
Sbjct  34   PSAVLLPVSKDGATQQYVTGFRQRTPLVPVKAVLDLAGATLWVDCEAGYASATYSRVPCG  93

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S  C ++    C +           N+ C    EN V++++ SG +  D +A+     P 
Sbjct  94   SSLCRLSRSAACATSCSGAPSPSCLNDTCGGFPENTVTQVSTSGNVITDVLALPTTFRPA  153

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
             G  L+  P FLF+   +FL QGL  G  G+  L  SR +LP+QLA+TF   RK
Sbjct  154  PGP-LATAPAFLFTCGATFLTQGLAAGAAGMASLSRSRFALPTQLASTFRFSRK  206



>gb|EPS72958.1| hypothetical protein M569_01796, partial [Genlisea aurea]
Length=422

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 97/186 (52%), Gaps = 9/186 (5%)
 Frame = +1

Query  154  TISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            T   A  P  PR +++ V KD  T QYV  ++      P+KLVVD+GG FLW D    + 
Sbjct  11   TTGHASSPPRPRELLLTVRKDAATQQYVTVIRQRTPEVPVKLVVDLGGQFLWVDCDRNYI  70

Query  322  SSSQGSIPCGSLKCSMA-NPKGCTSN-EICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            SSS  ++ C + +C++A N   C +N   C +   +P     G   L ED ++V   D  
Sbjct  71   SSSLRNVRCNTAECNLAGNSVACGNNGTTCSVFPGSPFLTTIGD--LVEDVVSVASTDGT  128

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G + + VP F F+   + L  GL  G  G+ GLG SRI +P Q A  F   RK A+CL
Sbjct  129  NPGPY-ATVPRFAFACGSTALLHGLARGATGIAGLGRSRIGVPLQFAADFSFGRKFAICL  187

Query  676  SSSNGA  693
            SSS  A
Sbjct  188  SSSTAA  193



>ref|NP_001055497.1| Os05g0403300 [Oryza sativa Japonica Group]
 gb|AAT85212.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17411.1| Os05g0403300 [Oryza sativa Japonica Group]
Length=455

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 99/189 (52%), Gaps = 18/189 (10%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P ++V+PVSKD  T QYV   +      P+K V+D+ G  LW D    + SSS   + CG
Sbjct  32   PSSVVLPVSKDDATQQYVTMFRQRTPQVPVKAVLDLAGTMLWVDCDAGYVSSSYAGVRCG  91

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            +  C +    GC             N+ C    +N  + ++ +G +  D +++     P 
Sbjct  92   AKPCRLLKNAGCAITCLDAVSAGCLNDTCSEFPKNTATSVSTAGNIITDVLSLPTTFRPA  151

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL-  675
             G  L+  P FLF+   +FL QGL +G  G++ L  +R +LP+QLA+TFG  RK A+CL 
Sbjct  152  PGP-LATAPAFLFTCGHTFLTQGLADGATGMVSLSRARFALPTQLADTFGFSRKFALCLP  210

Query  676  -SSSNGAII  699
             +S+ G ++
Sbjct  211  PASAAGVVV  219



>ref|XP_008438716.1| PREDICTED: basic 7S globulin-like isoform X1 [Cucumis melo]
 ref|XP_008438717.1| PREDICTED: basic 7S globulin-like isoform X2 [Cucumis melo]
Length=425

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 98/187 (52%), Gaps = 16/187 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A   F P+++V+PV K  P+ QY+ Q+     L P+ L VD+GG F+W D    + SSS 
Sbjct  22   AATSFTPKSLVLPVIKH-PSLQYIIQIHQRTPLVPVNLTVDLGGRFMWVDCDRGYVSSSY  80

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
                C S +C +A    C           +N  C L  EN V +++ SG +  D ++V  
Sbjct  81   KPARCRSAQCYLAKSISCGKCYLPPHPGCNNHTCHLPAENTVIQLSSSGEVTSDVVSVSS  140

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             ++ N    LS V NFLF    +FL +GL  GV G+ G G +RISLPSQ A  F   RK 
Sbjct  141  TNDFNPTRALS-VHNFLFVCSSTFLLEGLAGGVTGMAGFGRTRISLPSQFAAAFSFNRKF  199

Query  664  AVCLSSS  684
             VCLS S
Sbjct  200  TVCLSGS  206



>ref|XP_008222995.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=457

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 105/190 (55%), Gaps = 20/190 (11%)
 Frame = +1

Query  175  PFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD-----WASSSQGS  339
            P  P+A+V+P++KD  T QY+  ++       LKL VD+GG FLW D     + SS+   
Sbjct  31   PLKPKALVLPIAKDASTLQYITTIKQRTPPVTLKLTVDLGGQFLWVDCNEGEYISSTYKP  90

Query  340  IPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMA-GSGVLKEDTI-AVE  480
              C + +CS+AN K C            +N  C L  +N V   A  +G + +D +  + 
Sbjct  91   AYCNATQCSIANSKECNWECFFPKRPGCNNRTCILFPDNTVIGYADNNGEVGQDILWGLH  150

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQg--lgngvngvlglgnSRISLPSQLANTFGIP  654
              D  ++G  +S++PNF+F+   +  +    L NGV G+ GLG +RI+LP+Q A+ + +P
Sbjct  151  STDGSHSGPKVSNIPNFIFACSSNTFYGVLGLANGVKGMAGLGRTRIALPTQFASAYKLP  210

Query  655  RKXAVCLSSS  684
            RK A+CL SS
Sbjct  211  RKFAICLPSS  220



>ref|NP_001055496.1| Os05g0402900 [Oryza sativa Japonica Group]
 dbj|BAF17410.1| Os05g0402900 [Oryza sativa Japonica Group]
Length=437

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 90/174 (52%), Gaps = 16/174 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+++PVSKD  T QYV   +     APLK V+D+ G  LW D    + SSS   +PCG
Sbjct  34   PSAVLLPVSKDDATQQYVTMFRQRTPQAPLKAVLDLAGATLWVDCEAGYVSSSYARVPCG  93

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S +C +A    C +           N+ C    EN V+ ++ SG +  D +++     P 
Sbjct  94   SKQCRLAKTNACATSCDGAPSPACLNDTCGGFPENTVTHVSTSGNVITDVLSLPTTFRPA  153

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
             G  L+  P FLF+   +FL +GL  G  G++ L  +R + P+QLA TF   RK
Sbjct  154  PGP-LATAPAFLFTCGATFLTEGLAAGATGMVSLSRARFAFPTQLAATFRFSRK  206



>ref|XP_008246503.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=431

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 103/202 (51%), Gaps = 22/202 (11%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            AT S  Q P  P  +V+ V KD  T+ +VAQ+     L     V+D+ G FL  +    +
Sbjct  24   ATKSQTQVPIRPNKLVLKVQKDRATNLHVAQIHKRTPLVQFPFVIDLTGRFLSVNCENQY  83

Query  319  ASSSQGSIPCGSLKCSMANPK------------GCTSNEICELQFENPVSKMAGSGVLKE  462
             SS+  +  C S +C+ AN              GC +N  C L   NPV++ +  G L E
Sbjct  84   TSSTYKAPDCHSSQCARANSHTCRTCSSSKTRPGCHTNA-CGLLTTNPVTQQSALGELAE  142

Query  463  DTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLAN  639
            D + +      + G  ++H P FLF+  PS + Q      V GV GLG+S ISLP QLA+
Sbjct  143  DVLKIPSTQGSSPGPMVTH-PQFLFACAPSNILQKGLPKNVQGVAGLGHSPISLPYQLAS  201

Query  640  TFGIPRKXAVCLSSS---NGAI  696
             FG P K AVCL+SS   NGA+
Sbjct  202  HFGFPPKFAVCLTSSPGKNGAV  223



>gb|EYU20619.1| hypothetical protein MIMGU_mgv1a026442mg, partial [Erythranthe 
guttata]
Length=427

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 90/180 (50%), Gaps = 20/180 (11%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADW--ASSSQGSIPC  348
            P A   P+ KD  T+QY   +Q G N   L +V+D+GG FLW    D+  A+S+   IPC
Sbjct  21   PEAFTFPIKKDDTTNQYYTNIQFGSNSTKLNVVIDLGGNFLWFNSEDYLNAASTFHPIPC  80

Query  349  GSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            G+ KC +A   GCT           +N  C     NP S  +G   L EDT+ +      
Sbjct  81   GTRKCRIAEAIGCTFCFLKPAQPGCTNNTCSDYSLNPFSGTSGYSGLGEDTLRL----RS  136

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
              G  +  V +F F +    + +GL    +GV+ LG +RISL +QLA+ F I  K  +C+
Sbjct  137  ARGGNVYAVDDFPFQYAHDAMLEGLAGPASGVIALGRTRISLQAQLASAFKIREKFTLCV  196



>gb|KCW84282.1| hypothetical protein EUGRSUZ_B01133 [Eucalyptus grandis]
Length=437

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 107/204 (52%), Gaps = 24/204 (12%)
 Frame = +1

Query  154  TISLAQ-RPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            T+S  Q + F P+A+++PV+KD    QY  Q++    L P+KL +DVGG F+W      +
Sbjct  17   TVSQPQAKTFQPKALLLPVTKDSSLQQYTTQIKQRTPLVPIKLTIDVGGNFMWVKCEKGY  76

Query  319  ASSSQGSIPCGS------------LKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKE  462
             SSS   +PCGS            +KC   +  GC  N      + NP ++++  G +  
Sbjct  77   VSSSYRYVPCGSKICKISRSGACVVKCPPPHRPGCNDNACSHFSY-NPYTRISTLGEMAA  135

Query  463  DTIAVELIDEPNAGSFLSHVPNFLFS--FVPSFLFQglgngvngvlglgnSRISLPSQLA  636
            D + ++  D  ++G  +  VP  +FS  F    L +GL +G  G+ GLG S +SLPS  A
Sbjct  136  DAVLIQSTDGRSSGPMV-FVPGLVFSCTFRSPSLLKGLSSGAEGIAGLGRSLVSLPSLFA  194

Query  637  NTFGIPRKXAVCLSS---SNGAII  699
            + F   R  A+CLSS   SNG II
Sbjct  195  SAFKFQRIFAMCLSSSSQSNGVII  218



>gb|EAY97992.1| hypothetical protein OsI_19909 [Oryza sativa Indica Group]
Length=437

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 90/174 (52%), Gaps = 16/174 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+++PVSKD  T QYV   +     AP+K V+D+ G  LW D    + SSS   +PCG
Sbjct  34   PSAVLLPVSKDDATQQYVTMFRQRTPQAPVKAVLDLAGATLWVDCEAGYVSSSYARVPCG  93

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S +C +A    C +           N+ C    EN V+ ++ SG +  D +++     P 
Sbjct  94   SKQCRLAKTNACATSCDGAPSPACLNDTCGGFPENTVTHVSTSGNIITDVLSLPTTFRPA  153

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
             G  L+  P FLF+   +FL +GL  G  G++ L  +R + P+QLA TF   RK
Sbjct  154  PGP-LATAPAFLFTCGATFLTEGLAAGATGMVSLSRARFAFPTQLAATFRFSRK  206



>ref|XP_010045852.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=456

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 107/204 (52%), Gaps = 24/204 (12%)
 Frame = +1

Query  154  TISLAQ-RPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            T+S  Q + F P+A+++PV+KD    QY  Q++    L P+KL +DVGG F+W      +
Sbjct  36   TVSQPQAKTFQPKALLLPVTKDSSLQQYTTQIKQRTPLVPIKLTIDVGGNFMWVKCEKGY  95

Query  319  ASSSQGSIPCGS------------LKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKE  462
             SSS   +PCGS            +KC   +  GC  N      + NP ++++  G +  
Sbjct  96   VSSSYRYVPCGSKICKISRSGACVVKCPPPHRPGCNDNACSHFSY-NPYTRISTLGEMAA  154

Query  463  DTIAVELIDEPNAGSFLSHVPNFLFS--FVPSFLFQglgngvngvlglgnSRISLPSQLA  636
            D + ++  D  ++G  +  VP  +FS  F    L +GL +G  G+ GLG S +SLPS  A
Sbjct  155  DAVLIQSTDGRSSGPMV-FVPGLVFSCTFRSPSLLKGLSSGAEGIAGLGRSLVSLPSLFA  213

Query  637  NTFGIPRKXAVCLSS---SNGAII  699
            + F   R  A+CLSS   SNG II
Sbjct  214  SAFKFQRIFAMCLSSSSQSNGVII  237



>ref|XP_004495384.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=443

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 101/180 (56%), Gaps = 8/180 (4%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDF--PTSQYVAQLQMGYNLAPLKLVVDVGGPFLW-----ADWAS  324
            AQ    P+A+V+P++KD    T QYV Q++    L P+KL +D+GG +LW      ++ S
Sbjct  27   AQTSLRPKALVLPITKDISSTTPQYVTQIKQRTPLVPIKLTIDLGGGYLWVNCEKGNYVS  86

Query  325  SSQGSIPCGSLKCSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  504
            S+     C S +CS+    GC S  IC     N ++ ++  G +  D ++V+  D  N G
Sbjct  87   STSKPTLCTSSQCSLFASHGCNSENICARSPTNTITGVSSYGDIHSDIVSVQSTDGNNPG  146

Query  505  SFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
              +S VPNFLF    + + + L  GV G+ GLG +++S+ SQ ++ F   RK A+CL SS
Sbjct  147  RVVS-VPNFLFICGSNVVQKDLAKGVKGMAGLGRTKVSIFSQFSSAFSFNRKFAICLGSS  205



>gb|KHN03053.1| Basic 7S globulin [Glycine soja]
Length=414

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 100/190 (53%), Gaps = 22/190 (12%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA-----SSSQGSIPC  348
            P + +IPV+KD  T QY+  L  G  L P  LV+D+GGPFLW   A     SSS  + P 
Sbjct  25   PASFLIPVTKDASTLQYITTLSYGTPLVPTPLVLDLGGPFLWLHCASRNTPSSSSLTTPH  84

Query  349  GSLKCSMANPKGCTS-------NEI-----CELQFENPVS-KMAGSGVLKEDTIAVELID  489
             SL+C  A     T+       +E+     C++  EN ++  +A  G L ED +A++   
Sbjct  85   RSLQCFTAKTHKSTNSFLSSPVDEVDQYQPCQVFPENSITGTIAAEGELVEDLMALQSAK  144

Query  490  EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAV  669
            E   G  + H   F  S  P+ L  GL  G  G++GLG SR SLPSQ+ + F   RK  +
Sbjct  145  E--KGQLVEHQSRFTCS--PTTLLHGLAKGARGMVGLGRSRSSLPSQVFDNFSTHRKLTL  200

Query  670  CLSSSNGAII  699
            CLSSS G ++
Sbjct  201  CLSSSKGVVL  210



>ref|NP_001239980.1| uncharacterized protein LOC100806719 precursor [Glycine max]
 gb|ACU23537.1| unknown [Glycine max]
Length=414

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 100/190 (53%), Gaps = 22/190 (12%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA-----SSSQGSIPC  348
            P + +IPV+KD  T QY+  L  G  L P  LV+D+GGPFLW   A     SSS  + P 
Sbjct  25   PASFLIPVTKDASTLQYITTLSYGTPLVPTPLVLDLGGPFLWLHCASRNTPSSSSLTTPH  84

Query  349  GSLKCSMANPKGCTS-------NEI-----CELQFENPVS-KMAGSGVLKEDTIAVELID  489
             SL+C  A     T+       +E+     C++  EN ++  +A  G L ED +A++   
Sbjct  85   RSLQCFTAKTHKSTNSFLSSPVDEVDQYQPCQVFPENSITGTIAAEGELVEDLMALQSAK  144

Query  490  EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAV  669
            E   G  + H   F  S  P+ L  GL  G  G++GLG SR SLPSQ+ + F   RK  +
Sbjct  145  E--KGQLVEHQSRFTCS--PTTLLHGLAKGARGMVGLGRSRSSLPSQVFDNFSTHRKLTL  200

Query  670  CLSSSNGAII  699
            CLSSS G ++
Sbjct  201  CLSSSKGVVL  210



>ref|XP_010035585.1| PREDICTED: basic 7S globulin [Eucalyptus grandis]
Length=436

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 100/198 (51%), Gaps = 20/198 (10%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            +LA   F P+A+VIPV+KD  T QY  Q++    L P+KL +DVGG F W +    + SS
Sbjct  21   TLATTSFQPKALVIPVTKDSSTLQYTTQIKQRTPLVPVKLTIDVGGNFQWVNCDGGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCTS-----------NEICELQFENPVSKMA-GSGVLKEDTI  471
            S   +PC S  C  +    C +           N  C    +NP S +  G G +  DT 
Sbjct  81   SYRPVPCDSPICKASGSAACETECLAPPGPGCYNNTCSHIPDNPFSSIGIGGGEMASDTT  140

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
             ++  D    G  +  VP  +F+   + +  GL  G  G+ GLG S +SLP Q A+ F  
Sbjct  141  VIQSTDGRTVGKAVV-VPRVVFTCGTTSVLGGLSAGALGMAGLGRSEVSLPVQFASAFKF  199

Query  652  PRKXAVCL---SSSNGAI  696
            P+K ++CL   SSSNG I
Sbjct  200  PKKFSMCLSSSSSSNGVI  217



>ref|XP_009625013.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=436

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 105/203 (52%), Gaps = 22/203 (11%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            +T  LA+  F P+ + + V KD  + QY+ ++Q    L PLKL + + G  LW D    +
Sbjct  22   STNCLAKTTFHPKTLFLAVKKDPSSLQYITEIQQRTPLVPLKLAIHLAGDSLWVDCENGY  81

Query  319  ASSSQGSIPCGSLKCSMANPKGC-------------TSNEICELQFENPVSKMAGSGVLK  459
             SS+     C S +C +A+   C              + + C    ENP+ ++  SG + 
Sbjct  82   KSSTYKPSRCKSKQCKLASTTQCGECLLGFVQRGPGCNKDACYNHVENPLVEILTSGEIA  141

Query  460  EDTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlg-lgnSRISLPSQLA  636
            +D ++++ I+E   G  ++ +P F+FS   S++ Q LG  V G +G    S +S+P+Q A
Sbjct  142  DDVLSIQSINESFPGP-VATIPKFIFSCAGSYVTQDLGKDVKGTVGFGHQSAVSVPAQFA  200

Query  637  NTFGIPRKXAVCLSSS---NGAI  696
            + F   RK A+CLSSS   NG I
Sbjct  201  SAFKFSRKFAICLSSSTERNGII  223



>gb|KEH36784.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=430

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 95/181 (52%), Gaps = 16/181 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+V+PV++D+ TSQYV  +     + P+KL +D+ G FLW +    + SSS   + C 
Sbjct  25   PNALVLPVTRDYATSQYVTLIHQRTPIVPIKLTLDLSGQFLWINCDEGYVSSSYHPVHCN  84

Query  352  SLKCSMANPK----------GCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            + +CS+   K          GC  N  C L   N  ++    G +  D +A+   D    
Sbjct  85   TKQCSLTGSKSCRNCFLSEPGCNMNT-CNLFPNNIFTRTNQIGEVALDVVAIHSTDGSKL  143

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G  ++ + NFLF+   + L +GL +GV G+ G G S ISLPS  A+ F    K A+CLSS
Sbjct  144  GKIVT-INNFLFTCGRTNLLKGLASGVKGMAGFGKSNISLPSLFASAFNFKTKFAICLSS  202

Query  682  S  684
            S
Sbjct  203  S  203



>ref|XP_006418255.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
 gb|ESQ36608.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
Length=437

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 91/185 (49%), Gaps = 15/185 (8%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P+A+++PV+KD  T QY   +     L    +V D+GG  LW D    + SS+  S  
Sbjct  30   FRPKALLLPVTKDKSTLQYTTVINQRTPLVAASVVFDLGGRELWVDCDKGYVSSTYSSPR  89

Query  346  CGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            C S  CS A    C           SN  C    +N V+  A SG    D ++++  +  
Sbjct  90   CRSAVCSRAGSNSCGICFSPPRPGCSNNTCGSIPDNTVTGTATSGEYAIDVVSIQSTNGS  149

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G  +  +PNF+FS   +FL +GL  G  G+ G+G   + LPSQ A  F   RK AVCL
Sbjct  150  NPGRVV-KIPNFVFSCGSTFLLKGLARGTVGMAGMGRHNVGLPSQFAAAFSFNRKFAVCL  208

Query  676  SSSNG  690
            +S  G
Sbjct  209  TSGRG  213



>ref|XP_006654378.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=436

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 89/174 (51%), Gaps = 16/174 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+++P SKD  T QYV   +     AP+K V+D+ G  LW D    + SSS   +PCG
Sbjct  33   PPAVLLPASKDDATQQYVTMFRQRTPQAPVKAVLDLAGATLWVDCEAGYVSSSYARVPCG  92

Query  352  SLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  498
            S  C +A    C +           N+ C    EN V+ ++ SG +  D +++     P 
Sbjct  93   SKACRLAKSNACATSCDGAPSPACLNDTCGGFPENTVTHVSTSGNIITDVLSLPTTFRPA  152

Query  499  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
             G  L+  P FLF+   +FL +GL  G  G++ L  +R +LP+QLA TF   RK
Sbjct  153  PGP-LATAPAFLFTCGATFLLEGLAAGATGMVSLSRARFALPTQLAATFRFSRK  205



>emb|CAN68737.1| hypothetical protein VITISV_030194 [Vitis vinifera]
Length=439

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 98/181 (54%), Gaps = 16/181 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+V+ VSK+  T+ +V  +Q    L P+ LV+DV G  LW D    + SS+  +  C 
Sbjct  38   PNALVLLVSKNEATNLHVVDIQKRTPLKPVPLVLDVNGRSLWVDCESNYLSSTYNAPQCH  97

Query  352  SLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S +CS AN   C +          N  C L   NP+S     G L +D +++   D  + 
Sbjct  98   STQCSRANLHDCRTCSAQTRPGCHNNTCGLNAANPISGETAFGELAQDVLSIPSTDGSSL  157

Query  502  GSFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
            G  ++ +P FLF+  PS L Q      V GV+GLG++ I+LP+QLA+ FG  +K A+CL+
Sbjct  158  GQLVT-IPQFLFACAPSSLAQKGFPPAVQGVVGLGHTSIALPTQLASHFGFQQKFALCLT  216

Query  679  S  681
            S
Sbjct  217  S  217



>ref|XP_010659830.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=455

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 98/181 (54%), Gaps = 16/181 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P A+V+ VSK+  T+ +V  +Q    L P+ LV+DV G  LW D    + SS+  +  C 
Sbjct  54   PNALVLLVSKNEATNLHVVDIQKRTPLKPVPLVLDVNGRSLWVDCESNYLSSTYNAPQCH  113

Query  352  SLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S +CS AN   C +          N  C L   NP+S     G L +D +++   D  + 
Sbjct  114  STQCSRANLHDCRTCSAQTRPGCHNNTCGLNAANPISGETAFGELAQDVLSIPSTDGSSL  173

Query  502  GSFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
            G  ++ +P FLF+  PS L Q      V GV+GLG++ I+LP+QLA+ FG  +K A+CL+
Sbjct  174  GQLVT-IPQFLFACAPSSLAQKGFPPAVQGVVGLGHTSIALPTQLASHFGFQQKFALCLT  232

Query  679  S  681
            S
Sbjct  233  S  233



>ref|XP_011091050.1| PREDICTED: basic 7S globulin 2-like [Sesamum indicum]
Length=404

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 90/176 (51%), Gaps = 22/176 (13%)
 Frame = +1

Query  196  VIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADWASSSQGSIPCGSLKCS  366
             +P+ KD  TSQ+   +QMG NL  +  V+D+GGPFLW    D+ S++   IPCGS KC 
Sbjct  25   TLPIWKDMKTSQFYTTIQMGSNLVAINAVIDLGGPFLWFACNDYVSNTYAPIPCGSTKCE  84

Query  367  MANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLS  516
            +A   GC           +N+ C     NP   M  S    EDT  ++          LS
Sbjct  85   VAKGIGCVGCNLPPRPGCTNDTCGASPYNPFMDMLVSQGYAEDTFYMK--------DRLS  136

Query  517  HVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSS  684
             +P+F FS +     +GL +G  G+LGL  + IS   Q A+ F +P K ++CL SS
Sbjct  137  -LPDFSFSCMDKDFLEGLASGSTGMLGLARTDISFHKQAAHRFNLPDKFSLCLPSS  191



>ref|XP_009342159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=440

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 97/189 (51%), Gaps = 25/189 (13%)
 Frame = +1

Query  181  FPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQGSIPC  348
            + + +V+PV+KD  T QY+     G  L P+KL++D+ G +LW     D+ SS+  S  C
Sbjct  36   YQKPLVLPVAKDSSTLQYLTTFSQGTPLVPIKLIIDLSGQYLWVDCKKDYISSTYESACC  95

Query  349  GSLKCSMANPKG---CTS------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
             S +CS++N K    C S      N IC L   N V++ + S  L ED +        N 
Sbjct  96   NSAQCSLSNSKAYVICYSSKPASYNNICHLSPNNIVTRTSTSSELGEDIVX------SNP  149

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISL-----PSQLANTFGIPRKXA  666
            G  L +V N LF+   +FL + L + V G+  LG  +I L     PSQ  + F    K A
Sbjct  150  GR-LVYVANLLFTCGATFLLKYLASDVKGMASLGRDKIGLLKHXHPSQFTSAFSFSEKFA  208

Query  667  VCLSSSNGA  693
            +CLS+S+ +
Sbjct  209  ICLSTSSSS  217



>ref|XP_007205231.1| hypothetical protein PRUPE_ppa006032mg [Prunus persica]
 gb|EMJ06430.1| hypothetical protein PRUPE_ppa006032mg [Prunus persica]
Length=431

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 103/202 (51%), Gaps = 22/202 (11%)
 Frame = +1

Query  151  ATISLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  318
            AT S    P  P  +V+ V KD  T+ +VAQ+     L     V+D+ G FL  +    +
Sbjct  24   ATKSQTHVPIRPNKLVLKVQKDRATNLHVAQIHKRTPLVQFPFVIDLTGRFLSVNCENQY  83

Query  319  ASSSQGSIPCGSLKCSMANPK------------GCTSNEICELQFENPVSKMAGSGVLKE  462
             SS+  +  C S +C+ AN              GC +N  C L   NPV++ +  G L E
Sbjct  84   TSSTYKAPVCHSSQCARANSHMCRTCSSLKTRPGCHTNA-CGLLTTNPVTQQSAQGELAE  142

Query  463  DTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLAN  639
            D + +      + G  ++H P+FLF+  PS + Q      V GV GLG+S ISLP QLA+
Sbjct  143  DVLKIPSTQGSSPGPMVTH-PHFLFACAPSNILQKGLPKNVQGVAGLGHSPISLPYQLAS  201

Query  640  TFGIPRKXAVCLSSS---NGAI  696
             FG P K A+CL+SS   NGA+
Sbjct  202  HFGFPPKFALCLTSSPGKNGAV  223



>ref|XP_004962140.1| PREDICTED: basic 7S globulin-like [Setaria italica]
Length=434

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 97/190 (51%), Gaps = 19/190 (10%)
 Frame = +1

Query  184  PRAIVIPVSKDFP-TSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPC  348
            P A+V+PVSKD   T QYV   +    LAP++ V+D+ G  LW D    +ASS+   +PC
Sbjct  29   PSAVVLPVSKDAAATQQYVTSFRQRTPLAPVEAVLDLAGATLWVDCEAGYASSTYRRVPC  88

Query  349  GSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
             S  C ++    C +           N+ C     N V+ ++  G +  D +A+     P
Sbjct  89   ASKPCRLSRSAACATSCLGAPSPSCLNDTCAGFPGNTVTHVSTGGNIITDVLALPTTFRP  148

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
              G  L+  P FLF+   +FL +GL  G  G+  L  +R +LP+QLA TF   RK A+CL
Sbjct  149  APGP-LATAPAFLFTCGATFLTEGLAAGATGMASLSRARFALPTQLAATFRFSRKFALCL  207

Query  676  --SSSNGAII  699
              + S G ++
Sbjct  208  PPAGSAGVVV  217



>ref|XP_004486304.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=431

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 103/192 (54%), Gaps = 14/192 (7%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            S+A     P+A+V+PV+KD  TSQYV  +     L P+KL +D+ G FLW +    + SS
Sbjct  21   SIASTLIQPKALVLPVTKDSATSQYVTLIHQRTPLLPIKLTLDLSGQFLWINCEKGYVSS  80

Query  328  SQGSIPCGSLKCSMANPKGCT---------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
            +     C + +CS+   K C          +N  C L   N  + +   G +  D +A+ 
Sbjct  81   TYHPAHCTTKQCSITKSKFCRNCFLSKPGCNNNTCNLFPNNIFTHINEIGEVALDVVAIH  140

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              +  + G  ++ V NFLF+   + L +GL +GV G+ G G S IS+PS  A+ F + +K
Sbjct  141  STNGLSLGKIVT-VKNFLFTCGRTNLLKGLASGVKGMAGFGRSEISVPSLFASAFSLNKK  199

Query  661  XAVCLSSSNGAI  696
             ++CLSSS+G +
Sbjct  200  FSICLSSSSGVL  211



>ref|XP_009342158.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=408

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 102/184 (55%), Gaps = 8/184 (4%)
 Frame = +1

Query  172  RPFFP-RAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA-SSSQGSIP  345
            +PF P   ++  V KD  T QYV ++ +G  L   KL VD+GGPF W + A SSS   + 
Sbjct  24   KPFNPTDGLIFHVKKDVSTLQYVTEIHIGTPLLLSKLAVDLGGPFPWFNCAPSSSSRLVN  83

Query  346  CGSLKCSMANPKGC---TSNEICELQFENPVSKMAGSGVLKEDTIAV-ELIDEPNAG--S  507
              S++C  A PK      SN+ C +  EN +++MA  G L ED +AV ++ D    G  S
Sbjct  84   KRSIQCLAAKPKTHQYRRSNKKCHIFTENRITQMAIQGDLVEDIMAVNQVTDGSKTGSKS  143

Query  508  FLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSN  687
              +   NF FS  P  L  GL +G  G+LGLG +++S+ SQ++       +  +CLSSSN
Sbjct  144  ITTVDYNFQFSCAPMLLLNGLASGAKGMLGLGRTQMSMTSQISAQLSSKLQFIICLSSSN  203

Query  688  GAII  699
            G ++
Sbjct  204  GVVL  207



>ref|XP_004494958.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=440

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 97/190 (51%), Gaps = 19/190 (10%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P  +V+PV +D  T  + A +     L  L +++D+ G  LW +    ++SS+  +  C 
Sbjct  40   PNLLVLPVQQDANTGLHWAYIHKRTPLMQLPVLIDLNGKHLWVNCEQHYSSSTYQAPFCH  99

Query  352  SLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S +C+ AN   C +          N  C L   NPV++    G L +D  A+     P  
Sbjct  100  STQCARANTHTCHTCVSSFRPGCHNNTCGLMSANPVTQQTALGELAQDVFAIYTTRGPKL  159

Query  502  GSFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS  678
            G  ++ VP FLFS  PSFL Q    N V GV GL +S ISLP+QL++ FG+  +   CLS
Sbjct  160  GPMVT-VPQFLFSCAPSFLAQKGLPNNVQGVAGLAHSPISLPNQLSSHFGLKHQFTTCLS  218

Query  679  ---SSNGAII  699
                SNGAII
Sbjct  219  RYPKSNGAII  228



>ref|XP_002517167.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45330.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=435

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 95/183 (52%), Gaps = 15/183 (8%)
 Frame = +1

Query  175  PFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD---WASSSQGSIP  345
            P  P+ +V+PV KD  + QYV Q+     L  +KL VD+GG F+W D   + SSS   + 
Sbjct  30   PARPKPLVLPVLKDKCSHQYVTQINQRTPLVAVKLTVDLGGTFMWVDCDNYVSSSYTPVR  89

Query  346  CGSLKCSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDE  492
            C S  C +A+   CT+           N  C     NPV  ++ SG +  D ++++ +D 
Sbjct  90   CDSALCKLADSHSCTTECYSSPKPGCYNNTCSHIPYNPVVHVSTSGDIGLDVVSLQSMDG  149

Query  493  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
               G  +S VPN  F     F+ + L +GV GV GLG   ISLP+  ++  G+  K A+C
Sbjct  150  KYPGRNVS-VPNVPFVCGTGFMLENLADGVLGVAGLGRGNISLPAYFSSALGLQSKFAIC  208

Query  673  LSS  681
            LSS
Sbjct  209  LSS  211



>ref|XP_010481702.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=438

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 89/183 (49%), Gaps = 15/183 (8%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P+A+++PV+KD  T QY   +     L P  LV D+GG  LW D    + S++  S  C 
Sbjct  33   PKALILPVTKDRSTLQYKTVINQRTPLVPASLVFDLGGRELWVDCDKGYVSTTYRSPRCH  92

Query  352  SLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
            S  CS A    C           SN  C    +N VS  A SG    D ++++  +  N 
Sbjct  93   SAVCSRAGSTSCGTCFSPPSPGCSNNTCGAIPDNSVSGWAASGEFAIDVVSIQSTNGSNP  152

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
            G F+  +PN +F    + L +GL  G  G+ G+G   I LPSQ A  F   RK AVCL+S
Sbjct  153  GPFV-KIPNLIFGCGSTSLLKGLAKGAVGMAGMGRHNIGLPSQFAAAFSFNRKFAVCLTS  211

Query  682  SNG  690
              G
Sbjct  212  GKG  214



>ref|XP_007224945.1| hypothetical protein PRUPE_ppa021451mg [Prunus persica]
 gb|EMJ26144.1| hypothetical protein PRUPE_ppa021451mg [Prunus persica]
Length=457

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 104/192 (54%), Gaps = 20/192 (10%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD-----WASSSQ  333
            Q    P+A+V+P++KD  T QY+  ++       LKL +D+GG FLW D     + SS+ 
Sbjct  29   QSSLKPKALVLPIAKDASTLQYITTIKQRTPPVTLKLTIDLGGQFLWVDCDEGQYISSTY  88

Query  334  GSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMA-GSGVLKEDTI-A  474
                C + +CS+AN K C            +N  C L  +N V   A  +G + +D +  
Sbjct  89   KPAYCNATQCSIANSKECNWECFFPQRPGCNNRTCILFPDNTVIGSADNNGEVGQDILWG  148

Query  475  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQg--lgngvngvlglgnSRISLPSQLANTFG  648
            +   D  + G  +S++PNF+F+   +  +    L NGV G+ GLG +RI+LP+Q A+ + 
Sbjct  149  LHSTDGSHPGPKVSNIPNFIFACSSNTFYGVLGLANGVKGMAGLGRTRIALPTQFASAYK  208

Query  649  IPRKXAVCLSSS  684
            +PRK A+CL SS
Sbjct  209  LPRKFAICLPSS  220



>ref|XP_010457326.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 91/185 (49%), Gaps = 15/185 (8%)
 Frame = +1

Query  178  FFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  345
            F P+A+++PV+KD  T QY   +     L P  LV D+GG  LW D    + S++  S  
Sbjct  32   FRPKALILPVTKDRSTLQYTTVINQRTPLVPASLVFDLGGRELWVDCDKGYVSTTYRSPR  91

Query  346  CGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            C S  CS A    C           SN  C    +N V+  + SG    D ++++  +  
Sbjct  92   CNSAVCSRAGSISCGTCFSPPGPGCSNNTCGSFPDNSVTGWSTSGEFAMDVVSIQSTNGS  151

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
            N G F + +PN +FS   + L +GL  G  G+ G+G   I LPSQ A  F   RK AVCL
Sbjct  152  NPGPF-AKIPNLIFSCGSTSLLKGLAKGAVGMAGMGRHNIGLPSQFAAAFSFNRKFAVCL  210

Query  676  SSSNG  690
            +S  G
Sbjct  211  TSGKG  215



>ref|XP_008438718.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 103/188 (55%), Gaps = 17/188 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A   F P+++V+PV+K  P+ QY+ ++     L P+KL VD+GG F+W D    + SSS 
Sbjct  23   AATSFRPKSLVLPVTKH-PSLQYITEVHQRTPLVPVKLTVDLGGQFMWVDCDRDYVSSSY  81

Query  334  GSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE  480
                C S +CS+A+           P+   +N+ C L   N + +++ SG +  D ++V 
Sbjct  82   KPARCRSAQCSLASKSSSCGQCFSPPRPGCNNDTCGLFPSNTIIRLSTSGEVASDVVSVS  141

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              +  N    +S +PNFLF    +FL +GL  GV G+ G G + ISLPSQ A  F   RK
Sbjct  142  STNGFNPTRAVS-IPNFLFVCGSTFLLEGLAPGVTGMAGFGRNGISLPSQFAAAFSFNRK  200

Query  661  XAVCLSSS  684
             AVCLS S
Sbjct  201  FAVCLSGS  208



>ref|XP_006844967.1| hypothetical protein AMTR_s00058p00179910 [Amborella trichopoda]
 gb|ERN06642.1| hypothetical protein AMTR_s00058p00179910 [Amborella trichopoda]
Length=437

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 99/192 (52%), Gaps = 16/192 (8%)
 Frame = +1

Query  157  ISLAQ-RPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  321
            +SL+  + F P+A+V+PV KD  T QY+  L +   L P  L +D+GG FLW +    + 
Sbjct  21   VSLSHAQSFRPKALVVPVKKDPATLQYLITLHLKTPLQPETLTLDLGGAFLWLECGTTYT  80

Query  322  SSSQGSIPCGSLKCSMANPK----------GCTSNEICELQFENPVSKMAGSGVLKEDTI  471
            SSS   I C   +CS+              GC  N  C +   NP   ++G G L ED +
Sbjct  81   SSSYQPILCRRSQCSIVTTGCARCYTLPGPGCAPNRTCGVVPSNPFIAISGLGGLLEDVL  140

Query  472  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGI  651
            A+   D    G  ++   N+LFS  PS L +GL    +G+ GLGN +ISL +QLA  F  
Sbjct  141  AIRSTDGRAPGIQVT-TRNYLFSCAPSSLTKGLAPPSHGIAGLGNRKISLSAQLATKFSF  199

Query  652  PRKXAVCLSSSN  687
              +  +CLS S+
Sbjct  200  RPRFGLCLSGSS  211



>gb|KFK42681.1| hypothetical protein AALP_AA1G026100 [Arabis alpina]
Length=433

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 94/188 (50%), Gaps = 15/188 (8%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  327
            SLAQ  F P+A+++P++KD  T QY   +     L    +V D+GG  LW     ++ SS
Sbjct  19   SLAQTSFRPKALILPITKDQSTLQYTTIINQRTPLIAASVVFDLGGQNLWVNCDQNYISS  78

Query  328  SQGSIPCGSLKCSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAV  477
            +  S  C S  CS A   GC+S          N  C    +N +++ A SG +  D +++
Sbjct  79   TYKSPRCRSAVCSRAGSDGCSSCFLPQRPGCNNNTCGATPDNTITRTATSGEVATDVVSI  138

Query  478  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPR  657
            +  +  N G  +  + + +F    S +  GL +G  G+ G+G   I LPSQ A  F   R
Sbjct  139  QSTNGSNPGRVV-QISDLIFVCGSSNIITGLASGTVGMAGMGRHEIGLPSQFAAAFSFNR  197

Query  658  KXAVCLSS  681
            K AVCLSS
Sbjct  198  KFAVCLSS  205



>ref|XP_008458562.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=417

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 92/172 (53%), Gaps = 8/172 (5%)
 Frame = +1

Query  190  AIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSIPCGSLKCSM  369
            ++VIP++KD  T+QY+A +  G  + P+ L VD+GG  LW     SS            +
Sbjct  28   SLVIPLTKDSLTNQYLATVFHGSPIKPVHLAVDLGGRSLWMACGGSSSSRSIPSRSIQCI  87

Query  370  ANPKGCTSNEI---CELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFS  540
            A   G  S  +   C +  ENP   + G  +L EDT+AV  +    A   ++     L S
Sbjct  88   AATAGGRSGSVGGACNVIAENPFGDLEGKAILVEDTVAVGSLGRSTAAVIVA-----LHS  142

Query  541  FVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGAI  696
              P FL QGL   V GVLGLG ++ISLP+Q+A   G  R+ ++CLSS+NG +
Sbjct  143  CAPRFLLQGLAKSVKGVLGLGRNQISLPAQIATELGSHRRFSLCLSSTNGVV  194



>gb|AAB03390.1| 7S seed globulin precursor [Glycine max]
Length=427

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 95/189 (50%), Gaps = 21/189 (11%)
 Frame = +1

Query  193  IVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSLK  360
            +V+PV  D  T  + A LQ    L  + ++VD+ G  LW +    ++S +  +  C S +
Sbjct  34   VVLPVQNDGSTGLHSANLQKRTPLMQVPVLVDLNGNHLWVNCEQQYSSKTYQAPFCHSTQ  93

Query  361  CSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELID--EPNAG  504
            CS AN   C S             C L   NP+++  G G L ED +A+          G
Sbjct  94   CSRANTHQCLSCPAASRPGCHKNTCGLMSTNPITQQTGLGELGEDVLAIHATQGSTQQLG  153

Query  505  SFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS-  678
              ++ VP FLFS  PSFL Q        GV GLG++ ISLP+QLA+ FG+ R+   CLS 
Sbjct  154  PLVT-VPQFLFSCAPSFLVQKGLPRNTQGVAGLGHAPISLPNQLASHFGLQRQFTTCLSR  212

Query  679  --SSNGAII  699
              +S GAII
Sbjct  213  YPTSKGAII  221



>gb|EYU20618.1| hypothetical protein MIMGU_mgv1a018279mg [Erythranthe guttata]
Length=444

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 93/189 (49%), Gaps = 22/189 (12%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADW--ASSSQGSIPC  348
            P++ + P+ KD  T+QY   +Q+G     L +V+D+GG FL+    D+  A+SS   IPC
Sbjct  32   PQSFIFPIKKDAKTNQYYTTIQIGSKATTLDVVIDLGGKFLYFYSGDYSNATSSYRPIPC  91

Query  349  GSLKC-SMANPKGCT-------------SNEICELQFENPVSKMAGSGVLKEDTIAVELI  486
            G+ KC ++ +  GC              +N  C     NP +   G   L ED + V   
Sbjct  92   GTRKCRTVVDTDGCVVFCNTSPGPAPGCTNNTCADYALNPFTGTQGYNGLGEDALRVR--  149

Query  487  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXA  666
                       V NF F +    L   L +  +GV+GLG S+ISLP+QL++ F I RK  
Sbjct  150  -STRGSRRYYTVNNFPFQYSDPVLKDELASSTSGVIGLGRSKISLPAQLSSAFKIRRKFG  208

Query  667  VCLSSSNGA  693
            +C+ SS G 
Sbjct  209  LCVPSSGGG  217



>pdb|3AUP|A Chain A, Crystal Structure Of Basic 7s Globulin From Soybean
 pdb|3AUP|B Chain B, Crystal Structure Of Basic 7s Globulin From Soybean
 pdb|3AUP|C Chain C, Crystal Structure Of Basic 7s Globulin From Soybean
 pdb|3AUP|D Chain D, Crystal Structure Of Basic 7s Globulin From Soybean
Length=403

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 95/189 (50%), Gaps = 21/189 (11%)
 Frame = +1

Query  193  IVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSLK  360
            +V+PV  D  T  + A LQ    L  + ++VD+ G  LW +    ++S +  +  C S +
Sbjct  10   VVLPVQNDGSTGLHWANLQKRTPLMQVPVLVDLNGNHLWVNCEQQYSSKTYQAPFCHSTQ  69

Query  361  CSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELID--EPNAG  504
            CS AN   C S             C L   NP+++  G G L ED +A+          G
Sbjct  70   CSRANTHQCLSCPAASRPGCHKNTCGLMSTNPITQQTGLGELGEDVLAIHATQGSTQQLG  129

Query  505  SFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS-  678
              ++ VP FLFS  PSFL Q        GV GLG++ ISLP+QLA+ FG+ R+   CLS 
Sbjct  130  PLVT-VPQFLFSCAPSFLVQKGLPRNTQGVAGLGHAPISLPNQLASHFGLQRQFTTCLSR  188

Query  679  --SSNGAII  699
              +S GAII
Sbjct  189  YPTSKGAII  197



>gb|EYU20615.1| hypothetical protein MIMGU_mgv1a006692mg [Erythranthe guttata]
Length=435

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 95/183 (52%), Gaps = 16/183 (9%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADWASSSQGSIPCGS  354
            P A   P+ KD  T+QY   +Q+G N     +V+D+GG  L+    +++++S   + CG+
Sbjct  28   PEAFTFPIKKDDSTNQYYTNIQIGSNSTKFSVVIDLGGKLLYFNSINYSTASYRPVLCGT  87

Query  355  LKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  501
             +CS+++  GC            +N  C     NP S   G   L +D++ V       A
Sbjct  88   PQCSISSGGGCMFCVFSPPDTPCTNNTCTDYALNPFSGTRGCSPLGQDSLLVRY--ARGA  145

Query  502  GSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSS  681
              + + V NF F F    L +GL     G++GLG +RISLP+Q+A+ FG+ ++ A+CL  
Sbjct  146  HRYYTTVDNFPFQFSDPVLREGLAGPAAGLIGLGRTRISLPAQIASAFGVRQRFALCLPP  205

Query  682  SNG  690
            + G
Sbjct  206  AGG  208



>ref|XP_004134154.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170543.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57020.1| Xyloglucan-specific endoglucanase inhibitor protein [Cucumis 
sativus]
Length=435

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 102/188 (54%), Gaps = 17/188 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            A   F P+++++PV+K  P+ QY+ ++     L P+KL VD+GG F+W D    + SSS 
Sbjct  23   AATSFRPKSLLLPVTKH-PSLQYITEIHQRTPLVPVKLTVDLGGQFMWVDCDRGYVSSSY  81

Query  334  GSIPCGSLKCSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE  480
                C S +CS+A+           P+   +N  C L   N + +++ SG +  D ++V 
Sbjct  82   KPARCRSAQCSLASKSSACGQCFSPPRPGCNNNTCSLFPGNTIIRLSTSGEVASDVVSVS  141

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
              +  N    +S +PNFLF    +FL +GL  GV G+ G G + ISLPSQ A  F   RK
Sbjct  142  STNGFNPTRAVS-IPNFLFVCGSTFLLEGLAPGVTGMAGFGRNGISLPSQFAAAFSFNRK  200

Query  661  XAVCLSSS  684
             AVCLS S
Sbjct  201  FAVCLSGS  208



>emb|CAA34489.1| unnamed protein product [Glycine max]
Length=427

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 95/189 (50%), Gaps = 21/189 (11%)
 Frame = +1

Query  193  IVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSLK  360
            +V+PV  D  T  + A LQ    L  + ++VD+ G  LW +    ++S +  +  C S +
Sbjct  34   VVLPVQNDGSTGLHWANLQKRTPLMQVPVLVDLNGNHLWVNCEQQYSSKTYQAPFCHSTQ  93

Query  361  CSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELID--EPNAG  504
            CS AN   C S             C L   NP+++  G G L ED +A+          G
Sbjct  94   CSRANTHQCLSCPAASRPGCHKNTCGLMSTNPITQQTGLGELGEDVLAIHATQGSTQQLG  153

Query  505  SFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS-  678
              ++ VP FLFS  PSFL Q        GV GLG++ ISLP+QLA+ FG+ R+   CLS 
Sbjct  154  PLVT-VPQFLFSCAPSFLVQKGLPRNTQGVAGLGHAPISLPNQLASHFGLQRQFTTCLSR  212

Query  679  --SSNGAII  699
              +S GAII
Sbjct  213  YPTSKGAII  221



>ref|XP_003521716.1| PREDICTED: basic 7S globulin [Glycine max]
 sp|P13917.2|7SB1_SOYBN RecName: Full=Basic 7S globulin; AltName: Full=SBg7S; Short=Bg; 
Contains: RecName: Full=Basic 7S globulin high kDa subunit; 
Contains: RecName: Full=Basic 7S globulin low kDa subunit; 
Flags: Precursor [Glycine max]
 dbj|BAA03681.1| basic 7S globulin [Glycine max]
Length=427

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 95/189 (50%), Gaps = 21/189 (11%)
 Frame = +1

Query  193  IVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSLK  360
            +V+PV  D  T  + A LQ    L  + ++VD+ G  LW +    ++S +  +  C S +
Sbjct  34   VVLPVQNDGSTGLHWANLQKRTPLMQVPVLVDLNGNHLWVNCEQQYSSKTYQAPFCHSTQ  93

Query  361  CSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELID--EPNAG  504
            CS AN   C S             C L   NP+++  G G L ED +A+          G
Sbjct  94   CSRANTHQCLSCPAASRPGCHKNTCGLMSTNPITQQTGLGELGEDVLAIHATQGSTQQLG  153

Query  505  SFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVCLS-  678
              ++ VP FLFS  PSFL Q        GV GLG++ ISLP+QLA+ FG+ R+   CLS 
Sbjct  154  PLVT-VPQFLFSCAPSFLVQKGLPRNTQGVAGLGHAPISLPNQLASHFGLQRQFTTCLSR  212

Query  679  --SSNGAII  699
              +S GAII
Sbjct  213  YPTSKGAII  221



>ref|XP_004233956.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=436

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 105/203 (52%), Gaps = 28/203 (14%)
 Frame = +1

Query  160  SLAQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  327
            +LA+  F P+ + + V KD  + Q+++++Q    L PLKL + + G  +W D    + SS
Sbjct  25   TLAKTTFHPKTLFLAVKKDPISLQHISEIQQRTPLVPLKLSIHLAGDSVWVDCEKGYNSS  84

Query  328  SQGSIPCGSLKCSMANPKGC-------------TSNEICELQFENPVSKMAGSGVLKEDT  468
            S  +  C S +C +A+   C              + + C    ENP+ ++   G +  D 
Sbjct  85   SYKAAHCKSSQCKLASTTLCGDCLVGLVERGPGCNKDGCYNTIENPLVQILTRGEIARDV  144

Query  469  IAVELIDEPNAGSF---LSHVPNFLFSFVPSFLFQglgngvngvlg-lgnSRISLPSQLA  636
            + ++ I    +GSF   ++ +PN++FS   S++ Q LG  V G +G    S +SLP QLA
Sbjct  145  LTIKSI----SGSFVGPVATIPNYIFSCAGSYVTQDLGKDVKGTIGFGHQSAVSLPVQLA  200

Query  637  NTFGIPRKXAVCLSSS---NGAI  696
            + F   RK A+CLSSS   NG I
Sbjct  201  SAFKFTRKFAICLSSSTERNGII  223



>ref|XP_004170412.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
Length=414

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 101/172 (59%), Gaps = 8/172 (5%)
 Frame = +1

Query  190  AIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW-ADWASSSQGSIPCGSLKCS  366
            ++VIP++KD  T+QYVA +  G  + P+ L VD+GG  LW A   SSS  SIP  S++C 
Sbjct  25   SLVIPLTKDSLTNQYVATVFHGSPIKPVHLAVDLGGQSLWMACGGSSSSRSIPSRSIQCI  84

Query  367  MANPKGCTSNEI--CELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFS  540
             A   G + +    C++   NP   + G  +L EDT+AV  +D   A   ++     L S
Sbjct  85   AATGGGRSGSVGGACDVIAGNPFGDLEGKAILVEDTVAVRSLDRSTAAVIVA-----LHS  139

Query  541  FVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGAI  696
              P FL QGL   V GVLGLG ++ISLP+Q+A   G  R+ ++CLSS+NG +
Sbjct  140  CAPRFLLQGLAKSVKGVLGLGRNQISLPAQIATELGSHRRFSLCLSSTNGVV  191



>ref|NP_563679.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAG48774.1|AF332411_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72120.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|84105 and gb|AI100071 
come from this gene [Arabidopsis thaliana]
 gb|AEE27547.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=434

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 91/189 (48%), Gaps = 15/189 (8%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ  F P+A+++PV+KD  T QY   +     L P  +V D+GG   W D    + S++ 
Sbjct  23   AQPSFRPKALLLPVTKDPSTLQYTTVINQRTPLVPASVVFDLGGREFWVDCDQGYVSTTY  82

Query  334  GSIPCGSLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
             S  C S  CS A    C           SN  C    +N ++  A SG    D ++++ 
Sbjct  83   RSPRCNSAVCSRAGSIACGTCFSPPRPGCSNNTCGAFPDNSITGWATSGEFALDVVSIQS  142

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKX  663
             +  N G F+  +PN +FS   + L +GL  G  G+ G+G   I LP Q A  F   RK 
Sbjct  143  TNGSNPGRFV-KIPNLIFSCGSTSLLKGLAKGAVGMAGMGRHNIGLPLQFAAAFSFNRKF  201

Query  664  AVCLSSSNG  690
            AVCL+S  G
Sbjct  202  AVCLTSGRG  210



>ref|XP_004151001.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN47256.1| Basic 7S globulin 2 small subunit [Cucumis sativus]
Length=414

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 101/172 (59%), Gaps = 8/172 (5%)
 Frame = +1

Query  190  AIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW-ADWASSSQGSIPCGSLKCS  366
            ++VIP++KD  T+QYVA +  G  + P+ L VD+GG  LW A   SSS  SIP  S++C 
Sbjct  25   SLVIPLTKDSLTNQYVATVFHGSPIKPVHLAVDLGGQSLWMACGGSSSSRSIPSRSIQCI  84

Query  367  MANPKGCTSNEI--CELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFS  540
             A   G + +    C++   NP   + G  +L EDT+AV  +D   A   ++     L S
Sbjct  85   AATGGGRSGSVGGACDVIAGNPFGDLEGKAILVEDTVAVRSLDRSTAAVIVA-----LHS  139

Query  541  FVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCLSSSNGAI  696
              P FL QGL   V GVLGLG ++ISLP+Q+A   G  R+ ++CLSS+NG +
Sbjct  140  CAPRFLLQGLAKSVKGVLGLGRNQISLPAQIATELGSHRRFSLCLSSTNGVV  191



>pdb|4PPH|A Chain A, Crystal Structure Of Conglutin Gamma, A Unique Basic 
7s Globulin From Lupine Seeds
 pdb|4PPH|B Chain B, Crystal Structure Of Conglutin Gamma, A Unique Basic 
7s Globulin From Lupine Seeds
 pdb|4PPH|C Chain C, Crystal Structure Of Conglutin Gamma, A Unique Basic 
7s Globulin From Lupine Seeds
 pdb|4PPH|D Chain D, Crystal Structure Of Conglutin Gamma, A Unique Basic 
7s Globulin From Lupine Seeds
 pdb|4PPH|E Chain E, Crystal Structure Of Conglutin Gamma, A Unique Basic 
7s Globulin From Lupine Seeds
 pdb|4PPH|F Chain F, Crystal Structure Of Conglutin Gamma, A Unique Basic 
7s Globulin From Lupine Seeds
Length=417

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 98/192 (51%), Gaps = 21/192 (11%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQGSIPCG  351
            P  +V+PV +D  T  + A +     L  + L++D+ G  LW      ++SS+  +  C 
Sbjct  12   PNLLVLPVQEDASTGLHWANIHKRTPLMQVPLLLDLNGKHLWVTCSQHYSSSTYQAPFCH  71

Query  352  SLKCSMANPKGC------------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            S +CS AN   C              N  C L   NPV++ +G G L +D +A+      
Sbjct  72   STQCSRANTHQCFTCTDSTTTRPGCHNNTCGLLSSNPVTQESGLGELAQDVLAIHSTHGS  131

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
              G  +  VP FLFS  PSFL Q    N V G LGLG + ISL +QL + FG+ R+ +VC
Sbjct  132  KLGPMVK-VPQFLFSCAPSFLAQKGLPNNVQGALGLGQAPISLQNQLFSHFGLKRQFSVC  190

Query  673  L---SSSNGAII  699
            L   S+SNGAI+
Sbjct  191  LSRYSTSNGAIL  202



>ref|XP_010278299.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=426

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 97/186 (52%), Gaps = 19/186 (10%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  351
            P  + +P++KD  T QYV ++  G  L P  LV+D+ G FLW D    ++SSS  S+ C 
Sbjct  22   PATLFLPITKDGATHQYVTRIYQGTPLTPFPLVLDLAGQFLWVDCDSGYSSSSYRSVRCR  81

Query  352  SLKCSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV--ELIDEP  495
            S++C+ AN + C           +N  C L  EN V+    SG L  D IA+      EP
Sbjct  82   SIQCAAANAQRCGLCFSTPRPGCNNHTCGLSPENTVTGTVTSGELAVDVIALPSAYGSEP  141

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRKXAVCL  675
               +   H   FLFS  P+ L   L +GV G+ G G +RI LPSQLA  F   RK A+CL
Sbjct  142  GPIATAHH---FLFSCAPTPLLAHLASGVRGMAGFGRNRIGLPSQLAAAFNFDRKFAICL  198

Query  676  SSSNGA  693
             SS  +
Sbjct  199  PSSTAS  204



>gb|AAB53771.1| conglutin gamma [Lupinus angustifolius]
 emb|CAA46552.1| conglutin gamma [Lupinus angustifolius]
 gb|AEB33719.1| conglutin gamma 1 [Lupinus angustifolius]
Length=449

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 98/192 (51%), Gaps = 21/192 (11%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQGSIPCG  351
            P  +V+PV +D  T  + A +     L  + L++D+ G  LW      ++SS+  +  C 
Sbjct  44   PNLLVLPVQEDASTGLHWANIHKRTPLMQVPLLLDLNGKHLWVTCSQHYSSSTYQAPFCH  103

Query  352  SLKCSMANPKGC------------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  495
            S +CS AN   C              N  C L   NPV++ +G G L +D +A+      
Sbjct  104  STQCSRANTHQCFTCTDSTTTRPGCHNNTCGLLSSNPVTQESGLGELAQDVLAIHSTHGS  163

Query  496  NAGSFLSHVPNFLFSFVPSFLFQglg-ngvngvlglgnSRISLPSQLANTFGIPRKXAVC  672
              G  +  VP FLFS  PSFL Q    N V G LGLG + ISL +QL + FG+ R+ +VC
Sbjct  164  KLGPMVK-VPQFLFSCAPSFLAQKGLPNNVQGALGLGQAPISLQNQLFSHFGLKRQFSVC  222

Query  673  L---SSSNGAII  699
            L   S+SNGAI+
Sbjct  223  LSRYSTSNGAIL  234



>emb|CDX86682.1| BnaC08g00210D [Brassica napus]
Length=415

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 88/175 (50%), Gaps = 15/175 (9%)
 Frame = +1

Query  166  AQRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  333
            AQ  F P+A+V+PV+KD  T QY   +     L P  +V D+GG  LW D    + SS+ 
Sbjct  23   AQPSFRPKALVLPVTKDQTTLQYTTVINQRTPLVPASVVFDLGGRNLWVDCDRGYVSSTY  82

Query  334  GSIPCGSLKCSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVEL  483
             S  C S  CS A   GC+          +N  C    +N V++ A SG +  D ++++ 
Sbjct  83   RSTRCRSAVCSRAGSDGCSQCFSPPRPGCNNNTCSGTPDNTVTRTATSGEIATDVVSIQS  142

Query  484  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG  648
             +  N G  +  +P+ +F    +FL QGL +G  G+ G+G   I LPSQ    FG
Sbjct  143  TNGSNPGRIV-QIPDLVFVCGATFLLQGLASGTVGMAGMGRHNIGLPSQGVAFFG  196



>ref|XP_002517174.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45337.1| conserved hypothetical protein [Ricinus communis]
Length=445

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 100/186 (54%), Gaps = 23/186 (12%)
 Frame = +1

Query  184  PRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSI----PCG  351
            PRA+V+P++KD  T QY+ +L +G    P  LVVD+GG  LW D  +  Q S      CG
Sbjct  31   PRALVLPITKDSYTLQYLTRLNLGTPPVPRNLVVDLGGQHLWIDCDTGYQSSTYRPGYCG  90

Query  352  SLKCSMA---------NPKG-CTSNEICELQFENPVSKMAGSGVLKE---DTIAVELIDE  492
            S  CS+A         NP+G   +N  C++   N V    G G+  E   D I+++  D 
Sbjct  91   SASCSLAKAACVSICPNPRGPGCNNNTCKVLARNSV---FGGGIFPEVSLDVISLQSTDG  147

Query  493  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFG--IPRKXA  666
              AG  +S V +F+F    ++    L N  NG++GLG  R++ PSQL++ FG    RK A
Sbjct  148  SEAGPPVS-VSDFIFGCANTWDLIDLANAANGMIGLGKERVAFPSQLSSVFGGSFRRKFA  206

Query  667  VCLSSS  684
            +CL S+
Sbjct  207  ICLPSN  212



>ref|XP_011099700.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=433

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 94/188 (50%), Gaps = 21/188 (11%)
 Frame = +1

Query  169  QRPFFPRAIVIPVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADW--ASSSQ  333
            Q P  P+A + P+ KD  T+QY   +Q+G +     +V+D+GG FLW    D+  A+SS 
Sbjct  23   QSPPKPQAFIFPIKKDVTTNQYYTTIQIGSSATTFNVVIDLGGKFLWFNSLDYFNAASSY  82

Query  334  GSIPCGSLKCSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  480
              I CG+ +C +AN  GC            +N  C     NP +   G   L +D + V 
Sbjct  83   RPILCGTQQCRIANGVGCVFCFLSPPVPGCTNNTCSDYALNPFTGTQGYSGLGQDVLRVY  142

Query  481  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlglgnSRISLPSQLANTFGIPRK  660
                         V +F F F    L +GL +   G++GLG +RISL +QLA+ F I +K
Sbjct  143  STRGDQY-----RVNDFPFQFSDPVLREGLASPTAGLIGLGRTRISLQAQLASAFKIRQK  197

Query  661  XAVCLSSS  684
             A+CL SS
Sbjct  198  FALCLPSS  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335