BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF037O24

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010047334.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    219   1e-66   Eucalyptus grandis [rose gum]
gb|AFV46211.1|  hypothetical protein                                    217   2e-66   Scutellaria baicalensis [Baikal skullcap]
gb|AGH12216.1|  glycine decarboxylase P protein                         216   4e-66   Flaveria pringlei
emb|CDP08258.1|  unnamed protein product                                216   4e-66   Coffea canephora [robusta coffee]
ref|XP_010097067.1|  Glycine cleavage system P protein 1                221   5e-66   
gb|KCW81693.1|  hypothetical protein EUGRSUZ_C03047                     220   4e-65   Eucalyptus grandis [rose gum]
ref|XP_010049196.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    219   9e-65   Eucalyptus grandis [rose gum]
ref|XP_011081684.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    222   2e-64   Sesamum indicum [beniseed]
ref|XP_004291039.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    211   4e-64   Fragaria vesca subsp. vesca
sp|O49954.1|GCSP_SOLTU  RecName: Full=Glycine dehydrogenase (deca...    224   4e-64   Solanum tuberosum [potatoes]
gb|AGH12214.1|  glycine decarboxylase P protein                         207   1e-63   Flaveria pringlei
ref|XP_008444466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    222   2e-63   Cucumis melo [Oriental melon]
ref|XP_004142925.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    222   3e-63   Cucumis sativus [cucumbers]
ref|XP_004245101.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    221   5e-63   Solanum lycopersicum
ref|XP_009620998.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    221   6e-63   Nicotiana tomentosiformis
emb|CAN63089.1|  hypothetical protein VITISV_032016                     218   7e-63   Vitis vinifera
ref|XP_006382015.1|  hypothetical protein POPTR_0006s24570g             218   8e-63   
ref|XP_011097886.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    221   9e-63   Sesamum indicum [beniseed]
ref|XP_010648358.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    218   1e-62   Vitis vinifera
gb|ABO61734.1|  mitochondrial glycine decarboxylase complex P-pro...    220   1e-62   Populus tremuloides
ref|XP_009797115.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    220   1e-62   Nicotiana sylvestris
ref|XP_009361863.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    220   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_009361869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    220   1e-62   Pyrus x bretschneideri [bai li]
ref|NP_001289247.1|  glycine dehydrogenase (decarboxylating), mit...    220   1e-62   Pyrus x bretschneideri [bai li]
gb|KDP34101.1|  hypothetical protein JCGZ_07672                         220   2e-62   Jatropha curcas
ref|XP_006361002.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    220   2e-62   
ref|XP_006382016.1|  hypothetical protein POPTR_0006s24570g             218   3e-62   
ref|XP_011019466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    219   5e-62   Populus euphratica
ref|XP_002516446.1|  glycine dehydrogenase, putative                    218   7e-62   Ricinus communis
sp|P49361.1|GCSPA_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    215   1e-61   Flaveria pringlei
gb|EPS70254.1|  precursor of carboxylase p-protein 1, glycine dec...    209   1e-61   Genlisea aurea
gb|KJB54687.1|  hypothetical protein B456_009G045100                    217   2e-61   Gossypium raimondii
ref|XP_002308562.1|  P-protein subunit of glycine decarboxylase e...    217   2e-61   Populus trichocarpa [western balsam poplar]
gb|KJB54688.1|  hypothetical protein B456_009G045100                    217   3e-61   Gossypium raimondii
emb|CAA81076.1|  P protein                                              215   3e-61   Flaveria pringlei
ref|XP_003544533.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    216   7e-61   Glycine max [soybeans]
ref|XP_010519851.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    210   7e-61   Tarenaya hassleriana [spider flower]
ref|XP_008393646.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    215   1e-60   Malus domestica [apple tree]
sp|P49362.1|GCSPB_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    214   1e-60   Flaveria pringlei
gb|KHG06307.1|  Glycine dehydrogenase [decarboxylating], mitochon...    214   1e-60   Gossypium arboreum [tree cotton]
dbj|BAJ33627.1|  unnamed protein product                                213   1e-60   Eutrema halophilum
ref|XP_004498895.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    211   2e-60   
ref|XP_010526062.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    214   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_006283054.1|  hypothetical protein CARUB_v10004049mg             214   3e-60   Capsella rubella
gb|KFK29912.1|  hypothetical protein AALP_AA7G194500                    204   3e-60   Arabis alpina [alpine rockcress]
gb|KJB65558.1|  hypothetical protein B456_010G101200                    213   4e-60   Gossypium raimondii
gb|KJB65559.1|  hypothetical protein B456_010G101200                    213   4e-60   Gossypium raimondii
ref|XP_007012280.1|  Glycine decarboxylase P-protein 1                  213   5e-60   
gb|EYU20359.1|  hypothetical protein MIMGU_mgv1a000655mg                209   6e-60   Erythranthe guttata [common monkey flower]
dbj|BAJ34193.1|  unnamed protein product                                211   7e-60   Eutrema halophilum
gb|KJB65560.1|  hypothetical protein B456_010G101200                    212   1e-59   Gossypium raimondii
ref|XP_006412401.1|  hypothetical protein EUTSA_v10024257mg             209   1e-59   
ref|XP_007161011.1|  hypothetical protein PHAVU_001G035500g             212   1e-59   Phaseolus vulgaris [French bean]
sp|O49850.1|GCSP_FLAAN  RecName: Full=Glycine dehydrogenase (deca...    211   2e-59   Flaveria anomala
ref|XP_006408846.1|  hypothetical protein EUTSA_v10001891mg             211   2e-59   Eutrema salsugineum [saltwater cress]
gb|EYU29323.1|  hypothetical protein MIMGU_mgv1a000648mg                211   2e-59   Erythranthe guttata [common monkey flower]
sp|O49852.1|GCSP_FLATR  RecName: Full=Glycine dehydrogenase (deca...    211   2e-59   Flaveria trinervia
ref|XP_010925018.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    211   2e-59   Elaeis guineensis
ref|XP_008220472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    211   3e-59   Prunus mume [ume]
ref|XP_007227061.1|  hypothetical protein PRUPE_ppa000675mg             211   3e-59   
ref|XP_003550270.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    211   5e-59   Glycine max [soybeans]
gb|KFK32542.1|  hypothetical protein AALP_AA6G256500                    210   5e-59   Arabis alpina [alpine rockcress]
gb|AAB97081.1|  glycine decarboxylase P subunit                         194   6e-59   Coffea arabica [arabica coffee]
gb|AAB99844.1|  glycine decarboxylase multi-enzyme complex P subunit    193   7e-59   Coffea canephora [robusta coffee]
ref|XP_010262151.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    210   8e-59   Nelumbo nucifera [Indian lotus]
gb|KDO80092.1|  hypothetical protein CISIN_1g001531mg                   207   8e-59   Citrus sinensis [apfelsine]
gb|KDO80091.1|  hypothetical protein CISIN_1g001531mg                   207   9e-59   Citrus sinensis [apfelsine]
gb|KDO80090.1|  hypothetical protein CISIN_1g001531mg                   207   9e-59   Citrus sinensis [apfelsine]
gb|KDO80085.1|  hypothetical protein CISIN_1g001531mg                   207   1e-58   Citrus sinensis [apfelsine]
ref|XP_006475931.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    206   1e-58   Citrus sinensis [apfelsine]
ref|XP_006450834.1|  hypothetical protein CICLE_v10007310mg             206   1e-58   Citrus clementina [clementine]
gb|KDO80089.1|  hypothetical protein CISIN_1g001531mg                   206   2e-58   Citrus sinensis [apfelsine]
ref|XP_010432628.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    199   2e-58   Camelina sativa [gold-of-pleasure]
gb|KHG00684.1|  Glycine dehydrogenase [decarboxylating], mitochon...    208   3e-58   Gossypium arboreum [tree cotton]
sp|P26969.1|GCSP_PEA  RecName: Full=Glycine dehydrogenase (decarb...    208   3e-58   Pisum sativum [garden pea]
ref|XP_003589000.1|  Glycine dehydrogenase P protein                    208   3e-58   Medicago truncatula
ref|XP_010942763.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    207   5e-58   Elaeis guineensis
gb|AAN17423.1|  P-Protein - like protein                                207   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001119106.1|  glycine dehydrogenase [decarboxylating] 2          207   6e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AAB99845.1|  glycine decarboxylase multi-enzyme complex P subunit    190   1e-57   Coffea congensis
gb|AAK68740.1|  P-Protein - like protein                                206   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195027.1|  glycine dehydrogenase [decarboxylating] 2             206   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57651.1|  AT4g33010/F26P21_130                                    206   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867212.1|  hypothetical protein ARALYDRAFT_491390             206   2e-57   
ref|XP_010667776.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    206   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008808050.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    206   2e-57   Phoenix dactylifera
ref|XP_002880741.1|  hypothetical protein ARALYDRAFT_481465             206   3e-57   
gb|AAU94363.1|  glycine decarboxylase P-protein                         199   5e-57   Moricandia nitens
ref|XP_006858311.1|  hypothetical protein AMTR_s00064p00096040          204   8e-57   Amborella trichopoda
emb|CBI27919.3|  unnamed protein product                                204   1e-56   Vitis vinifera
ref|XP_002282271.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    203   2e-56   Vitis vinifera
ref|XP_010417387.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    203   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008797766.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    203   2e-56   Phoenix dactylifera
ref|NP_180178.1|  glycine decarboxylase P-protein 2                     203   3e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98954.1|  putative glycine dehydrogenase                         202   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472637.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    202   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006296473.1|  hypothetical protein CARUB_v10025658mg             202   5e-56   Capsella rubella
ref|XP_010429623.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    201   1e-55   Camelina sativa [gold-of-pleasure]
gb|KHN29723.1|  Glycine dehydrogenase [decarboxylating], mitochon...    200   3e-55   Glycine soja [wild soybean]
ref|XP_003523643.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    200   3e-55   Glycine max [soybeans]
ref|XP_010437818.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    200   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009392931.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    199   7e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN32209.1|  Glycine dehydrogenase [decarboxylating], mitochon...    196   6e-54   Glycine soja [wild soybean]
ref|XP_003526001.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    196   6e-54   Glycine max [soybeans]
ref|XP_009401914.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    196   9e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75316.1|  BnaA01g03860D                                          189   2e-51   
ref|XP_009125119.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    189   2e-51   Brassica rapa
emb|CDX68930.1|  BnaC01g05230D                                          187   7e-51   
ref|XP_004969722.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    185   4e-50   
ref|XP_003569669.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    183   2e-49   Brachypodium distachyon [annual false brome]
gb|AAB82711.1|  glycine decarboxylase P subunit                         182   6e-49   x Tritordeum sp.
emb|CDM83805.1|  unnamed protein product                                182   7e-49   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001044046.1|  Os01g0711400                                       181   2e-48   
gb|EAY75571.1|  hypothetical protein OsI_03474                          181   2e-48   Oryza sativa Indica Group [Indian rice]
gb|AAA63798.1|  victorin binding protein                                180   3e-48   Avena sativa [cultivated oat]
ref|NP_001058062.1|  Os06g0611900                                       178   9e-48   
ref|XP_007136824.1|  hypothetical protein PHAVU_009G077400g             179   1e-47   Phaseolus vulgaris [French bean]
gb|AAS16361.1|  glycine dehydrogenase P protein                         177   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_006371884.1|  hypothetical protein POPTR_0018s05150g             176   2e-47   
gb|EAZ37623.1|  hypothetical protein OsJ_21958                          177   3e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ13293.1|  hypothetical protein OsJ_03218                          177   3e-47   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD35509.1|  putative glycine dehydrogenase                         177   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001780310.1|  predicted protein                                  177   4e-47   
ref|XP_001754864.1|  predicted protein                                  176   8e-47   
ref|XP_005850088.1|  hypothetical protein CHLNCDRAFT_16305              168   8e-47   Chlorella variabilis
ref|XP_002441849.1|  hypothetical protein SORBIDRAFT_08g003440          176   9e-47   Sorghum bicolor [broomcorn]
ref|XP_008662474.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    175   2e-46   
gb|AFW56071.1|  glycine cleavage complex P-protein                      175   3e-46   
ref|XP_001692993.1|  glycine cleavage system, P protein                 159   7e-41   Chlamydomonas reinhardtii
gb|KDO80088.1|  hypothetical protein CISIN_1g001531mg                   159   1e-40   Citrus sinensis [apfelsine]
gb|KIY98368.1|  glycine dehydrogenase                                   148   7e-40   Monoraphidium neglectum
gb|AGH12215.1|  glycine decarboxylase P protein                         143   2e-39   Flaveria pringlei
ref|XP_001420206.1|  predicted protein                                  154   6e-39   Ostreococcus lucimarinus CCE9901
ref|XP_002503477.1|  glycine cleavage system p-protein                  152   2e-38   Micromonas commoda
ref|XP_002956892.1|  hypothetical protein VOLCADRAFT_107448             152   2e-38   Volvox carteri f. nagariensis
ref|XP_003081763.1|  GCSP_FLAAN Glycine dehydrogenase [decarboxyl...    150   5e-38   
emb|CEF99477.1|  Pyridoxal phosphate-dependent transferase, major...    151   6e-38   Ostreococcus tauri
ref|XP_003055654.1|  glycine cleavage system p-protein                  149   3e-37   Micromonas pusilla CCMP1545
ref|XP_011398598.1|  Glycine dehydrogenase [decarboxylating], mit...    145   9e-36   Auxenochlorella protothecoides
ref|XP_005649750.1|  glycine dehydrogenase                              144   9e-36   Coccomyxa subellipsoidea C-169
ref|XP_002979861.1|  hypothetical protein SELMODRAFT_153563             142   4e-35   
ref|XP_002988429.1|  hypothetical protein SELMODRAFT_159459             142   7e-35   
ref|XP_007510359.1|  glycine dehydrogenase                              140   3e-34   Bathycoccus prasinos
ref|XP_006644607.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    137   2e-33   Oryza brachyantha
gb|EMT12369.1|  Glycine dehydrogenase (decarboxylating), mitochon...    137   3e-33   
ref|XP_001755004.1|  predicted protein                                  136   6e-33   
ref|XP_006681352.1|  hypothetical protein BATDEDRAFT_20549              132   3e-31   Batrachochytrium dendrobatidis JAM81
gb|ESA20942.1|  hypothetical protein GLOINDRAFT_343379                  130   1e-30   
ref|WP_014435168.1|  glycine dehydrogenase                              129   2e-30   Caldilinea aerophila
ref|WP_009768707.1|  glycine dehydrogenase, decarboxylating             129   3e-30   Oscillatoriales cyanobacterium JSC-12
gb|KFH65627.1|  glycine dehydrogenase                                   127   1e-29   Mortierella verticillata NRRL 6337
ref|WP_039830229.1|  glycine dehydrogenase                              121   2e-29   
ref|XP_007339769.1|  glycine dehydrogenase                              126   3e-29   
ref|WP_009187084.1|  glycine dehydrogenase                              126   3e-29   Cecembia lonarensis
ref|WP_035493337.1|  glycine dehydrogenase                              125   3e-29   
ref|WP_014772152.1|  glycine dehydrogenase                              125   6e-29   Belliella baltica
ref|WP_013030982.1|  glycine dehydrogenase                              125   6e-29   Sideroxydans lithotrophicus
ref|WP_018149850.1|  glycine dehydrogenase                              124   7e-29   Leeia oryzae
ref|WP_008624248.1|  Glycine dehydrogenase                              124   1e-28   Mariniradius saccharolyticus
ref|WP_013294701.1|  glycine dehydrogenase                              124   1e-28   Gallionella capsiferriformans
ref|WP_035075932.1|  glycine dehydrogenase                              124   1e-28   Anditalea andensis
ref|WP_035628774.1|  hypothetical protein                               115   1e-28   
ref|WP_021830956.1|  Glycine dehydrogenase [decarboxylating] (gly...    124   2e-28   Crocosphaera watsonii
ref|XP_009056743.1|  hypothetical protein LOTGIDRAFT_216694             124   2e-28   Lottia gigantea
ref|WP_002707146.1|  glycine dehydrogenase                              123   2e-28   
ref|WP_012627655.1|  glycine dehydrogenase                              123   2e-28   Cyanothece sp. PCC 7425
ref|WP_044226980.1|  glycine dehydrogenase                              123   3e-28   Phaeodactylibacter xiamenensis
emb|CDH56548.1|  glycine dehydrogenase                                  123   3e-28   Lichtheimia corymbifera JMRC:FSU:9682
ref|WP_009032864.1|  glycine dehydrogenase                              123   3e-28   Indibacter alkaliphilus
ref|WP_007581597.1|  glycine dehydrogenase                              123   3e-28   Burkholderiaceae
ref|WP_015130859.1|  glycine dehydrogenase                              123   3e-28   Calothrix sp. PCC 7507
ref|WP_040728598.1|  glycine dehydrogenase                              122   4e-28   
ref|XP_007270989.1|  glycine dehydrogenase                              122   4e-28   Fomitiporia mediterranea MF3/22
ref|WP_002694452.1|  glycine dehydrogenase                              122   4e-28   Microscilla marina
ref|WP_021833183.1|  Glycine dehydrogenase [decarboxylating] (gly...    122   4e-28   
ref|WP_012402353.1|  glycine dehydrogenase                              122   5e-28   Paraburkholderia phymatum
ref|WP_024850811.1|  glycine dehydrogenase                              122   5e-28   Hydrogenovibrio kuenenii
ref|XP_004343370.1|  glycine dehydrogenase                              122   6e-28   Capsaspora owczarzaki ATCC 30864
ref|WP_007096761.1|  glycine dehydrogenase                              122   7e-28   Kordia algicida
ref|WP_012166094.1|  glycine dehydrogenase                              122   7e-28   Acaryochloris marina
ref|WP_035827440.1|  glycine dehydrogenase                              122   8e-28   Crocosphaera watsonii
emb|CCQ61793.1|  Glycine dehydrogenase [decarboxylating] (glycine...    122   8e-28   Crocosphaera watsonii WH 0401
ref|WP_028471416.1|  glycine dehydrogenase                              122   8e-28   Neptunomonas japonica
ref|WP_044206069.1|  glycine dehydrogenase                              122   8e-28   Coleofasciculus chthonoplastes
emb|CDS12383.1|  hypothetical protein LRAMOSA04578                      122   9e-28   Lichtheimia ramosa
ref|WP_018979919.1|  glycine dehydrogenase                              121   9e-28   
ref|WP_018476108.1|  glycine dehydrogenase                              121   1e-27   Pontibacter roseus
gb|EDX77003.1|  glycine dehydrogenase                                   121   1e-27   Coleofasciculus chthonoplastes PCC 7420
ref|WP_028364014.1|  glycine dehydrogenase                              121   1e-27   Burkholderia sp. UYPR1.413
gb|KGT34387.1|  glycine dehydrogenase                                   114   1e-27   Vibrio parahaemolyticus
ref|WP_044145105.1|  glycine dehydrogenase                              119   1e-27   
gb|EVU15264.1|  glycine cleavage system P-family protein                114   1e-27   Vibrio parahaemolyticus V-223/04
ref|WP_035987447.1|  glycine dehydrogenase                              121   1e-27   Paraburkholderia caribensis
ref|WP_024162626.1|  Glycine dehydrogenase (decarboxylating)            121   1e-27   Burkholderia sp. BT03
gb|ELS34041.1|  Glycine dehydrogenase (decarboxylating)                 121   1e-27   Pseudanabaena biceps PCC 7429
ref|WP_025918361.1|  glycine dehydrogenase                              121   1e-27   Herminiimonas sp. CN
ref|WP_042305123.1|  glycine dehydrogenase                              120   2e-27   Paraburkholderia terrae
ref|WP_042302959.1|  glycine dehydrogenase                              120   2e-27   Paraburkholderia kururiensis
ref|WP_017772230.1|  glycine dehydrogenase                              120   2e-27   Paraburkholderia kururiensis
ref|WP_040687253.1|  glycine dehydrogenase                              120   2e-27   
ref|WP_041919296.1|  glycine dehydrogenase                              120   2e-27   
ref|WP_035151567.1|  glycine dehydrogenase                              120   2e-27   Calothrix sp. 336/3
ref|WP_044171749.1|  glycine dehydrogenase                              120   2e-27   
gb|AFZ32122.1|  Glycine dehydrogenase (decarboxylating)                 120   2e-27   Gloeocapsa sp. PCC 7428
ref|WP_019586329.1|  glycine dehydrogenase                              120   2e-27   Deinococcus apachensis
ref|WP_009544701.1|  MULTISPECIES: glycine dehydrogenase                120   2e-27   Cyanothece
ref|WP_027857624.1|  glycine dehydrogenase                              120   2e-27   Marinobacterium jannaschii
ref|XP_010875485.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    120   2e-27   Esox lucius
ref|WP_017294248.1|  glycine dehydrogenase                              120   2e-27   Geminocystis herdmanii
ref|WP_012410110.1|  glycine dehydrogenase                              120   2e-27   Nostoc punctiforme
ref|WP_031817094.1|  glycine dehydrogenase                              114   3e-27   
ref|WP_008692424.1|  glycine dehydrogenase                              119   3e-27   
ref|WP_039413576.1|  glycine dehydrogenase                              120   3e-27   
ref|WP_044179699.1|  glycine dehydrogenase                              120   3e-27   Photobacterium damselae
ref|WP_044451621.1|  glycine dehydrogenase                              119   3e-27   Mastigocladus laminosus
ref|WP_028946840.1|  glycine dehydrogenase                              120   3e-27   Synechocystis sp. PCC 6714
gb|EJK45128.1|  hypothetical protein THAOC_36273                        120   3e-27   Thalassiosira oceanica
ref|WP_019556676.1|  glycine dehydrogenase                              120   3e-27   Thiomicrorhabdus arctica
ref|WP_005365623.1|  glycine dehydrogenase                              120   3e-27   Photobacterium angustum
gb|KJG15141.1|  glycine dehydrogenase                                   120   3e-27   Photobacterium angustum
ref|WP_010472943.1|  glycine dehydrogenase                              120   4e-27   Acaryochloris sp. CCMEE 5410
ref|WP_006643852.1|  glycine dehydrogenase                              119   4e-27   Photobacterium sp. SKA34
gb|KJF83041.1|  glycine dehydrogenase                                   119   4e-27   Photobacterium damselae subsp. damselae
gb|KJG39760.1|  glycine dehydrogenase                                   119   4e-27   Photobacterium angustum
ref|WP_013340914.1|  glycine dehydrogenase                              119   4e-27   Burkholderia sp. CCGE1003
ref|WP_026736448.1|  glycine dehydrogenase                              119   4e-27   Fischerella sp. PCC 9605
ref|WP_044106198.1|  glycine dehydrogenase                              119   4e-27   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_015145532.1|  glycine dehydrogenase, decarboxylating             119   4e-27   Pleurocapsa minor
ref|WP_007306344.1|  glycine dehydrogenase                              119   5e-27   Crocosphaera watsonii
ref|WP_008684764.1|  glycine dehydrogenase                              119   5e-27   Rhodopirellula sallentina
ref|WP_028220613.1|  glycine dehydrogenase                              119   5e-27   Paraburkholderia oxyphila
ref|WP_015784226.1|  glycine dehydrogenase                              119   5e-27   Cyanothece sp. PCC 8802
ref|WP_025598176.1|  glycine dehydrogenase                              119   5e-27   Burkholderia sp. WSM2230
ref|WP_039743276.1|  glycine dehydrogenase                              119   5e-27   
ref|WP_012434789.1|  glycine dehydrogenase                              119   5e-27   Paraburkholderia phytofirmans
ref|WP_019499546.1|  glycine dehydrogenase                              119   5e-27   Pseudanabaena sp. PCC 6802
dbj|GAL17115.1|  glycine dehydrogenase                                  115   6e-27   Vibrio maritimus
ref|WP_020402760.1|  glycine dehydrogenase                              119   6e-27   Gracilimonas tropica
ref|WP_018418838.1|  glycine dehydrogenase                              119   6e-27   Paraburkholderia tuberum
ref|WP_007107330.1|  glycine dehydrogenase                              119   6e-27   Paraglaciecola polaris
ref|WP_008917902.1|  glycine dehydrogenase                              119   6e-27   
ref|WP_037439120.1|  glycine dehydrogenase                              119   6e-27   Shewanella mangrovi
ref|WP_018432467.1|  glycine dehydrogenase                              119   6e-27   Burkholderia sp. JPY251
ref|WP_042327162.1|  glycine dehydrogenase                              119   6e-27   Paraburkholderia ginsengisoli
ref|WP_013090938.1|  glycine dehydrogenase                              119   6e-27   Burkholderia sp. CCGE1002
ref|WP_017309685.1|  glycine dehydrogenase                              119   6e-27   Fischerella sp. PCC 9339
gb|KDN53552.1|  putative GCV2-glycine decarboxylase P subunit           119   7e-27   Tilletiaria anomala UBC 951
gb|EEX32328.1|  glycine dehydrogenase [decarboxylating]                 119   7e-27   Vibrio coralliilyticus ATCC BAA-450
ref|WP_025404644.1|  glycine dehydrogenase                              119   7e-27   Burkholderia thailandensis
ref|WP_009906657.1|  glycine dehydrogenase                              119   7e-27   Burkholderia thailandensis
dbj|BAH37805.1|  glycine dehydrogenase                                  119   8e-27   Gemmatimonas aurantiaca T-27
ref|WP_030102409.1|  glycine dehydrogenase                              119   8e-27   Burkholderia sp. K24
ref|WP_028198452.1|  glycine dehydrogenase                              119   8e-27   Paraburkholderia fungorum
ref|WP_039366657.1|  glycine dehydrogenase                              119   8e-27   
ref|WP_028981454.1|  glycine dehydrogenase                              119   9e-27   Sporocytophaga myxococcoides
ref|XP_002182636.1|  glycine decarboxylase p- protein                   119   9e-27   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_027210635.1|  glycine dehydrogenase                              119   9e-27   Burkholderia sp. WSM2232
ref|WP_006050861.1|  glycine dehydrogenase                              119   9e-27   Paraburkholderia graminis
ref|WP_009094772.1|  glycine dehydrogenase                              119   9e-27   Rhodopirellula sp. SWK7
ref|WP_042007515.1|  glycine dehydrogenase                              118   9e-27   Capnocytophaga
ref|WP_042343522.1|  glycine dehydrogenase                              118   9e-27   Capnocytophaga canis
ref|WP_005304561.1|  glycine dehydrogenase                              118   9e-27   Photobacterium damselae
ref|WP_040121887.1|  glycine dehydrogenase                              118   1e-26   Vibrio coralliilyticus
ref|WP_042347795.1|  glycine dehydrogenase                              118   1e-26   Capnocytophaga canis
ref|WP_006980349.1|  glycine dehydrogenase                              118   1e-26   Chthoniobacter flavus
ref|WP_038159925.1|  glycine dehydrogenase                              118   1e-26   Vibrio sp. B183
ref|WP_019275951.1|  glycine dehydrogenase                              118   1e-26   Vibrio coralliilyticus
ref|WP_043009965.1|  glycine dehydrogenase                              118   1e-26   Vibrio coralliilyticus
ref|WP_035805169.1|  glycine dehydrogenase                              118   1e-26   Lunatimonas lonarensis
ref|WP_043893096.1|  hypothetical protein                               118   1e-26   
ref|WP_031780027.1|  glycine dehydrogenase                              115   1e-26   
ref|WP_028490147.1|  glycine dehydrogenase                              118   1e-26   Thiothrix lacustris
ref|WP_035480407.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_008273963.1|  glycine dehydrogenase                              118   1e-26   Cyanothece sp. CCY0110
ref|WP_039982227.1|  glycine dehydrogenase                              118   1e-26   Vibrio
ref|WP_015004072.1|  glycine dehydrogenase                              118   1e-26   Paraburkholderia phenoliruptrix
ref|WP_034341915.1|  glycine dehydrogenase                              118   1e-26   Deinococcus misasensis
ref|WP_015137299.1|  glycine dehydrogenase, decarboxylating             118   1e-26   Nostoc sp. PCC 7524
ref|WP_021710634.1|  glycine dehydrogenase                              118   1e-26   Vibrio azureus
ref|WP_010451973.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_013590033.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_026727000.1|  glycine dehydrogenase                              118   1e-26   
gb|EKM30522.1|  glycine dehydrogenase                                   118   1e-26   
gb|AIV08805.1|  glycine dehydrogenase                                   118   1e-26   
ref|WP_017189009.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_005451647.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_009696729.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_006986397.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_038898897.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_029789378.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_010415806.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_027199249.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_013615693.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_035554383.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_035816192.1|  glycine dehydrogenase                              114   1e-26   
ref|WP_029991321.1|  glycine dehydrogenase                              118   2e-26   
ref|WP_039401704.1|  glycine dehydrogenase                              118   2e-26   
gb|EEV87820.1|  glycine dehydrogenase                                   118   2e-26   
ref|WP_028731177.1|  MULTISPECIES: glycine dehydrogenase                118   2e-26   
ref|WP_027776930.1|  glycine dehydrogenase                              118   2e-26   
ref|WP_039204353.1|  glycine dehydrogenase                              115   2e-26   
ref|WP_036587010.1|  glycine dehydrogenase                              118   2e-26   
gb|AHN75965.1|  glycine dehydrogenase                                   118   2e-26   
ref|WP_031627481.1|  glycine dehydrogenase                              118   2e-26   
ref|WP_028361435.1|  glycine dehydrogenase                              118   2e-26   
ref|WP_020067441.1|  glycine dehydrogenase                              118   2e-26   
ref|WP_009910201.1|  glycine dehydrogenase                              118   2e-26   
ref|WP_007180013.1|  glycine dehydrogenase                              118   2e-26   
ref|WP_020566270.1|  glycine dehydrogenase                              118   2e-26   
dbj|GAL33354.1|  glycine dehydrogenase                                  115   2e-26   
ref|WP_017027692.1|  glycine dehydrogenase                              117   2e-26   
ref|WP_042113557.1|  glycine dehydrogenase                              117   2e-26   
ref|XP_008527904.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    115   2e-26   
ref|WP_029971225.1|  glycine dehydrogenase                              117   2e-26   
gb|AJF00842.1|  glycine dehydrogenase                                   117   2e-26   
emb|CDQ64607.1|  unnamed protein product                                117   2e-26   
dbj|GAL84002.1|  glycine dehydrogenase                                  117   2e-26   
ref|WP_040355616.1|  glycine dehydrogenase                              117   2e-26   
ref|WP_031780093.1|  glycine dehydrogenase                              115   2e-26   
gb|EDM13112.1|  glycine decarboxylase (predicted), isoform CRA_b        112   3e-26   
gb|EDL41700.1|  glycine decarboxylase, isoform CRA_c                    112   3e-26   
ref|WP_026463388.1|  glycine dehydrogenase                              117   3e-26   
dbj|GAM71457.1|  glycine dehydrogenase                                  113   3e-26   
ref|WP_035470920.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_011490275.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_039976795.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_042604164.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_015264586.1|  glycine dehydrogenase, decarboxylating             117   3e-26   
ref|WP_013322173.1|  glycine dehydrogenase                              117   3e-26   
emb|CEI88334.1|  Putative Glycine dehydrogenase                         115   3e-26   
ref|WP_009841190.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_042602813.1|  glycine dehydrogenase                              117   3e-26   
dbj|GAK21950.1|  glycine dehydrogenase                                  117   3e-26   
gb|EOQ89615.1|  glycine dehydrogenase                                   117   3e-26   
ref|WP_033906528.1|  glycine dehydrogenase                              117   3e-26   
dbj|GAJ69680.1|  LOW QUALITY PROTEIN: glycine dehydrogenase             117   3e-26   
ref|WP_005386044.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_017820968.1|  MULTISPECIES: glycine dehydrogenase                117   3e-26   
ref|WP_017634197.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_005376434.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_039986371.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_005442136.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_041770080.1|  glycine dehydrogenase                              117   3e-26   
gb|ABZ95547.1|  Glycine dehydrogenase (decarboxylating), protein P      117   3e-26   
ref|WP_041053123.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_020596172.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_033185730.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_020197067.1|  glycine dehydrogenase                              117   4e-26   
ref|XP_008334077.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    115   4e-26   
ref|WP_039928551.1|  glycine dehydrogenase                              117   4e-26   
ref|XP_004991539.1|  glycine decarboxylase multi-enzyme complex P...    117   4e-26   
ref|WP_010107157.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_038894866.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_017819574.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_029828132.1|  glycine dehydrogenase                              115   4e-26   
ref|WP_039839419.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_038883994.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_009704501.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_008989114.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_010117488.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_027330224.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_042520777.1|  glycine dehydrogenase                              117   4e-26   
dbj|GAK17746.1|  LOW QUALITY PROTEIN: glycine dehydrogenase             117   4e-26   
ref|WP_025608878.1|  glycine dehydrogenase                              117   4e-26   
ref|XP_007253924.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    117   4e-26   
ref|WP_025902714.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_006991822.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_008843029.1|  glycine dehydrogenase                              117   4e-26   
ref|WP_020081767.1|  glycine dehydrogenase                              116   4e-26   
ref|WP_038187339.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_039477082.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_038201543.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_039623928.1|  glycine dehydrogenase                              116   5e-26   
ref|XP_006268968.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    116   5e-26   
ref|WP_038134901.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_017243124.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_015157279.1|  glycine dehydrogenase subunit alpha/beta           116   5e-26   
ref|WP_038212609.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_027799229.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_038877986.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_038870877.1|  glycine dehydrogenase                              116   5e-26   
gb|KGR35979.1|  glycine dehydrogenase (decarboxylating)                 116   5e-26   
ref|WP_008198699.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_005469763.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_005530769.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_017513570.1|  MULTISPECIES: glycine dehydrogenase                116   5e-26   
ref|WP_035986474.1|  glycine dehydrogenase                              116   5e-26   
dbj|BAO87726.1|  glycine dehydrogenase [decarboxylating]                116   5e-26   
ref|WP_014192651.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_017031903.1|  glycine dehydrogenase                              116   5e-26   
gb|KJF96875.1|  glycine dehydrogenase                                   116   5e-26   
ref|WP_023934439.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_010649368.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_012129510.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_005431387.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_037223913.1|  glycine dehydrogenase                              115   6e-26   
ref|WP_011517911.1|  glycine dehydrogenase                              116   6e-26   
pdb|4LGL|A  Chain A, Crystal Structure Of Glycine Decarboxylase P...    116   6e-26   
ref|WP_044223259.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_021713910.1|  glycine dehydrogenase [decarboxylating]            116   6e-26   
ref|WP_027000783.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_010873139.1|  glycine dehydrogenase                              116   6e-26   
ref|XP_004653057.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    116   6e-26   
pdb|4LHC|A  Chain A, Crystal Structure Of Synechocystis Sp. Pcc 6...    116   6e-26   
ref|WP_036259154.1|  hypothetical protein                               116   6e-26   
ref|WP_035383253.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_042265964.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_010628682.1|  glycine dehydrogenase                              116   6e-26   
emb|CBJ30901.1|  Glycine dehydrogenase (decarboxylating)                116   6e-26   
ref|WP_022942732.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_027251065.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_039485771.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_035401444.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_029637128.1|  glycine dehydrogenase [                            116   7e-26   
ref|WP_026721410.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_010607325.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_021096897.1|  glycine dehydrogenase (decarboxylating)            116   7e-26   
ref|WP_022800452.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_010370544.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_022946238.1|  glycine dehydrogenase                              115   7e-26   
ref|WP_039491978.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_017217915.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_039452154.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_040507194.1|  glycine dehydrogenase                              116   8e-26   
emb|CDQ71180.1|  unnamed protein product                                115   8e-26   
ref|WP_027463523.1|  glycine dehydrogenase                              116   8e-26   
gb|EOQ96237.1|  glycine dehydrogenase                                   116   8e-26   
ref|WP_009336924.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_007622061.1|  glycine dehydrogenase                              115   8e-26   
ref|XP_006881367.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    115   9e-26   
ref|WP_009471306.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_038889275.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_023404562.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_025509358.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_002155592.1|  glycine dehydrogenase (decarboxylating)            113   9e-26   
dbj|GAL16098.1|  glycine dehydrogenase                                  111   9e-26   
ref|WP_017334831.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_008647393.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_025553125.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_024701286.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_027885662.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_034386891.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_044202817.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_027853111.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_036989241.1|  glycine dehydrogenase                              115   1e-25   
emb|CEP11218.1|  hypothetical protein                                   115   1e-25   
ref|WP_041265988.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_025639988.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_029849396.1|  glycine dehydrogenase                              115   1e-25   
gb|ERE79332.1|  glycine dehydrogenase                                   112   1e-25   
ref|WP_035563762.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_016792003.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_029861334.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_027948813.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_029807401.1|  glycine dehydrogenase                              115   1e-25   
gb|EKV00929.1|  glycine dehydrogenase, decarboxylating                  115   1e-25   
ref|XP_002499282.1|  ZYRO0E08206p                                       115   1e-25   
ref|WP_029840619.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_013665365.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_041430269.1|  glycine dehydrogenase                              115   1e-25   
gb|AFY75171.1|  glycine dehydrogenase, decarboxylating                  115   1e-25   
ref|WP_027846740.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_015225454.1|  glycine dehydrogenase (decarboxylating) beta...    115   1e-25   
ref|WP_023006846.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_010888444.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_020531529.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_025621442.1|  glycine dehydrogenase                              114   1e-25   
ref|WP_039713483.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_025733773.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_012596779.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_008079962.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_012374749.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_004411308.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_023265002.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_002988516.1|  glycine dehydrogenase                              115   1e-25   
gb|KEI72124.1|  glycine dehydrogenase                                   115   1e-25   
ref|WP_012486709.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_031815054.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_022574032.1|  glycine dehydrogenase, decarboxylating             115   1e-25   
ref|WP_010572852.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_008352522.1|  MULTISPECIES: glycine dehydrogenase                115   1e-25   
ref|WP_033403597.1|  glycine dehydrogenase                              115   1e-25   
gb|EYD77881.1|  Glycine dehydrogenase [decarboxylating] (glycine ...    114   1e-25   
ref|XP_005716298.1|  glycine dehydrogenase (decarboxylating), mit...    115   2e-25   
ref|WP_019596339.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_035884403.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_004784745.1|  glycine dehydrogenase                              115   2e-25   
emb|CEG63023.1|  Putative Glycine dehydrogenase                         115   2e-25   
ref|WP_016708739.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_020776421.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_002972410.1|  glycine dehydrogenase                              115   2e-25   
gb|EMO61678.1|  glycine dehydrogenase                                   115   2e-25   
ref|WP_036966657.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_036020282.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_038173226.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_038752967.1|  glycine dehydrogenase                              115   2e-25   
ref|XP_006018433.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    115   2e-25   
ref|WP_044095056.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_018301908.1|  glycine dehydrogenase                              115   2e-25   
emb|CDI54855.1|  probable GCV2-glycine decarboxylase P subunit          115   2e-25   



>ref|XP_010047334.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Eucalyptus grandis]
 gb|KCW79221.1| hypothetical protein EUGRSUZ_C00646 [Eucalyptus grandis]
Length=1053

 Score =   219 bits (559),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKP+DTF RRHNSATPE+Q+KMAE CGF SLDALIDATVP+SIR+DSMKF KFD 
Sbjct  82   ISVEALKPNDTFARRHNSATPEEQTKMAESCGFGSLDALIDATVPKSIRIDSMKFSKFDG  141

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMKNLASKNKVFK++IGMGYYNTFVPPVILRNIMENP WYTQYTPYQ
Sbjct  142  GLTESQMIEHMKNLASKNKVFKTFIGMGYYNTFVPPVILRNIMENPAWYTQYTPYQ  197


 Score = 60.8 bits (146),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE----TPAAALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LANRAIL+R+V E K  R  E    + ++AL+ P+RYVSSL+ C++M+++ R
Sbjct  1    MERARRLANRAILKRIVSETKHHRRLESGLDSSSSALYTPSRYVSSLSACSSMHKSSR  58



>gb|AFV46211.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=266

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALKPSD+FPRRHNSA PE+QSKMAEF GF SLD+LIDATVP+SIR+D M+ P F  
Sbjct  67   ISVDALKPSDSFPRRHNSAAPENQSKMAEFVGFDSLDSLIDATVPKSIRIDKMELPVFSE  126

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTEAQM+EHM++LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ
Sbjct  127  GLTEAQMLEHMQDLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  182



>gb|AGH12216.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=250

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            S+    SVEALKPSDTFP RHNSATPE+Q+KMAEF G+P+LD+LIDATVP+SIRL+SMK+
Sbjct  60   SQARTISVEALKPSDTFPHRHNSATPEEQTKMAEFVGYPNLDSLIDATVPKSIRLESMKY  119

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
            PKFD GLTE+QMI HM+ LASKNK+FKS+IGMGYYNT+VP VILRNIMENPGWYTQYTPY
Sbjct  120  PKFDEGLTESQMIAHMQELASKNKIFKSFIGMGYYNTYVPTVILRNIMENPGWYTQYTPY  179

Query  637  Q  639
            Q
Sbjct  180  Q  180


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 46/88 (52%), Gaps = 14/88 (16%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYEN---QRRYS  245
            MERAR+LAN+AILRRLV + K     +    AL+ P+RYVSSL+P      N    R  +
Sbjct  1    MERARRLANKAILRRLVSKTK----TQPITPALYSPSRYVSSLSPYICSGTNVRFDRNVN  56

Query  246  GAGAGFPASHQQRRSIFRGGFEAERHFP  329
            G G+       Q R+I     +    FP
Sbjct  57   GFGS-------QARTISVEALKPSDTFP  77



>emb|CDP08258.1| unnamed protein product [Coffea canephora]
Length=1031

 Score =   216 bits (550),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  474
            SVEALKPSDTFPRRHNSATPE+Q KM E CGFPSLD+LIDATVP+SIRLD M F KFD G
Sbjct  82   SVEALKPSDTFPRRHNSATPEEQIKMVENCGFPSLDSLIDATVPKSIRLDGMTFSKFDEG  141

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            LTEAQMI+HM+ LASKNKVFKSYIGMGYYNTFVPPVILRN++ENP WYTQYTPYQ
Sbjct  142  LTEAQMIDHMQKLASKNKVFKSYIGMGYYNTFVPPVILRNLLENPAWYTQYTPYQ  196


 Score = 62.8 bits (151),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 6/62 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLR----ANETPAA--ALHRPARYVSSLAPCAAMYENQR  236
            M+RARKLANRAIL+RLV EAKQ R    ANE  +A    +RP+RYVSSL+PC+   + QR
Sbjct  1    MDRARKLANRAILKRLVSEAKQRRGNGEANELLSAPSPFYRPSRYVSSLSPCSFRGQYQR  60

Query  237  RY  242
             Y
Sbjct  61   TY  62



>ref|XP_010097067.1| Glycine cleavage system P protein 1 [Morus notabilis]
 gb|EXB66868.1| Glycine cleavage system P protein 1 [Morus notabilis]
Length=1059

 Score =   221 bits (564),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 120/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  220  CTKTSGGTPAPE-----LGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFC  384
            C++T  G P  E     +G+R   S+    SVEALKPSDTF RRHNSATPE+QSKMAE  
Sbjct  54   CSRTRKGIPRSETASYNVGYRGIGSQTRSISVEALKPSDTFARRHNSATPEEQSKMAELV  113

Query  385  GFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYN  564
            GF SLDALID+TVP+SIRL+SMKF KFD GLTE+QMIEHMK+LASKNKVFKS+IGMGYYN
Sbjct  114  GFESLDALIDSTVPKSIRLESMKFSKFDEGLTESQMIEHMKDLASKNKVFKSFIGMGYYN  173

Query  565  TFVPPVILRNIMENPGWYTQYTPYQ  639
            T VPPVILRN++ENP WYTQYTPYQ
Sbjct  174  THVPPVILRNVLENPAWYTQYTPYQ  198


 Score = 57.4 bits (137),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 8/55 (15%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEA-KQLRANETPAA-------ALHRPARYVSSLAPCA  215
            MERAR++ANRA L+RLV EA KQ R NE+PAA         + P+RYVSSL+PC+
Sbjct  1    MERARRVANRAFLKRLVSEAKKQYRQNESPAALQNASSPMSYTPSRYVSSLSPCS  55



>gb|KCW81693.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=838

 Score =   220 bits (560),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            S+    SVEALKP+DTFPRRHNSATPE+Q+KMAE+CGF +LD+LIDATVP+SIRLDSMKF
Sbjct  78   SQARSISVEALKPNDTFPRRHNSATPEEQTKMAEYCGFDNLDSLIDATVPKSIRLDSMKF  137

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMI HMKNL SKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  138  SKFDEGLTESQMIAHMKNLESKNKVFKSYIGMGYYNTSVPPVILRNIMENPAWYTQYTPY  197

Query  637  Q  639
            Q
Sbjct  198  Q  198


 Score = 55.8 bits (133),  Expect(2) = 4e-65, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE----TPAAALHRPARYVSSLAP  209
            MERAR+LANRAIL+RLV E+KQ R +E    + +  +  P+RYVSSL P
Sbjct  1    MERARRLANRAILKRLVSESKQYRQDESLLSSSSPVIFTPSRYVSSLVP  49



>ref|XP_010049196.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW81692.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=1053

 Score =   219 bits (558),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            S+    SVEALKP+DTFPRRHNSATPE+Q+KMAE+CGF +LD+LIDATVP+SIRLDSMKF
Sbjct  78   SQARSISVEALKPNDTFPRRHNSATPEEQTKMAEYCGFDNLDSLIDATVPKSIRLDSMKF  137

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMI HMKNL SKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  138  SKFDEGLTESQMIAHMKNLESKNKVFKSYIGMGYYNTSVPPVILRNIMENPAWYTQYTPY  197

Query  637  Q  639
            Q
Sbjct  198  Q  198


 Score = 55.5 bits (132),  Expect(2) = 9e-65, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE----TPAAALHRPARYVSSLAP  209
            MERAR+LANRAIL+RLV E+KQ R +E    + +  +  P+RYVSSL P
Sbjct  1    MERARRLANRAILKRLVSESKQYRQDESLLSSSSPVIFTPSRYVSSLVP  49



>ref|XP_011081684.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1037

 Score =   222 bits (565),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+QSKMAEF GF SLD+LIDATVP+SIR++ M+FP FD 
Sbjct  66   ISVEALKPSDTFPRRHNSATPEEQSKMAEFVGFNSLDSLIDATVPKSIRIEKMEFPIFDE  125

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTEAQM+EHMK+LASKNK+FKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ
Sbjct  126  GLTEAQMLEHMKDLASKNKIFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  181


 Score = 51.2 bits (121),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 8/45 (18%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  209
            MERARKLANRAILRRLV E+KQ          L++ +RY+SSL+P
Sbjct  1    MERARKLANRAILRRLVSESKQ--------QPLYQSSRYISSLSP  37



>ref|XP_004291039.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Fragaria vesca subsp. vesca]
Length=1048

 Score =   211 bits (537),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             +VEALK SDTF RRHNSATPE+Q+KMA  CGF SLD+LIDATVP+SIRL+SMKF KFD 
Sbjct  79   IAVEALKSSDTFARRHNSATPEEQTKMAGLCGFDSLDSLIDATVPKSIRLESMKFSKFDE  138

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QM+EHMK LASKNK+FKSYIGMGYYNT+VPPVILRNIMENP WYTQYTPYQ
Sbjct  139  GLTESQMLEHMKVLASKNKLFKSYIGMGYYNTYVPPVILRNIMENPAWYTQYTPYQ  194


 Score = 61.2 bits (147),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 46/80 (58%), Gaps = 8/80 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAAL-------HRPARYVSSLAPCAAMYENQ  233
            MERAR+LANRA ++RLV EAKQ R NET +A L         P+RYVSSL+         
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNETSSALLGSSSPVMFTPSRYVSSLSSFIRTNPRS  60

Query  234  RRYSGAGAGFPASHQQRRSI  293
                G+ AG   S QQ RSI
Sbjct  61   DSLLGSKAGIAGS-QQTRSI  79



>sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Solanum 
tuberosum]
 emb|CAB16918.1| P-Protein precursor [Solanum tuberosum]
Length=1035

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQSIR +SMK PKFD 
Sbjct  65   ISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQSIRSESMKLPKFDS  124

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM+NLASKNKVFKSYIGMGYYNT+VPPVILRN++ENP WYTQYTPYQ
Sbjct  125  GLTESQMIEHMQNLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPAWYTQYTPYQ  180


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERARKLANRAIL+RLV ++KQ R+NE P+++L+RP+RYVSSL+P    Y  Q R +   
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSSSLYRPSRYVSSLSP----YTFQARNNAKS  56

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
                 + QQ RSI     +    FP
Sbjct  57   ----FNTQQARSISVEALKPSDTFP  77



>gb|AGH12214.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=190

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             S+EALKPSDTF RRHNSAT E+Q+KMAEF GF SLD+LIDATVP+SIR+  MK P+FD 
Sbjct  65   ISIEALKPSDTFARRHNSATAEEQTKMAEFVGFSSLDSLIDATVPKSIRIGKMKLPQFDQ  124

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM+ LA+KN+VFKS+IGMGYYNTFVP VILRNIMENPGWYTQYTPYQ
Sbjct  125  GLTESQMIDHMQTLAAKNRVFKSFIGMGYYNTFVPSVILRNIMENPGWYTQYTPYQ  180



>ref|XP_008444466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Cucumis melo]
Length=1047

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = +1

Query  265  RRAISRGG-PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  441
            R  I  G    SVEALKPSDTFPRRHNSATPE+QSKMAE CGF SLD+L+DATVP+SIRL
Sbjct  66   RNGIGIGARSISVEALKPSDTFPRRHNSATPEEQSKMAEVCGFDSLDSLVDATVPKSIRL  125

Query  442  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  621
             SMKF KFD GLTE+QMIEHM+NLA+KNK+FKSYIGMGYYNTFVPPVILRNIMENP WYT
Sbjct  126  QSMKFSKFDEGLTESQMIEHMQNLAAKNKIFKSYIGMGYYNTFVPPVILRNIMENPAWYT  185

Query  622  QYTPYQ  639
            QYTPYQ
Sbjct  186  QYTPYQ  191



>ref|XP_004142925.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Cucumis sativus]
 gb|KGN62389.1| hypothetical protein Csa_2G351700 [Cucumis sativus]
Length=1046

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = +1

Query  265  RRAISRGG-PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  441
            R  I  G    SVEALKPSDTFPRRHNSATPE+QSKMAE CGF SLD+L+DATVP+SIRL
Sbjct  65   RNGIGIGSRSISVEALKPSDTFPRRHNSATPEEQSKMAEVCGFDSLDSLVDATVPKSIRL  124

Query  442  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  621
             SMKF KFD GLTE+QMIEHM+NLA+KNK+FKSYIGMGYYNTFVPPVILRNIMENP WYT
Sbjct  125  QSMKFSKFDEGLTESQMIEHMQNLAAKNKIFKSYIGMGYYNTFVPPVILRNIMENPAWYT  184

Query  622  QYTPYQ  639
            QYTPYQ
Sbjct  185  QYTPYQ  190



>ref|XP_004245101.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Solanum lycopersicum]
Length=1036

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQSIR +SMK PKFD 
Sbjct  66   ISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQSIRSESMKLPKFDG  125

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM+ LASKNKVFKSYIGMGYYNT+VPPVILRN++ENP WYTQYTPYQ
Sbjct  126  GLTESQMIEHMQKLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPAWYTQYTPYQ  181


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPA-AALHRPARYVSSLAPCAAMYENQRRYSGA  251
            MERARKLANRAIL+RLV ++KQ R+NE P+ ++L+RP+RYVSSL+P    Y  Q R S  
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSPSSLYRPSRYVSSLSP----YTFQARNSVK  56

Query  252  GAGFPASHQQRRSIFRGGFEAERHFP  329
                  + QQ RSI     +    FP
Sbjct  57   S----FNTQQVRSISVEALKPSDTFP  78



>ref|XP_009620998.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana tomentosiformis]
Length=1043

 Score =   221 bits (563),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATP++Q++MAEFCGF SLD+LIDATVPQSIR++SMKF KFD 
Sbjct  72   ISVEALKPSDTFPRRHNSATPQEQTQMAEFCGFSSLDSLIDATVPQSIRIESMKFSKFDE  131

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTEAQMIEHM  LAS NKVFKSYIGMGYYNTFVPPVILRNIMENP WYTQYTPYQ
Sbjct  132  GLTEAQMIEHMSKLASMNKVFKSYIGMGYYNTFVPPVILRNIMENPAWYTQYTPYQ  187


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP-AAALHRPARYVSSLAPCAAMYENQRRYSGA  251
            M+RARKLANRAIL+RLV E+KQ RAN+ P +AAL+RP+RYVSSL+P      N +     
Sbjct  1    MDRARKLANRAILKRLVSESKQSRANDIPSSAALYRPSRYVSSLSPYIFQARNGKNMLHG  60

Query  252  GAGFPASHQQRRSIFRGGFEAERHFP  329
               F  + Q  RSI     +    FP
Sbjct  61   NGNF--NKQHVRSISVEALKPSDTFP  84



>emb|CAN63089.1| hypothetical protein VITISV_032016 [Vitis vinifera]
Length=1036

 Score =   218 bits (556),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAE CG+ SLD+L+DATVP+SIRL+S+KF KFD 
Sbjct  83   ISVEALKPSDTFPRRHNSATPEEQTKMAESCGYESLDSLVDATVPKSIRLESLKFSKFDE  142

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM  LA+KNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ
Sbjct  143  GLTESQMIEHMMQLAAKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  198


 Score = 49.3 bits (116),  Expect(2) = 7e-63, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSLAPCA  215
            MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL  CA
Sbjct  1    MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSLPTCA  52



>ref|XP_006382015.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
 gb|ERP59812.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
Length=677

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVE+LKPSDTFPRRHNSATPE+Q+KMAE CGF +LD+LIDATVP+SIRLDSMKF KFD 
Sbjct  89   ISVESLKPSDTFPRRHNSATPEEQTKMAELCGFDTLDSLIDATVPKSIRLDSMKFSKFDG  148

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM  LASKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  149  GLTESQMIEHMNYLASKNKVFKSYIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  204



>ref|XP_011097886.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1071

 Score =   221 bits (563),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEF G+ SLDALIDATVP+SIR+D M+FP FD 
Sbjct  68   ISVEALKPSDTFPRRHNSATPEEQAKMAEFVGYNSLDALIDATVPKSIRIDKMEFPIFDE  127

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTEAQMI+HM++LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ
Sbjct  128  GLTEAQMIQHMQDLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  183



>ref|XP_010648358.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1053

 Score =   218 bits (555),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAE CG+ SLD+L+DATVP+SIRL+S+KF KFD 
Sbjct  83   ISVEALKPSDTFPRRHNSATPEEQTKMAESCGYESLDSLVDATVPKSIRLESLKFSKFDE  142

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM  LA+KNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ
Sbjct  143  GLTESQMIEHMMQLAAKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  198


 Score = 49.7 bits (117),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSLAPCA  215
            MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL  CA
Sbjct  1    MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSLPTCA  52



>gb|ABO61734.1| mitochondrial glycine decarboxylase complex P-protein [Populus 
tremuloides]
Length=1060

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVE+LKPSDTFPRRHNSATPE+Q+KMAE CGF +LD+LIDATVP+SIRLDSMKF KFD 
Sbjct  89   ISVESLKPSDTFPRRHNSATPEEQTKMAELCGFDTLDSLIDATVPKSIRLDSMKFSKFDG  148

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK LASKNKVFKSYIGMGYYNT+VPPVILRNIMENP WYTQYTPYQ
Sbjct  149  GLTESQMIEHMKYLASKNKVFKSYIGMGYYNTYVPPVILRNIMENPAWYTQYTPYQ  204



>ref|XP_009797115.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana sylvestris]
Length=1046

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  262  FRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  441
            F R        SVEALKPSDTFPRRHNSATP++Q++MAEFCGF SLD+LIDATVPQSIR+
Sbjct  65   FNRQQQHVRSISVEALKPSDTFPRRHNSATPQEQTQMAEFCGFSSLDSLIDATVPQSIRI  124

Query  442  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  621
            +SMKF KFD GLTEAQMI+HM  LAS NKVFKSYIGMGYYNTFVPPVILRNIMENP WYT
Sbjct  125  ESMKFSKFDEGLTEAQMIDHMSKLASMNKVFKSYIGMGYYNTFVPPVILRNIMENPAWYT  184

Query  622  QYTPYQ  639
            QYTPYQ
Sbjct  185  QYTPYQ  190


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP-AAALHRPARYVSSLAPCAAMYEN-QRRYSG  248
            MERARKLANRAIL+RLV ++KQ RANE P +AAL+RP+RYVSSL+P      N      G
Sbjct  1    MERARKLANRAILKRLVSDSKQSRANEIPSSAALYRPSRYVSSLSPYTFQARNGNNMLHG  60

Query  249  AGAGFPASHQQRRSIFRGGFEAERHFP  329
                F    Q  RSI     +    FP
Sbjct  61   KVGNFNRQQQHVRSISVEALKPSDTFP  87



>ref|XP_009361863.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361876.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=1049

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 117/144 (81%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  CTKTSGGTPAPELGFRRAISRGG----PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCG  387
            C+ T     +  L  R A    G      SV+ALK SDTFPRRHNSATPE+Q+KMAE CG
Sbjct  52   CSLTRSSPRSDSLLSRNASHNAGFQTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCG  111

Query  388  FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  567
            F  LD+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT
Sbjct  112  FDGLDSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNT  171

Query  568  FVPPVILRNIMENPGWYTQYTPYQ  639
            +VPPVILRNIMENP WYTQYTPYQ
Sbjct  172  YVPPVILRNIMENPAWYTQYTPYQ  195


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 53/97 (55%), Gaps = 17/97 (18%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP------AAALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LANRA ++RLV EAKQ R NE+       +  L+ P+RYVSSL+PC+    + R
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  237  ------RYSGAGAGFPASHQQRRSIFRGGFEAERHFP  329
                  R +   AGF     Q RSI     +    FP
Sbjct  61   SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFP  92



>ref|XP_009361869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=1049

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 117/144 (81%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  CTKTSGGTPAPELGFRRAISRGG----PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCG  387
            C+ T     +  L  R A    G      SV+ALK SDTFPRRHNSATPE+Q+KMAE CG
Sbjct  52   CSLTRSSPRSDSLLSRNASHNAGFQTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCG  111

Query  388  FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  567
            F  LD+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT
Sbjct  112  FDGLDSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNT  171

Query  568  FVPPVILRNIMENPGWYTQYTPYQ  639
            +VPPVILRNIMENP WYTQYTPYQ
Sbjct  172  YVPPVILRNIMENPAWYTQYTPYQ  195


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 53/97 (55%), Gaps = 17/97 (18%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP------AAALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LANRA ++RLV EAKQ R NE+       +  L+ P+RYVSSL+PC+    + R
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  237  ------RYSGAGAGFPASHQQRRSIFRGGFEAERHFP  329
                  R +   AGF     Q RSI     +    FP
Sbjct  61   SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFP  92



>ref|NP_001289247.1| glycine dehydrogenase (decarboxylating), mitochondrial [Pyrus 
x bretschneideri]
 gb|AHM26626.1| glycine dehydrogenase decarboxylating protein [Pyrus x bretschneideri]
Length=1049

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 117/144 (81%), Gaps = 4/144 (3%)
 Frame = +1

Query  220  CTKTSGGTPAPELGFRRAISRGG----PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCG  387
            C+ T     +  L  R A    G      SV+ALK SDTFPRRHNSATPE+Q+KMAE CG
Sbjct  52   CSLTRSSPRSDSLLSRNASHNAGFQTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCG  111

Query  388  FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  567
            F  LD+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT
Sbjct  112  FDGLDSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNT  171

Query  568  FVPPVILRNIMENPGWYTQYTPYQ  639
            +VPPVILRNIMENP WYTQYTPYQ
Sbjct  172  YVPPVILRNIMENPAWYTQYTPYQ  195


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 53/97 (55%), Gaps = 17/97 (18%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE------TPAAALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LANRA ++RLV EAKQ R NE      + +  L+ P+RYVSSL+PC+    + R
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  237  ------RYSGAGAGFPASHQQRRSIFRGGFEAERHFP  329
                  R +   AGF     Q RSI     +    FP
Sbjct  61   SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFP  92



>gb|KDP34101.1| hypothetical protein JCGZ_07672 [Jatropha curcas]
Length=1059

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  247  APELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  426
            A   G+    S+    SVE+LKPSDTFPRRHNSATPE+Q+KMAE CGF +LD+LIDATVP
Sbjct  73   ASAAGYYGVGSQVRSISVESLKPSDTFPRRHNSATPEEQTKMAEVCGFDNLDSLIDATVP  132

Query  427  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  606
            +SI++DSMKFPKFD GLTE+QM+EHMK LASKNKVFKSYIGMGYYNT VPPVILRNIMEN
Sbjct  133  KSIKIDSMKFPKFDEGLTESQMVEHMKKLASKNKVFKSYIGMGYYNTHVPPVILRNIMEN  192

Query  607  PGWYTQYTPYQ  639
            P WYTQYTPYQ
Sbjct  193  PAWYTQYTPYQ  203


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 15/100 (15%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLR---ANETPA------AALHRPARYVSSLA------P  209
            MERAR+LANRAIL+RLV+E++Q      NE+ A        L+ P+RYVSSL+      P
Sbjct  1    MERARRLANRAILKRLVNESRQCSHQGRNESSALLNSSSPVLYSPSRYVSSLSSFASRNP  60

Query  210  CAAMYENQRRYSGAGAGFPASHQQRRSIFRGGFEAERHFP  329
             +  ++  +  + + AG+     Q RSI     +    FP
Sbjct  61   RSGFFQGGKNVAASAAGYYGVGSQVRSISVESLKPSDTFP  100



>ref|XP_006361002.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Solanum tuberosum]
Length=1092

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQSIR +SMK PKFD 
Sbjct  65   ISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQSIRSESMKLPKFDG  124

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM+ LASKNKVFKSYIGMGYYNT+VPPVILRN++ENP WYTQYTPYQ
Sbjct  125  GLTESQMIDHMQKLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPAWYTQYTPYQ  180


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 54/85 (64%), Gaps = 8/85 (9%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERARKLANRAIL+RLV ++KQ R+NE P+++L+ P+RYVSSL+P    Y  Q R +   
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSSSLYWPSRYVSSLSP----YTFQARNNAKS  56

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
                 + QQ RSI     +    FP
Sbjct  57   ----FNTQQARSISVEALKPSDTFP  77



>ref|XP_006382016.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
 gb|ERP59813.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
Length=806

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = +1

Query  229  TSGGTPAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  408
             S   PA   G    I      SVE+LKPSDTFPRRHNSATPE+Q+KMAE CGF +LD+L
Sbjct  71   VSHNVPAGSYGIGSQIR---SISVESLKPSDTFPRRHNSATPEEQTKMAELCGFDTLDSL  127

Query  409  IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  588
            IDATVP+SIRLDSMKF KFD GLTE+QMIEHM  LASKNKVFKSYIGMGYYNT VPPVIL
Sbjct  128  IDATVPKSIRLDSMKFSKFDGGLTESQMIEHMNYLASKNKVFKSYIGMGYYNTHVPPVIL  187

Query  589  RNIMENPGWYTQYTPYQ  639
            RNIMENP WYTQYTPYQ
Sbjct  188  RNIMENPAWYTQYTPYQ  204



>ref|XP_011019466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Populus euphratica]
Length=1060

 Score =   219 bits (557),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVE+LKPSDTFPRRHNSATPE+Q+KMAE CGF +LD+LIDATVP+SIRLDSMKF KFD 
Sbjct  89   ISVESLKPSDTFPRRHNSATPEEQTKMAELCGFDTLDSLIDATVPKSIRLDSMKFSKFDG  148

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK LASKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  149  GLTESQMIEHMKYLASKNKVFKSYIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  204



>ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus communis]
 gb|EEF45787.1| glycine dehydrogenase, putative [Ricinus communis]
Length=1057

 Score =   218 bits (556),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +1

Query  232  SGGTPAPE-LGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  408
            SG  P  + +G+    S+    SVE+LKPSDTFPRRHNSAT E+QSKMAE CGF +LD+L
Sbjct  65   SGSLPGTKSIGYYGIGSQVRSISVESLKPSDTFPRRHNSATAEEQSKMAELCGFDNLDSL  124

Query  409  IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  588
            IDATVP+SIR+DSMKF KFD+GLTE+QMIEHM++LASKNKVFKSYIGMGYYNT VPPVIL
Sbjct  125  IDATVPKSIRIDSMKFSKFDNGLTESQMIEHMQDLASKNKVFKSYIGMGYYNTHVPPVIL  184

Query  589  RNIMENPGWYTQYTPYQ  639
            RNIMENP WYTQYTPYQ
Sbjct  185  RNIMENPAWYTQYTPYQ  201


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 51/100 (51%), Gaps = 17/100 (17%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLR------------ANETPAAALHRPARYVSSLAPCAA  218
            MERARKLANRAIL+RLV+E+K  +             N + +  L+ P+RYVSSL+  A+
Sbjct  1    MERARKLANRAILKRLVNESKPHKHHSRNESSATTLLNSSSSPILYTPSRYVSSLSSFAS  60

Query  219  MYENQRRYSGAGA---GFPASHQQRRSIFRGGFEAERHFP  329
               N R  S  G    G+     Q RSI     +    FP
Sbjct  61   --RNPRSGSLPGTKSIGYYGIGSQVRSISVESLKPSDTFP  98



>sp|P49361.1|GCSPA_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) A, mitochondrial; 
AltName: Full=Glycine cleavage system P protein A; 
AltName: Full=Glycine decarboxylase A; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) A; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA85353.1| P-protein of the glycine cleavage system [Flaveria pringlei]
Length=1037

 Score =   215 bits (548),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP+SIRLDSMK+ KFD 
Sbjct  67   ISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVPKSIRLDSMKYSKFDE  126

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMENPGWYTQYTPYQ
Sbjct  127  GLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWYTQYTPYQ  182


 Score = 48.9 bits (115),  Expect(2) = 1e-61, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LAN+AIL RLV + K   +  +P  AL  P+RYVSSL+P      N R
Sbjct  1    MERARRLANKAILGRLVSQTKHNPSISSP--ALCSPSRYVSSLSPYVCSGTNVR  52



>gb|EPS70254.1| precursor of carboxylase p-protein 1, glycine decarboxylase complex, 
partial [Genlisea aurea]
Length=408

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSA+P +QSKM E  GF +LD+LIDATVP+SIR+D MK P FD 
Sbjct  61   ISVEALKPSDTFPRRHNSASPVEQSKMVEALGFETLDSLIDATVPRSIRIDEMKLPIFDR  120

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QM EHMK LASKNKVFKS+IGMGYYNTFVPPVILRNIMENP WYTQYTPYQ
Sbjct  121  GLTESQMAEHMKELASKNKVFKSFIGMGYYNTFVPPVILRNIMENPAWYTQYTPYQ  176



>gb|KJB54687.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1050

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDALIDATVP++IR+DSMKFPKFD 
Sbjct  79   ISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDALIDATVPKAIRIDSMKFPKFDG  138

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  139  GLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  194


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 40/94 (43%), Positives = 53/94 (56%), Gaps = 12/94 (13%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAPCAAMYENQRRYSG  248
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEMSSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  249  AGA-------GFPASHQQRRSIFRGGFEAERHFP  329
             GA       GF     Q RSI     ++   FP
Sbjct  59   LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFP  91



>ref|XP_002308562.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
 gb|EEE92085.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
Length=1060

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVE+LKPSDTFPRRHNSATPE+Q+KMAE CGF +LD+LIDATVP+SIRLDSMKF KFD 
Sbjct  89   ISVESLKPSDTFPRRHNSATPEEQTKMAELCGFDTLDSLIDATVPKSIRLDSMKFSKFDG  148

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM  LASKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  149  GLTESQMIEHMNYLASKNKVFKSYIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  204



>gb|KJB54688.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1053

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDALIDATVP++IR+DSMKFPKFD 
Sbjct  79   ISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDALIDATVPKAIRIDSMKFPKFDG  138

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  139  GLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  194


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 40/94 (43%), Positives = 53/94 (56%), Gaps = 12/94 (13%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAPCAAMYENQRRYSG  248
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEMSSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  249  AGA-------GFPASHQQRRSIFRGGFEAERHFP  329
             GA       GF     Q RSI     ++   FP
Sbjct  59   LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFP  91



>emb|CAA81076.1| P protein [Flaveria pringlei]
Length=1037

 Score =   215 bits (547),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP+SIRLDSMK+ KFD 
Sbjct  67   ISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVPKSIRLDSMKYSKFDE  126

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMENPGWYTQYTPYQ
Sbjct  127  GLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWYTQYTPYQ  182


 Score = 47.4 bits (111),  Expect(2) = 3e-61, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQR  236
            M+RAR+LAN+AIL RLV + K   +  +P  AL  P+RYVSSL+P      N R
Sbjct  1    MDRARRLANKAILGRLVSQTKHNPSISSP--ALCSPSRYVSSLSPYVCSGTNVR  52



>ref|XP_003544533.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1059

 Score =   216 bits (549),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEAL+PSDTFPRRHNSATPE+QSKMAE CGF SLD+L+DATVP+SIRL  MKF KFD 
Sbjct  88   ISVEALRPSDTFPRRHNSATPEEQSKMAESCGFGSLDSLVDATVPKSIRLKDMKFGKFDA  147

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE QMIEHMK+LASKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  148  GLTENQMIEHMKDLASKNKVFKSYIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  203



>ref|XP_010519851.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=1054

 Score =   210 bits (535),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKP+DTFPRRHNSATPE+Q+ MA  CGF SLD+LIDATVP++IR+DSMKF KFD 
Sbjct  83   ISVEALKPTDTFPRRHNSATPEEQTVMANSCGFDSLDSLIDATVPKAIRIDSMKFSKFDE  142

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HMK+LASKNKVFKSYIGMGYYNT +PPVILRNI ENP WYTQYTPYQ
Sbjct  143  GLTESQMIDHMKDLASKNKVFKSYIGMGYYNTHIPPVILRNITENPAWYTQYTPYQ  198


 Score = 50.8 bits (120),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 7/61 (11%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLR-------ANETPAAALHRPARYVSSLAPCAAMYENQ  233
            MERAR+LANRAIL+RLV  +K+ R       +    + AL+ PARYVSSL+P A+   N 
Sbjct  1    MERARRLANRAILKRLVDSSKRHRTAREASLSGGASSPALYSPARYVSSLSPFASSASNI  60

Query  234  R  236
            R
Sbjct  61   R  61



>ref|XP_008393646.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Malus domestica]
Length=1049

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALK SDTFPRRHNSATPE+Q+KMAE CGF +LD+LIDATVP+SIRL+SMKF KFD 
Sbjct  80   ISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDALDSLIDATVPKSIRLESMKFQKFDE  139

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK LASKNK+FKS+IGMGYYNT+VPPVILRNIMENP WYTQYTPYQ
Sbjct  140  GLTESQMIEHMKKLASKNKIFKSFIGMGYYNTYVPPVILRNIMENPAWYTQYTPYQ  195


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 52/97 (54%), Gaps = 17/97 (18%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP------AAALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LANRA ++RLV EAKQ R NE+       +  L+ P+RYVSSL+PC+      R
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSCPR  60

Query  237  ------RYSGAGAGFPASHQQRRSIFRGGFEAERHFP  329
                  R +   AGF     Q RSI     +    FP
Sbjct  61   SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFP  92



>sp|P49362.1|GCSPB_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) B, mitochondrial; 
AltName: Full=Glycine cleavage system P protein B; 
AltName: Full=Glycine decarboxylase B; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) B; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA91000.1| P-protein precursor of glycine cleavage system [Flaveria pringlei]
Length=1034

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP+SIRLDSMK+ KFD 
Sbjct  64   ISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVPKSIRLDSMKYSKFDE  123

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMENPGWYTQYTPYQ
Sbjct  124  GLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWYTQYTPYQ  179



>gb|KHG06307.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1028

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDALIDATVP++IR+DSMKF KFD 
Sbjct  79   ISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDALIDATVPKAIRIDSMKFSKFDG  138

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  139  GLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  194


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 40/94 (43%), Positives = 53/94 (56%), Gaps = 12/94 (13%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAPCAAMYENQRRYSG  248
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEISSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  249  AGA-------GFPASHQQRRSIFRGGFEAERHFP  329
             GA       GF     Q RSI     ++   FP
Sbjct  59   LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFP  91



>dbj|BAJ33627.1| unnamed protein product [Thellungiella halophila]
Length=822

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = +1

Query  259  GF-RRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  435
            GF R  + +    SV+ALKPSDTFPRRHNSATPE+Q++MA +CGF SL+ LID+TVP+SI
Sbjct  57   GFGRHQLQQTRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDSLNTLIDSTVPKSI  116

Query  436  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  615
            RLDSMKF KFD GLTE+QMIEHM +LA+KNKVFKS+IGMGYYNT VPPVILRNIMENP W
Sbjct  117  RLDSMKFSKFDGGLTESQMIEHMSDLATKNKVFKSFIGMGYYNTHVPPVILRNIMENPAW  176

Query  616  YTQYTPYQ  639
            YTQYTPYQ
Sbjct  177  YTQYTPYQ  184



>ref|XP_004498895.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004498896.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=1114

 Score =   211 bits (538),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            S+    SVEALKPSDTFPRRHNSATPE+Q+KMAE CGF +LD+L+DATVP+SIRL  MKF
Sbjct  138  SQSRSISVEALKPSDTFPRRHNSATPEEQTKMAESCGFNTLDSLVDATVPKSIRLKEMKF  197

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE QMIEHMK LASKNK+FKS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  198  NKFDGGLTEGQMIEHMKYLASKNKIFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  257

Query  637  Q  639
            Q
Sbjct  258  Q  258


 Score = 48.1 bits (113),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRP---ARYVSSLA  206
            MERAR+LANRA L+RL+ EAKQ R NET       P   +RYVSS++
Sbjct  57   MERARRLANRATLKRLLSEAKQNRNNETIWNTSTTPIPSSRYVSSVS  103



>ref|XP_010526062.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Tarenaya hassleriana]
Length=1051

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q++MA  CGF +LDALIDATVP+SIRLDSM F KFD 
Sbjct  80   ISVEALKPSDTFPRRHNSATPEEQTQMATSCGFDNLDALIDATVPKSIRLDSMSFSKFDG  139

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM +LASKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  140  GLTESQMIEHMNDLASKNKVFKSYIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  195



>ref|XP_006283054.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
 gb|EOA15952.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
Length=1038

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFD  468
            P SVEAL+P DTFPRRHNSATP++QS MA+FCGF  +D+L+DATVP+SIRLDSMKF KFD
Sbjct  68   PISVEALQPGDTFPRRHNSATPDEQSHMAKFCGFDHIDSLVDATVPKSIRLDSMKFSKFD  127

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE+QMIEHM +LASKNK+FKS+IGMGYYNT+VPPVILRNIMENP WYTQYTPYQ
Sbjct  128  GGLTESQMIEHMVDLASKNKIFKSFIGMGYYNTYVPPVILRNIMENPAWYTQYTPYQ  184


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 50/86 (58%), Gaps = 6/86 (7%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYENQRRYSGA  251
            MERAR+LA R I++RLV+EAK+ R  ETP   + H PARYVSSL+P  + +      S A
Sbjct  1    MERARRLAYRGIVKRLVNEAKRHRNPETPHLVVPHAPARYVSSLSPFVSTHR-----SPA  55

Query  252  GAGFPASHQQRRSIFRGGFEAERHFP  329
              G   SHQQ R I     +    FP
Sbjct  56   SFGRHHSHQQTRPISVEALQPGDTFP  81



>gb|KFK29912.1| hypothetical protein AALP_AA7G194500 [Arabis alpina]
Length=1042

 Score =   204 bits (519),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALKPSDTFPRRHNSATPE+Q+ MA+ CGF  LD+LIDATVP+SIRLDSMKF KFD 
Sbjct  73   ISVDALKPSDTFPRRHNSATPEEQTHMAKHCGFDHLDSLIDATVPKSIRLDSMKFSKFDG  132

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI HM +LASKNKVFKS+IGMGYYNT VP VILRNI+ENP WYTQYTPYQ
Sbjct  133  GLTESQMISHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNILENPAWYTQYTPYQ  188


 Score = 55.1 bits (131),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANET-PAAALHRPARYVSSLAP  209
            MERAR+LA R I+RRLV++ K+ R N+T P+   H P RYVSSL+P
Sbjct  1    MERARRLAYRGIVRRLVNDTKRHRNNQTSPSIVPHTPTRYVSSLSP  46



>gb|KJB65558.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=945

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATVP++IR+DSMKF KFD 
Sbjct  76   ISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATVPKAIRIDSMKFSKFDE  135

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  136  GLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  191


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMYENQRRYSG  248
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  249  AGAGFPAS--HQQRRSIFRGGFEAERHFP  329
             G   P S   QQ RSI     ++   FP
Sbjct  61   -GRNVPNSFGSQQVRSISVEALKSSDTFP  88



>gb|KJB65559.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=973

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATVP++IR+DSMKF KFD 
Sbjct  76   ISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATVPKAIRIDSMKFSKFDE  135

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  136  GLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  191


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMYENQRRYSG  248
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  249  AGAGFPAS--HQQRRSIFRGGFEAERHFP  329
             G   P S   QQ RSI     ++   FP
Sbjct  61   -GRNVPNSFGSQQVRSISVEALKSSDTFP  88



>ref|XP_007012280.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
 gb|EOY29899.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
Length=1050

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALK SDTFPRRHNSATPE+Q KMA+ CGF +LD+LIDATVP++IR+DSMKF KFD 
Sbjct  79   ISVEALKSSDTFPRRHNSATPEEQIKMAQSCGFDNLDSLIDATVPKAIRIDSMKFSKFDG  138

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM+NLASKNK+FKS+IGMGYYNT+VPPVILRNIMENP WYTQYTPYQ
Sbjct  139  GLTESQMIEHMQNLASKNKIFKSFIGMGYYNTYVPPVILRNIMENPAWYTQYTPYQ  194


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 8/92 (9%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAPCAAMYENQRRYSG  248
            MERAR++ANRAIL+RLV+ AKQ R  E  + +  L+ P+RYVSSL+P  +   ++    G
Sbjct  1    MERARRVANRAILKRLVNAAKQSRNGEISSRSPVLYTPSRYVSSLSPFGSKSYSRSDLLG  60

Query  249  A-----GAGFPASHQQRRSIFRGGFEAERHFP  329
            A      AGF     Q RSI     ++   FP
Sbjct  61   ARNVSNNAGFGVG-SQIRSISVEALKSSDTFP  91



>gb|EYU20359.1| hypothetical protein MIMGU_mgv1a000655mg [Erythranthe guttata]
Length=1030

 Score =   209 bits (532),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALKPSDTF RRHNSATPEDQS+MA F GF +LD+LIDATVP+SIR D M+ P FD 
Sbjct  59   ISVDALKPSDTFARRHNSATPEDQSRMAGFAGFETLDSLIDATVPKSIRADKMELPIFDK  118

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QM+EHMK+LASKNKVFKSYIGMGYY TFVPPVILRNIMENPGWYTQYTPYQ
Sbjct  119  GLTESQMLEHMKHLASKNKVFKSYIGMGYYGTFVPPVILRNIMENPGWYTQYTPYQ  174


 Score = 48.9 bits (115),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 8/45 (18%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP  209
            MERARKL NRAILRRLV  +KQ          L+R +RYVSSL P
Sbjct  1    MERARKLVNRAILRRLVSASKQ--------QPLYRSSRYVSSLPP  37



>dbj|BAJ34193.1| unnamed protein product [Thellungiella halophila]
Length=756

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFD  468
            P SVEALKP DTFPRRHNSATP++Q+ MA++CGF  +D+LIDATVP+SIRLDSMKF KFD
Sbjct  73   PISVEALKPGDTFPRRHNSATPDEQTHMAKYCGFDHIDSLIDATVPKSIRLDSMKFSKFD  132

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  133  GGLTESQMIEHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAWYTQYTPYQ  189


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 7/89 (8%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPA-RYVSSLAPCAAMYENQRRY  242
            MERAR++A R I+RRLV++AK+ R  ET   P+A  H PA RY+SSL+P       +   
Sbjct  1    MERARRIAYRGIVRRLVNDAKRHRNVETPHVPSAVPHAPATRYLSSLSP---FLSTRGSI  57

Query  243  SGAGAGFPASHQQRRSIFRGGFEAERHFP  329
            + +  G  A  QQ R I     +    FP
Sbjct  58   NPSTFGNLARQQQTRPISVEALKPGDTFP  86



>gb|KJB65560.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=1047

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATVP++IR+DSMKF KFD 
Sbjct  76   ISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATVPKAIRIDSMKFSKFDE  135

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  136  GLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  191


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMYENQRRYSG  248
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  249  AGAGFPAS--HQQRRSIFRGGFEAERHFP  329
             G   P S   QQ RSI     ++   FP
Sbjct  61   -GRNVPNSFGSQQVRSISVEALKSSDTFP  88



>ref|XP_006412401.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
 gb|ESQ53854.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
Length=1146

 Score =   209 bits (532),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFD  468
            P SVEALKP DTFPRRHNSATP++Q+ MA++CGF  +D+LIDATVP+SIRLDSMKF KFD
Sbjct  176  PISVEALKPGDTFPRRHNSATPDEQTHMAKYCGFDHIDSLIDATVPKSIRLDSMKFSKFD  235

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  236  GGLTESQMIEHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAWYTQYTPYQ  292


 Score = 48.1 bits (113),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 5/56 (9%)
 Frame = +3

Query  57   FLEF-PAMERARKLANRAILRRLVHEAKQLRANET---PAAALHRPA-RYVSSLAP  209
            FL F  +MERAR++A R I+RRLV++AK+ R  ET   P+A  H PA RY+SSL+P
Sbjct  97   FLPFYISMERARRIAYRGIVRRLVNDAKRHRNVETPHVPSAVPHAPATRYLSSLSP  152



>ref|XP_007161011.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
 gb|ESW33005.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
Length=1062

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEAL+ SDTFPRRHNSATPE+QSKMAE CGF S+D+L+DATVP+SIRL  MKF KFD 
Sbjct  91   ISVEALQASDTFPRRHNSATPEEQSKMAESCGFESIDSLVDATVPKSIRLKEMKFGKFDG  150

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK LASKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  151  GLTESQMIEHMKELASKNKVFKSYIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  206



>sp|O49850.1|GCSP_FLAAN RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
anomala]
 emb|CAB16911.1| P-protein [Flaveria anomala]
Length=1034

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEF GF +LD+LIDATVP+SIRLDSMK+ KFD 
Sbjct  64   ISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFSNLDSLIDATVPKSIRLDSMKYSKFDE  123

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMENPGWYTQYTPYQ
Sbjct  124  GLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWYTQYTPYQ  179



>ref|XP_006408846.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
 gb|ESQ50299.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
Length=1041

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = +1

Query  259  GF-RRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  435
            GF R  + +    SV+ALKPSDTFPRRHNSATPE+Q++MA +CGF SL+ LID+TVP+SI
Sbjct  57   GFGRHQLQQTRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDSLNTLIDSTVPKSI  116

Query  436  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  615
            RLDSMKF KFD GLTE+QMIEHM +LA+KNKVFKS+IGMGYYNT VPPVILRNIMENP W
Sbjct  117  RLDSMKFSKFDGGLTESQMIEHMSDLATKNKVFKSFIGMGYYNTHVPPVILRNIMENPAW  176

Query  616  YTQYTPYQ  639
            YTQYTPYQ
Sbjct  177  YTQYTPYQ  184



>gb|EYU29323.1| hypothetical protein MIMGU_mgv1a000648mg [Erythranthe guttata]
Length=1032

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV ALKPSDTFPRRHNSATPEDQSKMAEF GF +LD LIDATVP+SIR+D M  P F  
Sbjct  61   ISVAALKPSDTFPRRHNSATPEDQSKMAEFVGFKTLDELIDATVPKSIRIDKMDLPIFGE  120

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTEAQM+ HM +LASKNKVFKSYIGMGYYNT+VPPVILRNIMENPGWYTQYTPYQ
Sbjct  121  GLTEAQMLSHMSDLASKNKVFKSYIGMGYYNTYVPPVILRNIMENPGWYTQYTPYQ  176


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 45/85 (53%), Gaps = 12/85 (14%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERARKLANRAILRRL  E+KQ          L++ +RYVSSL+P A   + +   S   
Sbjct  1    MERARKLANRAILRRLFSESKQ--------QPLYKSSRYVSSLSPSAVQQQGRTTNSKTL  52

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
            + F  +    RSI     +    FP
Sbjct  53   SQFLGA----RSISVAALKPSDTFP  73



>sp|O49852.1|GCSP_FLATR RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
trinervia]
 emb|CAB16916.1| P-Protein precursor [Flaveria trinervia]
Length=1034

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATPE+Q+KMAEF GF +LD+LIDATVP++IRLDSMK+ KFD 
Sbjct  64   ISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFSNLDSLIDATVPKAIRLDSMKYSKFDE  123

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMENPGWYTQYTPYQ
Sbjct  124  GLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWYTQYTPYQ  179



>ref|XP_010925018.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Elaeis guineensis]
Length=1040

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  262  FRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  441
            FR A  +    SVE+L+PSDTFPRRHNSA+P+DQ  MAE CGFPSLDALIDATVP SIR+
Sbjct  59   FRNAGRQSRSISVESLRPSDTFPRRHNSASPDDQVHMAELCGFPSLDALIDATVPNSIRI  118

Query  442  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  621
             +M  PKFD GLTE+QM+ HMK LAS NKVFKS+IGMGYYNTFVP VILRNIMENPGWYT
Sbjct  119  PTMALPKFDAGLTESQMLAHMKRLASMNKVFKSFIGMGYYNTFVPAVILRNIMENPGWYT  178

Query  622  QYTPYQ  639
            QYTPYQ
Sbjct  179  QYTPYQ  184



>ref|XP_008220472.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Prunus mume]
Length=1054

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = +1

Query  232  SGGTPAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALI  411
            +G   +  +G+R   ++    SV+ALK SDTFPRRHNSATP++Q+KMAE CGF SLD+LI
Sbjct  64   AGKNVSHNVGYRTG-TQTRSISVDALKNSDTFPRRHNSATPDEQTKMAELCGFGSLDSLI  122

Query  412  DATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILR  591
            DATVP+SIRL+SMKF KFD GLTE+QM+EHM+ LASKNK+FKS+IGMGYYNT+VPPVILR
Sbjct  123  DATVPKSIRLESMKFTKFDEGLTESQMLEHMQYLASKNKIFKSFIGMGYYNTYVPPVILR  182

Query  592  NIMENPGWYTQYTPYQ  639
            NIMENP WYTQYTPYQ
Sbjct  183  NIMENPAWYTQYTPYQ  198


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 54/97 (56%), Gaps = 14/97 (14%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANET-----PAAALHRPARYVSSLAPCAAMYENQRR  239
            MERAR+LANRA ++RLV +AKQ R NET      +  L+ P+RYVSSL+PC+ M  + R 
Sbjct  1    MERARRLANRAFVKRLVSDAKQFRQNETVFSSSTSPVLYTPSRYVSSLSPCSFMRTSSRS  60

Query  240  YSGAGAGFPASHQ-------QRRSIFRGGFEAERHFP  329
             S AG     SH        Q RSI     +    FP
Sbjct  61   DSLAGKN--VSHNVGYRTGTQTRSISVDALKNSDTFP  95



>ref|XP_007227061.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
 gb|EMJ28260.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
Length=1039

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALK SDTFPRRHNSATP++Q+KMAE CGF SLD+LIDATVP+SIRL+SMKF KFD 
Sbjct  68   ISVDALKNSDTFPRRHNSATPDEQTKMAELCGFGSLDSLIDATVPKSIRLESMKFAKFDE  127

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QM+EHM+ LASKNK+FKS+IGMGYYNT+VPPVILRNIMENP WYTQYTPYQ
Sbjct  128  GLTESQMLEHMQYLASKNKIFKSFIGMGYYNTYVPPVILRNIMENPAWYTQYTPYQ  183


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 42/85 (49%), Gaps = 5/85 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERAR+LAN+A ++RLV EAKQ R NET  ++   P  Y  S    +   +N     G G
Sbjct  1    MERARRLANQAFVKRLVSEAKQFRQNETVLSSSTSPVLYTPSSRSDSLAGKNVSHNVGYG  60

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
             G      Q RSI     +    FP
Sbjct  61   TG-----TQTRSISVDALKNSDTFP  80



>ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
 gb|KHN37032.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1056

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEAL+PSDTFPRRHNSATPE+QSKMAE  GF SLD+L+DATVP+SIRL  M F KFD 
Sbjct  85   ISVEALQPSDTFPRRHNSATPEEQSKMAESIGFESLDSLVDATVPKSIRLKEMTFGKFDA  144

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK+LASKNKVFKSYIGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  145  GLTESQMIEHMKDLASKNKVFKSYIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  200



>gb|KFK32542.1| hypothetical protein AALP_AA6G256500 [Arabis alpina]
Length=1041

 Score =   210 bits (535),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  241  TPAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  420
            +P     F R   +    SV+ALKPSDTFPRRHNSATPE+Q++MA +CGF  LD LID+T
Sbjct  54   SPGAGSSFGRQQQQSRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDKLDTLIDST  113

Query  421  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  600
            VP+SIRLDSMKF KFD GLTE++M+ HM +LASKNKVFKSYIGMGYYNT VPPVILRNIM
Sbjct  114  VPKSIRLDSMKFSKFDGGLTESEMMNHMSDLASKNKVFKSYIGMGYYNTHVPPVILRNIM  173

Query  601  ENPGWYTQYTPYQ  639
            ENP WYTQYTPYQ
Sbjct  174  ENPAWYTQYTPYQ  186


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE-TPAAALHRPARYVSSLAPCAAMYENQRRYS-G  248
            MERAR+LA+R I+RRL++E K+ R  E + +++ H P R+VSS+    + + ++R +S G
Sbjct  1    MERARRLASRGIIRRLINETKRHRNGESSSSSSSHIPTRHVSSV----STFLHRRDFSPG  56

Query  249  AGAGFPASHQQRRSIFRGGFEAERHFP  329
            AG+ F    QQ RSI     +    FP
Sbjct  57   AGSSFGRQQQQSRSISVDALKPSDTFP  83



>gb|AAB97081.1| glycine decarboxylase P subunit [Coffea arabica]
 gb|AAB99846.1| glycine decarboxylase multi-enzyme complex P subunit [Coffea 
eugenioides]
Length=142

 Score =   194 bits (492),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  331  RRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKN  510
            RRHNSATPE+Q KM E CGFPSLD+LIDATVP+SIRLD M F KFD GLTEAQMI+HM+ 
Sbjct  1    RRHNSATPEEQIKMVENCGFPSLDSLIDATVPKSIRLDGMTFSKFDEGLTEAQMIDHMQK  60

Query  511  LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            LASKNKVFKSYIGMGYYNTFVPPVILRN++ENP WYTQYTPYQ
Sbjct  61   LASKNKVFKSYIGMGYYNTFVPPVILRNLLENPAWYTQYTPYQ  103



>gb|AAB99844.1| glycine decarboxylase multi-enzyme complex P subunit [Coffea 
canephora]
Length=142

 Score =   193 bits (491),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  331  RRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKN  510
            RRHNSATPE+Q KM E CGFPSLD+LIDATVP+SIRLD M F KFD GLTEAQMI+HM+ 
Sbjct  1    RRHNSATPEEQIKMVENCGFPSLDSLIDATVPKSIRLDGMTFSKFDEGLTEAQMIDHMEK  60

Query  511  LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            LASKNKVFKSYIGMGYYNTFVPPVILRN++ENP WYTQYTPYQ
Sbjct  61   LASKNKVFKSYIGMGYYNTFVPPVILRNLLENPAWYTQYTPYQ  103



>ref|XP_010262151.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nelumbo nucifera]
Length=1043

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTFPRRHNSATP++QS+MAE CG+ +LD+LIDATVP+SIR+  MK PKFD 
Sbjct  72   ISVEALKPSDTFPRRHNSATPDEQSRMAESCGYSTLDSLIDATVPKSIRIQPMKLPKFDE  131

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK LASKNK+ KS+IGMGYYNT+VP VILRNIMENPGWYTQYTPYQ
Sbjct  132  GLTESQMIEHMKKLASKNKILKSFIGMGYYNTYVPSVILRNIMENPGWYTQYTPYQ  187


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 50/91 (55%), Gaps = 13/91 (14%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANET-----PAAALHRPARYVSSLAPCAAMYENQRR  239
            MERAR+LANRAILRRLVHE++Q + + T     PA+ +  PARY SSL+P        R 
Sbjct  1    MERARRLANRAILRRLVHESRQQQRHATSSYSSPASFI--PARYFSSLSPSVFPSTASRS  58

Query  240  YS-GAGAGFPASHQQRRSIFRGGFEAERHFP  329
               G G G+     Q RSI     +    FP
Sbjct  59   ADIGFGLGY-----QTRSISVEALKPSDTFP  84



>gb|KDO80092.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=985

 Score =   207 bits (527),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            +RG   SVEALKPSDTF RRHNSATPEDQ+KM+E  G  +LD+LIDATVP+SIR+DSMKF
Sbjct  84   TRG--ISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKF  141

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  142  SKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  201

Query  637  Q  639
            Q
Sbjct  202  Q  202


 Score = 47.4 bits (111),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  237  R  239
            R
Sbjct  61   R  61



>gb|KDO80091.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=985

 Score =   207 bits (527),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            +RG   SVEALKPSDTF RRHNSATPEDQ+KM+E  G  +LD+LIDATVP+SIR+DSMKF
Sbjct  84   TRG--ISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKF  141

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  142  SKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  201

Query  637  Q  639
            Q
Sbjct  202  Q  202


 Score = 47.4 bits (111),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  237  R  239
            R
Sbjct  61   R  61



>gb|KDO80090.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1049

 Score =   207 bits (526),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            +RG   SVEALKPSDTF RRHNSATPEDQ+KM+E  G  +LD+LIDATVP+SIR+DSMKF
Sbjct  84   TRG--ISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKF  141

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  142  SKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  201

Query  637  Q  639
            Q
Sbjct  202  Q  202


 Score = 47.4 bits (111),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  237  R  239
            R
Sbjct  61   R  61



>gb|KDO80085.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1016

 Score =   207 bits (526),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            +RG   SVEALKPSDTF RRHNSATPEDQ+KM+E  G  +LD+LIDATVP+SIR+DSMKF
Sbjct  84   TRG--ISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKF  141

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  142  SKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  201

Query  637  Q  639
            Q
Sbjct  202  Q  202


 Score = 47.0 bits (110),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  237  R  239
            R
Sbjct  61   R  61



>ref|XP_006475931.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Citrus sinensis]
 gb|KDO80086.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
 gb|KDO80087.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1058

 Score =   206 bits (525),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            +RG   SVEALKPSDTF RRHNSATPEDQ+KM+E  G  +LD+LIDATVP+SIR+DSMKF
Sbjct  84   TRG--ISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKF  141

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  142  SKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  201

Query  637  Q  639
            Q
Sbjct  202  Q  202


 Score = 47.4 bits (111),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  237  R  239
            R
Sbjct  61   R  61



>ref|XP_006450834.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
 gb|ESR64074.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
Length=1058

 Score =   206 bits (525),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            +RG   SVEALKPSDTF RRHNSATPEDQ+KM+E  G  +LD+LIDATVP+SIR+DSMKF
Sbjct  84   TRG--ISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKF  141

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  142  SKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  201

Query  637  Q  639
            Q
Sbjct  202  Q  202


 Score = 47.4 bits (111),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  237  R  239
            R
Sbjct  61   R  61



>gb|KDO80089.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1050

 Score =   206 bits (525),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            +RG   SVEALKPSDTF RRHNSATPEDQ+KM+E  G  +LD+LIDATVP+SIR+DSMKF
Sbjct  84   TRG--ISVEALKPSDTFARRHNSATPEDQAKMSELVGLDNLDSLIDATVPKSIRIDSMKF  141

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  142  SKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  201

Query  637  Q  639
            Q
Sbjct  202  Q  202


 Score = 47.0 bits (110),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  236
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  237  R  239
            R
Sbjct  61   R  61



>ref|XP_010432628.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Camelina sativa]
Length=1045

 Score =   199 bits (506),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALKP DTFPRRHNSATP++QS MA+FCG+  +D+L+DATVP+SIRL SMKF KFD 
Sbjct  76   ISVDALKPGDTFPRRHNSATPDEQSFMAKFCGYDHIDSLVDATVPKSIRLGSMKFSKFDD  135

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VI+RNI+ENP WYTQYTPYQ
Sbjct  136  GLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVIIRNILENPAWYTQYTPYQ  191


 Score = 53.9 bits (128),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYEN  230
            MERAR+LA R I++RLV++AK+ R  +TP   + H PARYVSSL+P  + + +
Sbjct  1    MERARRLAYRGIVKRLVNDAKRHRNPDTPHVVVPHAPARYVSSLSPFVSTHRS  53



>gb|KHG00684.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1047

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALK SDTFPRRHNSATPE+Q+KMAE CGF SL +LIDATVP++IR+DSMKF KFD 
Sbjct  76   ISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLYSLIDATVPKAIRIDSMKFSKFDE  135

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  136  GLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  191


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 5/89 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMYENQRRYSG  248
            MERAR+LA+RAILRRLV+E KQ    +    +  L+ P+RYVSSL+P  +   ++    G
Sbjct  1    MERARRLASRAILRRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKCYSRSDLLG  60

Query  249  AGAGFPAS--HQQRRSIFRGGFEAERHFP  329
             G   P S   QQ RSI     ++   FP
Sbjct  61   -GRNVPNSFGSQQLRSISVEALKSSDTFP  88



>sp|P26969.1|GCSP_PEA RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Pisum 
sativum]
 emb|CAA42443.1| P protein [Pisum sativum]
Length=1057

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            S+    SVEALKPSDTFPRRHNSATP++Q+KMAE  GF +LD+L+DATVP+SIRL  MKF
Sbjct  82   SQSRSISVEALKPSDTFPRRHNSATPDEQTKMAESVGFDTLDSLVDATVPKSIRLKEMKF  141

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
             KFD GLTE QMIEHMK+LASKNKVFKS+IGMGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  142  NKFDGGLTEGQMIEHMKDLASKNKVFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPY  201

Query  637  Q  639
            Q
Sbjct  202  Q  202



>ref|XP_003589000.1| Glycine dehydrogenase P protein [Medicago truncatula]
 gb|AES59251.1| glycine dehydrogenase [decarboxylating] protein [Medicago truncatula]
Length=1056

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             +VEALKPSDTF RRHNSATPE+Q+KMAE CGF  LD+L+DATVP+SIRL  MKF KFD 
Sbjct  85   ITVEALKPSDTFARRHNSATPEEQTKMAESCGFDHLDSLVDATVPKSIRLKEMKFNKFDE  144

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE QMIEHMK+LASKNKVFKS+IGMGYYNT VPPVILRNI+ENP WYTQYTPYQ
Sbjct  145  GLTEGQMIEHMKDLASKNKVFKSFIGMGYYNTHVPPVILRNILENPAWYTQYTPYQ  200



>ref|XP_010942763.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Elaeis guineensis]
Length=1042

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 111/133 (83%), Gaps = 3/133 (2%)
 Frame = +1

Query  241  TPAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  420
            +P+P   FR A  +    SVE+L+PSDTFPRRHNSA+P+DQ++MAE CGFPSLD LID T
Sbjct  57   SPSP---FRNASHQFRWISVESLRPSDTFPRRHNSASPDDQARMAELCGFPSLDTLIDTT  113

Query  421  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  600
            VP+SIR+  M  PKFD GLTE+QM+ HMK LAS NKVFKS+IGMGYYNTFVP VILRNIM
Sbjct  114  VPKSIRIAPMTLPKFDAGLTESQMLAHMKRLASMNKVFKSFIGMGYYNTFVPAVILRNIM  173

Query  601  ENPGWYTQYTPYQ  639
            ENPGWYTQYTPYQ
Sbjct  174  ENPGWYTQYTPYQ  186



>gb|AAN17423.1| P-Protein - like protein [Arabidopsis thaliana]
Length=956

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SIRLDSMKF KFD 
Sbjct  68   ISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSIRLDSMKFSKFDA  127

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  128  GLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAWYTQYTPYQ  183


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
            A F   HQQ RSI     +    FP
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFP  80



>ref|NP_001119106.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 gb|AEE86160.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=976

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SIRLDSMKF KFD 
Sbjct  68   ISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSIRLDSMKFSKFDA  127

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  128  GLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAWYTQYTPYQ  183


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
            A F   HQQ RSI     +    FP
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFP  80



>gb|AAB99845.1| glycine decarboxylase multi-enzyme complex P subunit [Coffea 
congensis]
Length=142

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  331  RRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKN  510
            RR NSATPE+Q KM E CGFPSLD+LIDATVP+SIRLD M F KFD GLTEAQMI+HM+ 
Sbjct  1    RRDNSATPEEQIKMVENCGFPSLDSLIDATVPKSIRLDGMTFSKFDEGLTEAQMIDHMEK  60

Query  511  LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            LASKNKVFKSYIGMGYYNTFVPPVILRN++ENP WYTQYTPYQ
Sbjct  61   LASKNKVFKSYIGMGYYNTFVPPVILRNLLENPAWYTQYTPYQ  103



>gb|AAK68740.1| P-Protein - like protein [Arabidopsis thaliana]
 gb|AAM91322.1| P-protein-like protein [Arabidopsis thaliana]
Length=1037

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SIRLDSMKF KFD 
Sbjct  68   ISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSIRLDSMKFSKFDA  127

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  128  GLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAWYTQYTPYQ  183


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
            A F   HQQ RSI     +    FP
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFP  80



>ref|NP_195027.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 sp|Q94B78.2|GCSP1_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 1, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 1; 
AltName: Full=Glycine decarboxylase 1; AltName: Full=Glycine 
decarboxylase P-protein 1; Short=AtGLDP1; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA21210.1| P-Protein-like protein [Arabidopsis thaliana]
 emb|CAB80018.1| P-Protein-like protein [Arabidopsis thaliana]
 gb|AAL36259.1| putative P-Protein [Arabidopsis thaliana]
 gb|AAM14125.1| putative P-protein [Arabidopsis thaliana]
 gb|AEE86159.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=1037

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SIRLDSMKF KFD 
Sbjct  68   ISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSIRLDSMKFSKFDA  127

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  128  GLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAWYTQYTPYQ  183


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
            A F   HQQ RSI     +    FP
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFP  80



>gb|AAL57651.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
 gb|AAN64523.1| At4g33010/F26P21_130 [Arabidopsis thaliana]
Length=1037

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SIRLDSMKF KFD 
Sbjct  68   ISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSIRLDSMKFSKFDA  127

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  128  GLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAWYTQYTPYQ  183


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
            A F   HQQ RSI     +    FP
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFP  80



>ref|XP_002867212.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43471.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
Length=1037

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALKP DTFPRRHNSATP++QS MA+FCGF  +D+LIDATVP+SIRLDSMKF KFD 
Sbjct  68   ISVDALKPGDTFPRRHNSATPDEQSHMAKFCGFDHIDSLIDATVPKSIRLDSMKFSKFDG  127

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM +LASKNKV KS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  128  GLTESQMIEHMVDLASKNKVLKSFIGMGYYNTHVPTVILRNIMENPAWYTQYTPYQ  183


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  254
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FLSTHRSVNPA  56

Query  255  AGFPASHQQRRSIFRGGFEAERHFP  329
            A F   HQQ RSI     +    FP
Sbjct  57   AAF-GRHQQTRSISVDALKPGDTFP  80



>ref|XP_010667776.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=1042

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALKPSDTF RRHNS  PE++ KMA++CGF + +ALIDATVP+SIR+ SMKF KFD 
Sbjct  72   ISVDALKPSDTFARRHNSINPEEEIKMAQYCGFDNTNALIDATVPKSIRIQSMKFSKFDE  131

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTEAQMIEHMKNLASKNK+FKS+IGMGYY+T+VPPVILRNIMENP WYTQYTPYQ
Sbjct  132  GLTEAQMIEHMKNLASKNKIFKSFIGMGYYDTYVPPVILRNIMENPAWYTQYTPYQ  187



>ref|XP_008808050.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  262  FRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  441
            FR A  +    SVE+++PSDTF RRHNSA+P+DQ +MAE CGFPSLDALIDATVP+SIR+
Sbjct  59   FRNAGWQSRSISVESMRPSDTFSRRHNSASPDDQVRMAELCGFPSLDALIDATVPKSIRI  118

Query  442  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  621
              M  PKFD GLTE+QM+ HMK LAS N+VFKS+IGMGYYNTFVP VILRNIMENPGWYT
Sbjct  119  PPMALPKFDAGLTESQMLAHMKRLASMNRVFKSFIGMGYYNTFVPAVILRNIMENPGWYT  178

Query  622  QYTPYQ  639
            QYTPYQ
Sbjct  179  QYTPYQ  184



>ref|XP_002880741.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57000.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
Length=1043

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFD  468
             S++ALKPSDTFPRRHNSATPE+Q++MA +CGF  L+ LID+TVP+SIRLDSMKF  KFD
Sbjct  72   ISIDALKPSDTFPRRHNSATPEEQTQMANYCGFDHLNTLIDSTVPKSIRLDSMKFSGKFD  131

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  132  EGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  188



>gb|AAU94363.1| glycine decarboxylase P-protein [Moricandia nitens]
Length=497

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEA+KP DTFPRRHNSATP++Q+ MA+ CG+  +D+L+DATVP+ IR+DSMKF KFD 
Sbjct  74   ISVEAVKPGDTFPRRHNSATPDEQAHMAKLCGYDHIDSLVDATVPKQIRIDSMKFSKFDE  133

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+ENP WYTQYTPYQ
Sbjct  134  GLTESQMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNILENPAWYTQYTPYQ  189


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 49/90 (54%), Gaps = 9/90 (10%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  239
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H PARY+SSL+P    Y +  R
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRKGEITPHHVPSVVPHAPARYISSLSP----YLSNHR  56

Query  240  YSGAGAGFPASHQQRRSIFRGGFEAERHFP  329
                GA    +H Q RSI     +    FP
Sbjct  57   SVNVGARHHHNHHQTRSISVEAVKPGDTFP  86



>ref|XP_006858311.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
 gb|ERN19778.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
Length=1044

 Score =   204 bits (519),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  283  GGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF--  456
            G   S EALKPSDTFPRRHNSATPE+Q+KMA+ CGFPSLD+LIDATVP SIR   M F  
Sbjct  69   GRSISTEALKPSDTFPRRHNSATPEEQAKMAKTCGFPSLDSLIDATVPVSIRGPPMHFSD  128

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
            P+FD G TE+QM+EHMK L++KNKVFKSYIGMGYYNTFVPPVI+RNIMENPGWYTQYTPY
Sbjct  129  PRFDAGFTESQMVEHMKRLSAKNKVFKSYIGMGYYNTFVPPVIVRNIMENPGWYTQYTPY  188

Query  637  Q  639
            Q
Sbjct  189  Q  189



>emb|CBI27919.3| unnamed protein product [Vitis vinifera]
Length=1024

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVE+L+PSDTFPRRHNSATP+++S MAE CGF SLDALIDATVP+SIR+ SMKF K D 
Sbjct  74   ISVESLRPSDTFPRRHNSATPQEESSMAETCGFSSLDALIDATVPKSIRIGSMKFSKLDE  133

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM  LA+KNKV+KS+IGMGYY T VP VILRNIMENPGWYTQYTPYQ
Sbjct  134  GLTESQMIEHMNQLAAKNKVYKSFIGMGYYGTLVPHVILRNIMENPGWYTQYTPYQ  189



>ref|XP_002282271.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1046

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVE+L+PSDTFPRRHNSATP+++S MAE CGF SLDALIDATVP+SIR+ SMKF K D 
Sbjct  74   ISVESLRPSDTFPRRHNSATPQEESSMAETCGFSSLDALIDATVPKSIRIGSMKFSKLDE  133

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMIEHM  LA+KNKV+KS+IGMGYY T VP VILRNIMENPGWYTQYTPYQ
Sbjct  134  GLTESQMIEHMNQLAAKNKVYKSFIGMGYYGTLVPHVILRNIMENPGWYTQYTPYQ  189



>ref|XP_010417387.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1041

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KF  465
            P SV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L  LID+TVP+SIRLDSMKF  KF
Sbjct  69   PISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLSKLIDSTVPKSIRLDSMKFSGKF  128

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            D GLTE+QM++HM  LASKN+VFKS+IGMGYYNT VP VILRNIMENPGWYTQYTPYQ
Sbjct  129  DEGLTESQMVKHMSELASKNRVFKSFIGMGYYNTHVPTVILRNIMENPGWYTQYTPYQ  186



>ref|XP_008797766.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  262  FRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  441
            FR A  +    SVE+L+PSDTF RRHNSA+P+DQ +MAE CGFPSLDALIDATVP+SIR+
Sbjct  59   FRNAGRQSRWISVESLRPSDTFARRHNSASPDDQVRMAEVCGFPSLDALIDATVPKSIRI  118

Query  442  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  621
              M  PKFD GLTE+QM+ HM  LAS NK FKS+IGMGYYNTFVP VILRNIMENPGWYT
Sbjct  119  PPMTLPKFDAGLTESQMLGHMNRLASMNKAFKSFIGMGYYNTFVPAVILRNIMENPGWYT  178

Query  622  QYTPYQ  639
            QYTPYQ
Sbjct  179  QYTPYQ  184



>ref|NP_180178.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
 sp|O80988.1|GCSP2_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 2, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 2; 
AltName: Full=Glycine decarboxylase 2; AltName: Full=Glycine 
decarboxylase P-protein 2; Short=AtGLDP2; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC31228.1| putative glycine dehydrogenase [Arabidopsis thaliana]
 gb|AEC07793.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
Length=1044

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPK-FD  468
             SV+ALKPSDTFPRRHNSATP++Q++MA +CGF +L+ LID+TVP+SIRLDSMKF   FD
Sbjct  73   ISVDALKPSDTFPRRHNSATPDEQAQMANYCGFDNLNTLIDSTVPKSIRLDSMKFSGIFD  132

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  133  EGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  189



>dbj|BAE98954.1| putative glycine dehydrogenase [Arabidopsis thaliana]
Length=1044

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPK-FD  468
             SV+ALKPSDTFPRRHNSATP++Q++MA +CGF +L+ LID+TVP+SIRLDSMKF   FD
Sbjct  73   ISVDALKPSDTFPRRHNSATPDEQAQMANYCGFDNLNTLIDSTVPKSIRLDSMKFSGIFD  132

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  133  EGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRNIMENPAWYTQYTPYQ  189



>ref|XP_010472637.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1046

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 111/135 (82%), Gaps = 3/135 (2%)
 Frame = +1

Query  238  GTPAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  417
            G   P  G  +  +R  P SV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L  LID+
Sbjct  59   GGSVPGTGMNQHQTR--PISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLSKLIDS  116

Query  418  TVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  594
            TVP+SIRL SMKF  KFD GLTE+QMI+HM  LASKN+VFKS+IGMGYYNT VP VILRN
Sbjct  117  TVPKSIRLGSMKFSGKFDEGLTESQMIKHMSELASKNRVFKSFIGMGYYNTHVPTVILRN  176

Query  595  IMENPGWYTQYTPYQ  639
            IMENPGWYTQYTPYQ
Sbjct  177  IMENPGWYTQYTPYQ  191



>ref|XP_006296473.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
 gb|EOA29371.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
Length=1040

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFD  468
             SV+ALKPSDTFPRRHNSA+PE+Q++MA++CGF  L  LID+TVP+SIRL SMKF  KFD
Sbjct  69   ISVDALKPSDTFPRRHNSASPEEQAQMAKYCGFDDLGTLIDSTVPKSIRLGSMKFSEKFD  128

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VPPVILRNIMENPGWYTQYTPYQ
Sbjct  129  EGLTESQMIKHMSDLASKNKVFKSFIGMGYYNTHVPPVILRNIMENPGWYTQYTPYQ  185



>ref|XP_010429623.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial 
[Camelina sativa]
Length=1044

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFD  468
             SV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L+ LID+TVP+SIRLDSMKF  KFD
Sbjct  73   ISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLNKLIDSTVPKSIRLDSMKFSGKFD  132

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE++MI+HM  LASKN+VFKS+IGMGYYNT VP VILRNIMENPGWYTQYTPYQ
Sbjct  133  EGLTESEMIKHMSELASKNRVFKSFIGMGYYNTHVPTVILRNIMENPGWYTQYTPYQ  189



>gb|KHN29723.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1031

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +1

Query  244  PAPE--LGFRRAISRGGP---FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  408
            P PE  +G  R +S   P    S++ALKPSDTFPRRHNSAT E+QSKMA+ CGF SLD+L
Sbjct  39   PKPENPIGNNRKLSHNVPSRFISLDALKPSDTFPRRHNSATSEEQSKMAQTCGFDSLDSL  98

Query  409  IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  588
            IDATVP+SIRL+ M F  F+ GLTE++M  HM +LASKNK FKSYIGMGYYNT VPPVIL
Sbjct  99   IDATVPKSIRLNDMSFSVFNEGLTESEMSSHMNSLASKNKCFKSYIGMGYYNTHVPPVIL  158

Query  589  RNIMENPGWYTQYTPYQ  639
            RNIMENP WYTQYTPYQ
Sbjct  159  RNIMENPAWYTQYTPYQ  175



>ref|XP_003523643.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1031

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +1

Query  244  PAPE--LGFRRAISRGGP---FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  408
            P PE  +G  R +S   P    S++ALKPSDTFPRRHNSAT E+QSKMA+ CGF SLD+L
Sbjct  39   PKPENPIGNNRKLSHNVPSRFISLDALKPSDTFPRRHNSATSEEQSKMAQTCGFDSLDSL  98

Query  409  IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  588
            IDATVP+SIRL+ M F  F+ GLTE++M  HM +LASKNK FKSYIGMGYYNT VPPVIL
Sbjct  99   IDATVPKSIRLNDMSFSVFNEGLTESEMSSHMNSLASKNKCFKSYIGMGYYNTHVPPVIL  158

Query  589  RNIMENPGWYTQYTPYQ  639
            RNIMENP WYTQYTPYQ
Sbjct  159  RNIMENPAWYTQYTPYQ  175



>ref|XP_010437818.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Camelina sativa]
Length=1040

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ALKP DTFPRRHNSATP++QS MA+FCG+  +D+L+DATVP+SIRL SMKF KFD 
Sbjct  71   ISVDALKPGDTFPRRHNSATPDEQSYMAKFCGYDHIDSLVDATVPKSIRLGSMKFSKFDD  130

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VI+RNI+ENP WYTQYTPYQ
Sbjct  131  GLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVIIRNILENPAWYTQYTPYQ  186


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYENQRRYSGA  251
            MERAR+LA R I++RLV++AK+ R  +TP   + H PARYVSSL+P  + + +    S A
Sbjct  1    MERARRLAYRGIVKRLVNDAKRHRNPDTPHLVVPHAPARYVSSLSPFVSTHRSVNPTSAA  60

Query  252  GAGFPASHQQRRSIFRGGFEAERHFP  329
              G    HQQ RSI     +    FP
Sbjct  61   AFG---RHQQTRSISVDALKPGDTFP  83



>ref|XP_009392931.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1038

 Score =   199 bits (505),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+AL+PSDTFPRRHNSATP+DQS MA  CGF SLDALIDATVP+SIR+  MKF KFD 
Sbjct  67   ISVDALRPSDTFPRRHNSATPDDQSTMAASCGFGSLDALIDATVPKSIRIPDMKFAKFDG  126

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE++MI HM  LA+KNKVFKS+IGMGYY+T VP VILRNIMENP WYTQYTPYQ
Sbjct  127  GLTESEMIAHMSRLAAKNKVFKSFIGMGYYDTLVPAVILRNIMENPAWYTQYTPYQ  182



>gb|KHN32209.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1023

 Score =   196 bits (498),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 109/138 (79%), Gaps = 6/138 (4%)
 Frame = +1

Query  244  PAPE---LGFRRAISRGGP---FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  405
            P PE   LG  R +S   P    S+ ALKPSD+FPRRHNSAT E+Q+KMA+ CGF +LD+
Sbjct  30   PKPENSILGSNRKLSHYVPSRSISLAALKPSDSFPRRHNSATSEEQTKMAQTCGFDTLDS  89

Query  406  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  585
            LIDATVP+SIRL  M F  F+ GLTE++M+ HM +LASKNK FKSYIGMGYYNT VPPVI
Sbjct  90   LIDATVPKSIRLSDMSFSVFNEGLTESEMMSHMNSLASKNKCFKSYIGMGYYNTHVPPVI  149

Query  586  LRNIMENPGWYTQYTPYQ  639
            LRNIMENP WYTQYTPYQ
Sbjct  150  LRNIMENPAWYTQYTPYQ  167



>ref|XP_003526001.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1023

 Score =   196 bits (498),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 109/138 (79%), Gaps = 6/138 (4%)
 Frame = +1

Query  244  PAPE---LGFRRAISRGGP---FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  405
            P PE   LG  R +S   P    S+ ALKPSD+FPRRHNSAT E+Q+KMA+ CGF +LD+
Sbjct  30   PKPENSILGSNRKLSHYVPSRSISLAALKPSDSFPRRHNSATSEEQTKMAQTCGFDTLDS  89

Query  406  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  585
            LIDATVP+SIRL  M F  F+ GLTE++M+ HM +LASKNK FKSYIGMGYYNT VPPVI
Sbjct  90   LIDATVPKSIRLSDMSFSVFNEGLTESEMMSHMNSLASKNKCFKSYIGMGYYNTHVPPVI  149

Query  586  LRNIMENPGWYTQYTPYQ  639
            LRNIMENP WYTQYTPYQ
Sbjct  150  LRNIMENPAWYTQYTPYQ  167



>ref|XP_009401914.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1033

 Score =   196 bits (497),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+AL+PSDTFPRRHNSATPE+Q  MA  CGF SLDALIDATVP++IR+  ++ PKFD 
Sbjct  62   ISVDALRPSDTFPRRHNSATPEEQFTMAASCGFSSLDALIDATVPKTIRISDIRLPKFDA  121

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE++MI HM  LA+KNKVFKS+IGMGYYNT VP VILRNIMENP WYTQYTPYQ
Sbjct  122  GLTESEMIAHMSRLAAKNKVFKSFIGMGYYNTLVPGVILRNIMENPAWYTQYTPYQ  177



>emb|CDX75316.1| BnaA01g03860D [Brassica napus]
Length=1044

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D TVP+ IR+DSMKF KFD 
Sbjct  75   ISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVDDTVPKQIRIDSMKFSKFDG  134

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE++MI HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+ENP WYTQYTPYQ
Sbjct  135  GLTESEMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNILENPAWYTQYTPYQ  190


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 12/92 (13%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  239
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H P+RY+SSL+P  +   + R 
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPSRYISSLSPFLSNNHHNR-  59

Query  240  YSGAGAGFPA--SHQQRRSIFRGGFEAERHFP  329
                    P   +H Q RSI     +A   FP
Sbjct  60   ----SVNLPKHHNHNQTRSISVDAVKAGDTFP  87



>ref|XP_009125119.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Brassica rapa]
Length=1045

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D TVP+ IR+DSMKF KFD 
Sbjct  76   ISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVDDTVPKQIRIDSMKFSKFDG  135

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE++MI HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+ENP WYTQYTPYQ
Sbjct  136  GLTESEMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNILENPAWYTQYTPYQ  191


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  239
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H P+RY+SSL+P   +  N  R
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPSRYISSLSP--FLSNNHHR  58

Query  240  YSGAGAGFPASHQQRRSIFRGGFEAERHFP  329
                      +H Q RSI     +A   FP
Sbjct  59   SVNLPKHHHHNHNQTRSISVDAVKAGDTFP  88



>emb|CDX68930.1| BnaC01g05230D [Brassica napus]
Length=1045

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D TVP+ IR+DSMKF KFD 
Sbjct  76   ISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVDDTVPKQIRIDSMKFSKFDG  135

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE++M+ HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+ENP WYTQYTPYQ
Sbjct  136  GLTESEMMAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNILENPAWYTQYTPYQ  191


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 47/90 (52%), Gaps = 7/90 (8%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  239
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H PARY+SSL+P   +  N  R
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPARYISSLSP--FLSNNHHR  58

Query  240  YSGAGAGFPASHQQRRSIFRGGFEAERHFP  329
                       H Q RSI     +A   FP
Sbjct  59   SVNLPKHHHHHHNQTRSISVDAVKAGDTFP  88



>ref|XP_004969722.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Setaria italica]
Length=1033

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 106/141 (75%), Gaps = 9/141 (6%)
 Frame = +1

Query  244  PAPEL-GFRRAISRGG-------PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  399
            PAP   G RR  +RG        P SV AL+PSDTFPRRHNSATP +Q+ MA  CGF ++
Sbjct  37   PAPAAAGKRRPRARGAHQYAQGRPVSVSALQPSDTFPRRHNSATPAEQAAMASTCGFDTV  96

Query  400  DALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVP  576
            DALIDATVP +IR  +M F  KFD G TE+QMI+HM+ LAS NK +KS+IGMGYYNT VP
Sbjct  97   DALIDATVPAAIRAPTMHFAGKFDEGFTESQMIDHMQRLASMNKAYKSFIGMGYYNTHVP  156

Query  577  PVILRNIMENPGWYTQYTPYQ  639
             VILRN+MENP WYTQYTPYQ
Sbjct  157  AVILRNLMENPAWYTQYTPYQ  177



>ref|XP_003569669.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Brachypodium distachyon]
Length=1033

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 103/140 (74%), Gaps = 7/140 (5%)
 Frame = +1

Query  241  TPAPELGFRRAISR------GGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  402
             PAP  G R    R      G P SV AL+PSDTFPRRHNSATP +Q+ MA  CGF +LD
Sbjct  36   VPAPAAGSRPHTRRAHQHTQGRPVSVSALQPSDTFPRRHNSATPAEQAVMASACGFNTLD  95

Query  403  ALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  579
            ALIDATVP +IR   M+F  KFD G TE+QM+EHM  L+S NK +KS+IGMGYYNT +P 
Sbjct  96   ALIDATVPAAIRAPPMQFSGKFDAGFTESQMLEHMARLSSMNKAYKSFIGMGYYNTHIPA  155

Query  580  VILRNIMENPGWYTQYTPYQ  639
            VILRN+MENP WYTQYTPYQ
Sbjct  156  VILRNLMENPAWYTQYTPYQ  175



>gb|AAB82711.1| glycine decarboxylase P subunit [x Tritordeum sp.]
Length=1031

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +1

Query  283  GGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  459
            G P SV AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR   M+F  
Sbjct  56   GCPVSVSALQPSDTFPRRHNSATPAEQAVMASECGFNTLDALIDATVPAAIRAPPMQFTG  115

Query  460  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            KFD G TE+QM+EHM +LAS NK +KS+IGMGYYNT +P VILRN+MENP WYTQYTPYQ
Sbjct  116  KFDAGFTESQMLEHMAHLASMNKTYKSFIGMGYYNTHIPAVILRNLMENPAWYTQYTPYQ  175



>emb|CDM83805.1| unnamed protein product [Triticum aestivum]
Length=1031

 Score =   182 bits (461),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +1

Query  283  GGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  459
            G P SV AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR   M+F  
Sbjct  56   GRPVSVSALQPSDTFPRRHNSATPAEQAVMASECGFNTLDALIDATVPAAIRAPPMQFTG  115

Query  460  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            KFD G TE+QM+EHM +LAS NK +KS+IGMGYYNT +P VILRN+MENP WYTQYTPYQ
Sbjct  116  KFDAGFTESQMLEHMAHLASMNKTYKSFIGMGYYNTHIPAVILRNLMENPAWYTQYTPYQ  175



>ref|NP_001044046.1| Os01g0711400 [Oryza sativa Japonica Group]
 gb|AAQ24377.1| glycine dehydrogenase P protein [Oryza sativa Japonica Group]
 dbj|BAF05960.1| Os01g0711400 [Oryza sativa Japonica Group]
Length=1033

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            + G P S  AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR  +M F
Sbjct  56   TTGRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFNTLDALIDATVPAAIRAPTMHF  115

Query  457  P-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTP  633
              KFD G TE+QMI+HM+ LA+ NK +KS+IGMGYYNT VP VILRN+MENP WYTQYTP
Sbjct  116  SGKFDAGFTESQMIDHMQRLAAMNKAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTP  175

Query  634  YQ  639
            YQ
Sbjct  176  YQ  177



>gb|EAY75571.1| hypothetical protein OsI_03474 [Oryza sativa Indica Group]
Length=1033

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            + G P S  AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR  +M F
Sbjct  56   TTGRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFNTLDALIDATVPAAIRAPTMHF  115

Query  457  P-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTP  633
              KFD G TE+QMI+HM+ LA+ NK +KS+IGMGYYNT VP VILRN+MENP WYTQYTP
Sbjct  116  SGKFDAGFTESQMIDHMQRLAAMNKAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTP  175

Query  634  YQ  639
            YQ
Sbjct  176  YQ  177



>gb|AAA63798.1| victorin binding protein [Avena sativa]
Length=1032

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KF  465
            P SV AL+PSDTFPRRHNSA+P +Q+ MA  CGF +LD+LIDATVP +IR   M+F  KF
Sbjct  59   PVSVSALQPSDTFPRRHNSASPAEQTVMASTCGFNTLDSLIDATVPAAIRAPPMQFTGKF  118

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            D G TE+QM+EHM +LAS NKV+KS+IGMGYYNT +P VILRN+MENP WYTQYTPYQ
Sbjct  119  DAGFTESQMLEHMAHLASMNKVYKSFIGMGYYNTHIPAVILRNLMENPAWYTQYTPYQ  176



>ref|NP_001058062.1| Os06g0611900 [Oryza sativa Japonica Group]
 dbj|BAF19976.1| Os06g0611900 [Oryza sativa Japonica Group]
Length=892

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KF  465
            P S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  +F
Sbjct  58   PVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSGRF  117

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            D G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  118  DAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  175



>ref|XP_007136824.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
 gb|ESW08818.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
Length=1018

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  280  RGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP  459
            R    SVEALKPSDTFPRRHNSAT ++   MA+ CGF  L++LIDAT+P SIR   M F 
Sbjct  56   RSRSISVEALKPSDTFPRRHNSATSDELINMAQTCGFSDLNSLIDATIPISIRRKEMSFN  115

Query  460  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             FD GLTEA+M+ HMK+L +KNK FKSYIGMGYY+  VP VILRNIMENP WYTQYTPYQ
Sbjct  116  TFDEGLTEAEMMLHMKSLEAKNKCFKSYIGMGYYDMHVPTVILRNIMENPAWYTQYTPYQ  175



>gb|AAS16361.1| glycine dehydrogenase P protein [Oryza sativa Indica Group]
Length=892

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KF  465
            P S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  +F
Sbjct  58   PVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSGRF  117

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            D G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  118  DAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  175



>ref|XP_006371884.1| hypothetical protein POPTR_0018s05150g [Populus trichocarpa]
 gb|ERP49681.1| hypothetical protein POPTR_0018s05150g [Populus trichocarpa]
Length=804

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  340  NSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLAS  519
            ++ATPE+Q+KMAE CGF +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHMK LAS
Sbjct  79   SAATPEEQTKMAELCGFDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMKYLAS  138

Query  520  KNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYT  630
            KNKVFKSYIGMGYY+T VPPVILRNIMENP WYTQYT
Sbjct  139  KNKVFKSYIGMGYYDTQVPPVILRNIMENPAWYTQYT  175



>gb|EAZ37623.1| hypothetical protein OsJ_21958 [Oryza sativa Japonica Group]
Length=1005

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KF  465
            P S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  +F
Sbjct  58   PVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSGRF  117

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            D G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  118  DAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  175



>gb|EAZ13293.1| hypothetical protein OsJ_03218 [Oryza sativa Japonica Group]
Length=1035

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KF  465
            P S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  +F
Sbjct  62   PVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSGRF  121

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            D G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  122  DAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  179



>dbj|BAD35509.1| putative glycine dehydrogenase [Oryza sativa Japonica Group]
 gb|EAZ01651.1| hypothetical protein OsI_23687 [Oryza sativa Indica Group]
Length=1031

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KF  465
            P S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  +F
Sbjct  58   PVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSGRF  117

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            D G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  118  DAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  175



>ref|XP_001780310.1| predicted protein [Physcomitrella patens]
 gb|EDQ54869.1| predicted protein [Physcomitrella patens]
Length=995

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 100/130 (77%), Gaps = 5/130 (4%)
 Frame = +1

Query  265  RRAISRGGPF-----SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  429
            +R + +  PF     S+EALKPSDTF RRHNS T E+Q  MA+ CGF S+DA+IDATVP+
Sbjct  10   KRLVQQVLPFGARTISIEALKPSDTFQRRHNSPTLEEQKMMAQACGFDSMDAMIDATVPK  69

Query  430  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  609
            SIR   +   K+  GLTE+Q++ H K +ASKNKV KSYIGMGYY+T VP VILRNI+ENP
Sbjct  70   SIRRPDLNLSKYGEGLTESQLLAHFKAMASKNKVMKSYIGMGYYDTHVPTVILRNILENP  129

Query  610  GWYTQYTPYQ  639
            GWYTQYTPYQ
Sbjct  130  GWYTQYTPYQ  139



>ref|XP_001754864.1| predicted protein [Physcomitrella patens]
 gb|EDQ80318.1| predicted protein [Physcomitrella patens]
Length=1038

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SVEALKPSDTF RRHNSAT E+Q  MA  CGF  +DA+IDATVP+SIR   +K  K+  
Sbjct  67   ISVEALKPSDTFQRRHNSATLEEQKAMAGMCGFEDMDAMIDATVPKSIRRPDLKLSKYAE  126

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GLTE++++ H K+LASKNKV +S+IGMGY++T VP VILRNI+ENPGWYTQYTPYQ
Sbjct  127  GLTESELLAHFKSLASKNKVMRSFIGMGYHDTHVPTVILRNILENPGWYTQYTPYQ  182



>ref|XP_005850088.1| hypothetical protein CHLNCDRAFT_16305, partial [Chlorella variabilis]
 gb|EFN57986.1| hypothetical protein CHLNCDRAFT_16305, partial [Chlorella variabilis]
Length=324

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI-RLDSMKF-PK  462
            P SV+ALKPSD F  RHNS +  ++  MA+ CGFPSLDAL++ATVP +I R D M   PK
Sbjct  2    PISVQALKPSDRFEPRHNSISEAEKQSMAQLCGFPSLDALVEATVPDAIKRTDGMPLGPK  61

Query  463  FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +  GLTE++ +   K +ASKNKVFKSYIGMGYYNT VPPVILRN++ENPGWYTQYTPYQ
Sbjct  62   YHEGLTESEFLAMFKEMASKNKVFKSYIGMGYYNTHVPPVILRNLLENPGWYTQYTPYQ  120



>ref|XP_002441849.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
 gb|EES15687.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
Length=1042

 Score =   176 bits (446),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPS-LDALIDATVPQSIRLDSMK  453
            ++G P SV AL+PSDTFPRRHNSATP +Q+ MA  CGF   LDALIDATVP +IR   M+
Sbjct  63   AQGRPVSVSALQPSDTFPRRHNSATPAEQAAMATTCGFDGGLDALIDATVPAAIRAPPMR  122

Query  454  FP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYT  630
            F  +FD GLTE+QM++HM+ LAS NK +KS+IGMGYY T VP V+LRN+MENP WYTQYT
Sbjct  123  FSGRFDAGLTESQMLDHMQRLASMNKAYKSFIGMGYYGTHVPGVVLRNLMENPAWYTQYT  182

Query  631  PYQ  639
            PYQ
Sbjct  183  PYQ  185



>ref|XP_008662474.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Zea mays]
 gb|AFW56070.1| glycine cleavage complex P-protein [Zea mays]
Length=1042

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = +1

Query  244  PAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  423
            P P    + A +R    SV AL+PSDTFPRRHNSATP +Q  MA  CGF  +DAL+DATV
Sbjct  54   PPPRGAHQHAQARA--VSVSALQPSDTFPRRHNSATPAEQEAMASACGFGGVDALVDATV  111

Query  424  PQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  600
            P +IR   M+FP +FD G TE+QM++HM+ LAS N+ FKS+IGMGYY T VP V+LRN+M
Sbjct  112  PPAIRAPPMRFPGRFDAGFTESQMLDHMRRLASMNRDFKSFIGMGYYGTHVPAVVLRNLM  171

Query  601  ENPGWYTQYTPYQ  639
            ENP WYTQYTPYQ
Sbjct  172  ENPAWYTQYTPYQ  184



>gb|AFW56071.1| glycine cleavage complex P-protein [Zea mays]
Length=1097

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = +1

Query  244  PAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  423
            P P    + A +R    SV AL+PSDTFPRRHNSATP +Q  MA  CGF  +DAL+DATV
Sbjct  54   PPPRGAHQHAQARA--VSVSALQPSDTFPRRHNSATPAEQEAMASACGFGGVDALVDATV  111

Query  424  PQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  600
            P +IR   M+FP +FD G TE+QM++HM+ LAS N+ FKS+IGMGYY T VP V+LRN+M
Sbjct  112  PPAIRAPPMRFPGRFDAGFTESQMLDHMRRLASMNRDFKSFIGMGYYGTHVPAVVLRNLM  171

Query  601  ENPGWYTQYTPYQ  639
            ENP WYTQYTPYQ
Sbjct  172  ENPAWYTQYTPYQ  184



>ref|XP_001692993.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
 gb|EDP03562.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
Length=1039

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 97/138 (70%), Gaps = 4/138 (3%)
 Frame = +1

Query  229  TSGGTPAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  408
            +   TP P  GF  +  R    SV AL+PSD F  RHNS TP +   M +  GF SLDAL
Sbjct  51   SHAATPLPS-GFAASGIRS--ISVAALQPSDDFKPRHNSGTPAEIDSMVKATGFGSLDAL  107

Query  409  IDATVPQSI-RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  585
            IDATVP++I R D M   K+  G+TE+Q +E+ K +ASKNKV+KSYIGMGYY T VP VI
Sbjct  108  IDATVPKAIVRKDGMNLGKYHEGMTESQFLEYFKAMASKNKVYKSYIGMGYYGTHVPNVI  167

Query  586  LRNIMENPGWYTQYTPYQ  639
            LRN++ENPGWYTQYTPYQ
Sbjct  168  LRNVLENPGWYTQYTPYQ  185



>gb|KDO80088.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=946

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  370  MAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIG  549
            M+E  G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IG
Sbjct  1    MSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIG  60

Query  550  MGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            MGYYNT VPPVILRNIMENP WYTQYTPYQ
Sbjct  61   MGYYNTHVPPVILRNIMENPAWYTQYTPYQ  90



>gb|KIY98368.1| glycine dehydrogenase [Monoraphidium neglectum]
Length=252

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFD  468
             S+ AL+PSD F  RHNS TP +   M    GF S+DALIDATVP  IR  D M   K+ 
Sbjct  70   ISLAALEPSDRFVPRHNSTTPAELDAMVAETGFKSMDALIDATVPVPIRRSDGMGMGKYT  129

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             G+ E++ +E+ K +A KNK++KS+IGMGYY T +PPVILRN++ENPGWYTQYTPYQ
Sbjct  130  EGMKESEFLEYFKEMAGKNKLYKSFIGMGYYGTHIPPVILRNVLENPGWYTQYTPYQ  186



>gb|AGH12215.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=145

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  277  SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            S+    SVEALKPSDTFPRRHNSATPE+Q+KMAEF G+P+LD+LIDATVP+SIRL+SMK+
Sbjct  60   SQARTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGYPNLDSLIDATVPKSIRLESMKY  119

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVF  534
            PKFD GLTE+QMI HM+ LASKNK+ 
Sbjct  120  PKFDEGLTESQMIAHMQELASKNKIL  145


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 47/88 (53%), Gaps = 14/88 (16%)
 Frame = +3

Query  75   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYEN---QRRYS  245
            MERAR+LAN+AILRRLV + K      TP  AL+ P+RYVSSL+P      N    R  +
Sbjct  1    MERARRLANKAILRRLVSKTKH--NPSTP--ALYSPSRYVSSLSPYICSSRNVRFDRNLN  56

Query  246  GAGAGFPASHQQRRSIFRGGFEAERHFP  329
            G G+       Q R+I     +    FP
Sbjct  57   GFGS-------QARTISVEALKPSDTFP  77



>ref|XP_001420206.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98499.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=976

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFD  468
             S EALKP DTF RRHNS T ++ ++M    GF  +DALIDATVP++IRL  +M   ++ 
Sbjct  12   VSTEALKPLDTFERRHNSGTTQEVAEMCAVIGFKDIDALIDATVPENIRLKKTMDMGEYT  71

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              LTE++ +  MKN+ASKNKVFK+YIG GY+ T VP VILRNI+ENPGWYTQYTPYQ
Sbjct  72   QPLTESEFLTMMKNMASKNKVFKNYIGTGYHGTHVPTVILRNILENPGWYTQYTPYQ  128



>ref|XP_002503477.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
 gb|ACO64735.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
Length=988

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKFD  468
             +VEALKP D+F RRHNSAT +++++MA++ GF S+DAL+DATVP  IR   SM   K+ 
Sbjct  22   IAVEALKPLDSFERRHNSATKKEEAEMAKYVGFDSMDALVDATVPSDIRRAGSMDMGKWT  81

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              L+E++ +   K++ASKNKVFKSY G GYY T VP VILRN++ENPGWYTQYTPYQ
Sbjct  82   QPLSESEFLSTFKSMASKNKVFKSYQGTGYYGTHVPTVILRNVLENPGWYTQYTPYQ  138



>ref|XP_002956892.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
 gb|EFJ42017.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
Length=978

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI-RLDSMKFPKFD  468
             +V+AL PSD F  RHNS +P +   M    GF SLDALIDATVP++I R D M   K+ 
Sbjct  27   IAVDALLPSDDFKPRHNSGSPAEIDAMVNMTGFSSLDALIDATVPKAIVRKDGMDLGKYH  86

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             G+TE+Q + + K++A KNKV KS++GMGYY+  VPPVILRN++ENPGWYTQYTPYQ
Sbjct  87   EGMTESQFLSYFKSMAGKNKVLKSFLGMGYYDVHVPPVILRNVLENPGWYTQYTPYQ  143



>ref|XP_003081763.1| GCSP_FLAAN Glycine dehydrogenase [decarboxylating], mitochondrial 
precursor (Glycine decarboxylase) (ISS), partial [Ostreococcus 
tauri]
Length=880

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 8/131 (6%)
 Frame = +1

Query  271  AISRGGP-------FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  429
            A +RGG         S  +LKP DTF RRHNS T E+ ++M +  GF ++DALIDATVP 
Sbjct  3    ARARGGANAMSARNVSAASLKPLDTFERRHNSGTEEEVAEMCKVVGFENIDALIDATVPT  62

Query  430  SIRL-DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  606
            +IRL   M   K+   LTE++ +  MK++A KNKV+K+YIG GY+ T VPPVILRNI+EN
Sbjct  63   NIRLPKLMDMGKYTEPLTESEFLAKMKDIAGKNKVYKTYIGAGYHGTHVPPVILRNILEN  122

Query  607  PGWYTQYTPYQ  639
            PGWYTQYTPYQ
Sbjct  123  PGWYTQYTPYQ  133



>emb|CEF99477.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
1 [Ostreococcus tauri]
Length=1019

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 8/131 (6%)
 Frame = +1

Query  271  AISRGGP-------FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  429
            A +RGG         S  +LKP DTF RRHNS T E+ ++M +  GF ++DALIDATVP 
Sbjct  41   ARARGGANAMSARNVSAASLKPLDTFERRHNSGTEEEVAEMCKVVGFENIDALIDATVPT  100

Query  430  SIRL-DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  606
            +IRL   M   K+   LTE++ +  MK++A KNKV+K+YIG GY+ T VPPVILRNI+EN
Sbjct  101  NIRLPKLMDMGKYTEPLTESEFLAKMKDIAGKNKVYKTYIGAGYHGTHVPPVILRNILEN  160

Query  607  PGWYTQYTPYQ  639
            PGWYTQYTPYQ
Sbjct  161  PGWYTQYTPYQ  171



>ref|XP_003055654.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
 gb|EEH60906.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
Length=1045

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +1

Query  256  LGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  435
            LGF  A++     + E L+P D+F RRHNSAT E++ +MA++ GF S+DAL+DATVP  I
Sbjct  64   LGFA-AVATTRSIATETLRPLDSFERRHNSATKEEEIEMAKYVGFDSMDALVDATVPTDI  122

Query  436  R-LDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  612
            R    M   ++   L+E++ +   K +ASKNKVFKSY G GYY T VPPVILRN++ENPG
Sbjct  123  RRAGEMDMGEWTSPLSESEYLARFKAMASKNKVFKSYQGTGYYGTHVPPVILRNVLENPG  182

Query  613  WYTQYTPYQ  639
            WYTQYTPYQ
Sbjct  183  WYTQYTPYQ  191



>ref|XP_011398598.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25702.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
Length=1211

 Score =   145 bits (365),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 77/144 (53%), Positives = 91/144 (63%), Gaps = 10/144 (7%)
 Frame = +1

Query  220  CTKTSGGTPAPELGFR--RAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFP  393
            C       P P    R  RAIS      +E+L+PSDTF  RHNS TP +  +M    GF 
Sbjct  217  CRLPCSSGPIPSFASRGVRAIS------IESLQPSDTFEPRHNSITPNEVKEMVGLLGFD  270

Query  394  SLDALIDATVPQSIRLDSMKFPKFDH--GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  567
            SLDALIDATVP SIR + +      H  G+TE+  I+  + LA +NKV  S+IGMGYY T
Sbjct  271  SLDALIDATVPASIRREGVMELANSHPDGITESAFIKEFRALAEQNKVASSHIGMGYYGT  330

Query  568  FVPPVILRNIMENPGWYTQYTPYQ  639
              PPVILRNI+ENPGWYTQYTPYQ
Sbjct  331  ITPPVILRNILENPGWYTQYTPYQ  354



>ref|XP_005649750.1| glycine dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE25206.1| glycine dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=1041

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             SV+ L+P+D F  RHNS T ++  +M    GF S+  LIDATVP++IR   M   ++  
Sbjct  66   ISVQTLQPTDVFAPRHNSGTEQEVQEMVNLTGFGSMAELIDATVPKAIRRGQMDLGEYTK  125

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            G TE++ I   K +A KNK+FKSY+GMGYYNT +PPVI RN++ENPGWYTQYTPYQ
Sbjct  126  GYTESEFIAKFKKMAEKNKMFKSYLGMGYYNTHLPPVIQRNLLENPGWYTQYTPYQ  181



>ref|XP_002979861.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
 gb|EFJ19263.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
Length=946

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = +1

Query  370  MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  546
            MAE  GF S+D L++ATVP+ I+   M  P KF  GLTE+QMI+HMK LA+KNK+ KSYI
Sbjct  1    MAEVVGFSSMDELVEATVPKPIKRGPMSLPGKFHEGLTESQMIDHMKYLAAKNKIAKSYI  60

Query  547  GMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GMGYYNT VPPVILRNIMENPGWYTQYTPYQ
Sbjct  61   GMGYYNTIVPPVILRNIMENPGWYTQYTPYQ  91



>ref|XP_002988429.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
 gb|EFJ10519.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
Length=946

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = +1

Query  370  MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  546
            MAE  GF S+D L++ATVP+ I+   M  P KF  GLTE+QMI+HMK LA+KNK+ KSYI
Sbjct  1    MAEAVGFSSMDELVEATVPKPIKRGPMSLPGKFHEGLTESQMIDHMKYLAAKNKIAKSYI  60

Query  547  GMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GMGYYNT VPPVILRNIMENPGWYTQYTPYQ
Sbjct  61   GMGYYNTIVPPVILRNIMENPGWYTQYTPYQ  91



>ref|XP_007510359.1| glycine dehydrogenase [Bathycoccus prasinos]
 emb|CCO18704.1| glycine dehydrogenase [Bathycoccus prasinos]
Length=1040

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 90/129 (70%), Gaps = 5/129 (4%)
 Frame = +1

Query  262  FRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  441
            F +  SR    SVE+L P DTF RRHNSA+ E+  +MA F GF S+  LIDATVP +I+ 
Sbjct  66   FNKIFSR--QISVESLGPLDTFERRHNSASKEEAEEMARFVGFKSVRELIDATVPDNIKA  123

Query  442  D---SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  612
                ++   +++ G +E + ++  K +A KNKVFK+Y+G GY+ T VP VILRNI+ENPG
Sbjct  124  PQALNLGSEEYNRGYSETEFLDMFKKMAGKNKVFKNYLGTGYHGTHVPQVILRNILENPG  183

Query  613  WYTQYTPYQ  639
            WYTQYTPYQ
Sbjct  184  WYTQYTPYQ  192



>ref|XP_006644607.1| PREDICTED: glycine dehydrogenase [decarboxylating] 2, mitochondrial-like 
[Oryza brachyantha]
Length=946

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +1

Query  370  MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  546
            MA  CGF +LDALIDATVP +IR   M F  KFD G TE+QMI+HM+ LA+ NK +KS+I
Sbjct  1    MASECGFNTLDALIDATVPAAIRAPQMHFSGKFDAGFTESQMIDHMQRLAAMNKAYKSFI  60

Query  547  GMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  61   GMGYYNTHVPGVILRNLMENPAWYTQYTPYQ  91



>gb|EMT12369.1| Glycine dehydrogenase (decarboxylating), mitochondrial [Aegilops 
tauschii]
Length=1027

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +1

Query  370  MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  546
            MA  CGF +LDALIDATVP +IR   M+F  KFD G TE+QM++HM +LAS NK +KS+I
Sbjct  1    MASECGFNTLDALIDATVPAAIRAPPMQFTGKFDAGFTESQMLDHMAHLASMNKTYKSFI  60

Query  547  GMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            GMGYYNT +P VILRN+MENP WYTQYTPYQ
Sbjct  61   GMGYYNTHIPAVILRNLMENPAWYTQYTPYQ  91



>ref|XP_001755004.1| predicted protein [Physcomitrella patens]
 gb|EDQ80458.1| predicted protein [Physcomitrella patens]
Length=946

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  370  MAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIG  549
            MA  CGF  +DA+IDATVP+SIR   +K  K+  GLTE++++ H K+LASKNKV +S+IG
Sbjct  1    MAGMCGFEDMDAMIDATVPKSIRRPDLKLSKYAEGLTESELLAHFKSLASKNKVMRSFIG  60

Query  550  MGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            MGY++T VP VILRNI+ENPGWYTQYTPYQ
Sbjct  61   MGYHDTHVPTVILRNILENPGWYTQYTPYQ  90



>ref|XP_006681352.1| hypothetical protein BATDEDRAFT_20549 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77981.1| hypothetical protein BATDEDRAFT_20549 [Batrachochytrium dendrobatidis 
JAM81]
Length=1019

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 90/139 (65%), Gaps = 5/139 (4%)
 Frame = +1

Query  226  KTSGGTPAPELGFRRAI-SRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  402
            ++S   P    GF  +I +R  P S+   +P DTF RRH   +  D  KM +  G  SL+
Sbjct  40   RSSTVRPVLIAGFSTSIIARSTPSSI--FEPLDTFARRHIGPSSADVQKMCKVVGVDSLE  97

Query  403  ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  582
            AL+  TVP++I + ++   +   GLTE++ +  +K +ASKNKV +SYIGMGY  T  PPV
Sbjct  98   ALVAKTVPENISIQNLT--RLGPGLTESEALAEIKRIASKNKVMRSYIGMGYNGTITPPV  155

Query  583  ILRNIMENPGWYTQYTPYQ  639
            ILRNIMENPGWYTQYTPYQ
Sbjct  156  ILRNIMENPGWYTQYTPYQ  174



>gb|ESA20942.1| hypothetical protein GLOINDRAFT_343379 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX62240.1| glycine decarboxylase subunit P [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX62241.1| glycine decarboxylase subunit P [Rhizophagus irregularis DAOM 
197198w]
Length=1019

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFD  468
            P   +A  P DTFPRRHN  +  +   M E      ++ L+  TVP +IR  S      +
Sbjct  61   PLKYDAFSPLDTFPRRHNGPSDTEIKAMLETIDVKDMEELVLKTVPANIR--SKDALALE  118

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             GLTE++++E +K +ASKNKV+KSYIGMGY NT VP VILRNI+E+PGWYTQYTPYQ
Sbjct  119  EGLTESELMERLKRIASKNKVYKSYIGMGYANTIVPSVILRNILESPGWYTQYTPYQ  175



>ref|WP_014435168.1| glycine dehydrogenase [Caldilinea aerophila]
 dbj|BAM01948.1| glycine dehydrogenase [decarboxylating] [Caldilinea aerophila 
DSM 14535 = NBRC 104270]
Length=962

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 8/117 (7%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS---MKFPKFD  468
            +E LKP DTFPRRH   +P D  +M E  G  SLDALID  VP  IRL     ++ P+  
Sbjct  7    IELLKPLDTFPRRHLGPSPFDIERMVEVLGVESLDALIDEAVPPQIRLKEPLHLEPPR--  64

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +E++++  +++LAS N+V++S+IGMGYY T  P VI RNI+ENPGWYTQYTPYQ
Sbjct  65   ---SESEVLAELRSLASHNRVYRSFIGMGYYGTLTPGVIQRNILENPGWYTQYTPYQ  118



>ref|WP_009768707.1| glycine dehydrogenase, decarboxylating [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ67914.1| glycine dehydrogenase, decarboxylating [Oscillatoriales cyanobacterium 
JSC-12]
Length=995

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  486
            L  +D+F  RH     ED ++M    G+ +LD LIDATVPQSIRL S    K + G  E 
Sbjct  45   LDYTDSFADRHIGPNQEDIAQMLNVLGYSNLDTLIDATVPQSIRLKSPL--KLEAGKAEY  102

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            Q+++ +K +A +N+VF+SYIGMGY N   PPVI RNI+ENPGWYTQYTPYQ
Sbjct  103  QLLQELKEIAQENQVFRSYIGMGYSNCITPPVIQRNILENPGWYTQYTPYQ  153



>gb|KFH65627.1| glycine dehydrogenase [Mortierella verticillata NRRL 6337]
Length=1018

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +1

Query  268  RAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  447
            R+I    P +     P DTF RRHN  +  +  +M    G   +D L   T+P  IR  S
Sbjct  45   RSIHTEKPPARTVFSPLDTFVRRHNGPSQGEIKEMLSAIGLKDMDGLTGKTIPDRIR--S  102

Query  448  MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQY  627
             +    DHG TE +++E +K +ASKNK+FK+YIGMGY +  VP VILRN+MENPGWYTQY
Sbjct  103  TRALALDHGFTEKEVLERLKYIASKNKLFKNYIGMGYTDVVVPNVILRNVMENPGWYTQY  162

Query  628  TPYQ  639
            TPYQ
Sbjct  163  TPYQ  166



>ref|WP_039830229.1| glycine dehydrogenase, partial [Pandoraea sp. B-6]
Length=300

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +1

Query  295  SVEALKPSDTFPRRH-NSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPK---  462
            S+  L+  D F  RH    TPE Q+ +AE  G+ S  ALIDA VP SIR D  +F +   
Sbjct  13   SLSELEQRDNFSARHIGPDTPEQQAMLAEL-GYASRAALIDAVVPASIRRDGARFAQSLG  71

Query  463  -FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             F    TE+Q +  ++ LAS+N+VFKS+IG GY NTF P VILRN++ENP WYT YTPYQ
Sbjct  72   PFAAAQTESQALAQLRALASQNQVFKSFIGQGYANTFTPGVILRNVLENPAWYTAYTPYQ  131



>ref|XP_007339769.1| glycine dehydrogenase [Auricularia delicata TFB-10046 SS5]
 gb|EJD51925.1| glycine dehydrogenase [Auricularia delicata TFB-10046 SS5]
Length=1011

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 87/147 (59%), Gaps = 8/147 (5%)
 Frame = +1

Query  223  TKTSGGTPAPELGFR-------RAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEF  381
            T  S    +P LG R       RA+S    ++     P DTF  RH      + +KM + 
Sbjct  23   TAWSRSLSSPSLGRRSGRLSGLRALSTAADYAHPVFAPLDTFVGRHIGPDAHEAAKMLQR  82

Query  382  CGFPSLDALIDATVPQSIRLDSMKFPKFDHG-LTEAQMIEHMKNLASKNKVFKSYIGMGY  558
             G+ S+DA +  TVPQ IR+ +          LTE+++++  K LA++NKVF+SYIGMGY
Sbjct  83   LGYDSMDAFVADTVPQHIRIAAAAVSNESIAPLTESELLDRAKELAAQNKVFRSYIGMGY  142

Query  559  YNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +N  VPPVILRNI+ENP WYT YTPYQ
Sbjct  143  HNAVVPPVILRNILENPAWYTPYTPYQ  169



>ref|WP_009187084.1| glycine dehydrogenase [Cecembia lonarensis]
 gb|EKB47336.1| Glycine dehydrogenase [Cecembia lonarensis LW9]
Length=965

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  483
            L PS  F  RHN  + E+ S M +  G  S+D LID T+P+SI+LD  +  PK     +E
Sbjct  5    LHPSTKFENRHNGPSQEEISMMLDAIGAASMDELIDQTIPKSIQLDRPLDLPK---AKSE  61

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            A  ++  K LASKNK+FKS+IG+GYY+T VP VILRNI+ENPGWYT YTPYQ
Sbjct  62   AAFLKDFKILASKNKIFKSFIGLGYYDTLVPGVILRNILENPGWYTAYTPYQ  113



>ref|WP_035493337.1| glycine dehydrogenase, partial [Geitlerinema sp. PCC 7105]
Length=983

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 4/118 (3%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKF  465
            P +  A  P+  F +RHN +TP+D  +M E  G+ S+D+LIDA VP  IRL   +  P+ 
Sbjct  23   PATSHATPPNLAFVQRHNGSTPQDIDRMLEILGYDSIDSLIDAIVPAQIRLKQPLNLPQ-  81

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               L+EAQ ++ ++ +A KN++F+S+IG GY+++  PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   --PLSEAQALQQLRAIAQKNQIFRSFIGTGYHDSITPPVIQRNILENPGWYTAYTPYQ  137



>ref|WP_014772152.1| glycine dehydrogenase [Belliella baltica]
 gb|AFL84161.1| glycine dehydrogenase, decarboxylating [Belliella baltica DSM 
15883]
Length=964

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  483
            L PS  F  RHN ++ ED + M E  G  S+D LID T+P+SI+L   +  P      +E
Sbjct  5    LSPSTKFENRHNGSSQEDVNMMLEKIGAASIDELIDQTIPKSIQLTKPLDLPS---AKSE  61

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            A  ++  K LASKNK+FKS+IG+GYY+T VP VILRN++ENPGWYT YTPYQ
Sbjct  62   AAFLKEFKTLASKNKIFKSFIGLGYYDTIVPGVILRNVLENPGWYTAYTPYQ  113



>ref|WP_013030982.1| glycine dehydrogenase [Sideroxydans lithotrophicus]
 gb|ADE13086.1| glycine dehydrogenase [Sideroxydans lithotrophicus ES-1]
Length=949

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +1

Query  316  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  492
            SD F  RHN  + +D   M +    PSLDALID TVP +IRL   +  P    G++E   
Sbjct  2    SDQFVNRHNGPSAQDVQAMLKKIDAPSLDALIDQTVPAAIRLRKPLNLPD---GMSEHAF  58

Query  493  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            ++H++ +A+KNK++KSYIG+GYY+T VPP I RN++ENPGWYT YTPYQ
Sbjct  59   LQHLRGIAAKNKLYKSYIGLGYYDTVVPPAIQRNVLENPGWYTAYTPYQ  107



>ref|WP_018149850.1| glycine dehydrogenase [Leeia oryzae]
Length=957

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  474
            S+  L+  D F RRH   +  DQ+KM    GF S+DAL++A VP +IR D+M  P     
Sbjct  7    SLAELEQHDDFQRRHIGPSRNDQAKMLSTLGFDSIDALMEAIVPANIRRDAMPLPG---A  63

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             TEA+++  +K +A +N++FKSYIGMGYY T  P VI RNI+ENP WYT YTPYQ
Sbjct  64   RTEAEVLAELKEIAGENQIFKSYIGMGYYGTHTPGVIQRNILENPAWYTAYTPYQ  118



>ref|WP_008624248.1| Glycine dehydrogenase [Mariniradius saccharolyticus]
 gb|EMS34672.1| Glycine dehydrogenase [Mariniradius saccharolyticus AK6]
Length=963

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 76/113 (67%), Gaps = 4/113 (4%)
 Frame = +1

Query  304  ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLT  480
            +L PS  F  RHN  +  + + M E  G  SLD LID T+P+SI+L   M  PK     T
Sbjct  4    SLNPSTRFESRHNGPSASEIAIMLEKIGAASLDELIDQTIPKSIQLGRPMDLPK---AKT  60

Query  481  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            EA  +   K LASKN++FKS+IG+GYY+T VP VILRNI+ENPGWYT YTPYQ
Sbjct  61   EASFLREFKKLASKNRIFKSFIGLGYYDTIVPGVILRNILENPGWYTAYTPYQ  113



>ref|WP_013294701.1| glycine dehydrogenase [Gallionella capsiferriformans]
 gb|ADL56799.1| glycine dehydrogenase [Gallionella capsiferriformans ES-2]
Length=949

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (72%), Gaps = 4/109 (4%)
 Frame = +1

Query  316  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  492
            +D F  RHN  + +D   M +     SLDALID T+P +IRL S +  P+   GL+E   
Sbjct  3    TDQFVNRHNGPSDKDVQDMLKAIDASSLDALIDQTIPAAIRLKSPLNLPE---GLSEHAY  59

Query  493  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            ++H++ +A+KNK++KSYIG+GYY+T +PPVI RN++ENPGWYT YTPYQ
Sbjct  60   LQHLRGIAAKNKLYKSYIGLGYYDTILPPVIQRNVLENPGWYTAYTPYQ  108



>ref|WP_035075932.1| glycine dehydrogenase [Anditalea andensis]
 gb|KEO72890.1| glycine dehydrogenase [Anditalea andensis]
Length=965

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  483
            L+PS  F  RHNS + +  ++M +  G  S++ LID TVP+SIRL+  ++ P      +E
Sbjct  5    LEPSVKFEHRHNSPSEQMVAQMLDKIGASSVEELIDQTVPKSIRLEQPLRLPA---AQSE  61

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            A  +   K LASKNK+FKSYIG+GYY+T VP VILRNI+ENPGWYT YTPYQ
Sbjct  62   AIFLRDFKKLASKNKIFKSYIGLGYYDTLVPGVILRNILENPGWYTAYTPYQ  113



>ref|WP_035628774.1| hypothetical protein, partial [Hydrogenovibrio marinus]
Length=123

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  477
            +  L  +D F +RH  +  E Q  M    G+ SL+ L+D  VP+SIR  S        GL
Sbjct  5    IADLMTTDNFSQRHIGSNNEQQQLMLSALGYNSLEQLLDGVVPKSIRRQSEM--ALGEGL  62

Query  478  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +E   +  +K +AS+N+  KS+IGMG+YNT  PPV+LRN++ENP WYT YTPYQ
Sbjct  63   SEHDALAKLKAMASQNQTIKSFIGMGFYNTLTPPVVLRNVLENPAWYTAYTPYQ  116



>ref|WP_021830956.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii]
 emb|CCQ51788.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 8502]
Length=985

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  483
            L P+D+F  RH     +D  KM +  GF SLD LIDATVPQ IRL  ++  P+     +E
Sbjct  25   LAPTDSFINRHIGPNSQDIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLILPE---AQSE  81

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   YGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  133



>ref|XP_009056743.1| hypothetical protein LOTGIDRAFT_216694 [Lottia gigantea]
 gb|ESO92602.1| hypothetical protein LOTGIDRAFT_216694 [Lottia gigantea]
Length=1025

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 3/116 (3%)
 Frame = +1

Query  295  SVEALKPS-DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
            ++E + PS D FP RH      ++  M +F G  S+D L+  TVPQ I L+  +    D 
Sbjct  41   ALEKILPSQDVFPERHIGPNEREKRDMLKFMGLQSIDELVTKTVPQDILLN--RKLDIDQ  98

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             L E Q+IEH++ +ASKN++++SYIG+GYYNT+VP  I+RNI ENPGW TQYTPYQ
Sbjct  99   PLGEHQLIEHLRGIASKNEIWRSYIGIGYYNTYVPHTIMRNIFENPGWTTQYTPYQ  154



>ref|WP_002707146.1| glycine dehydrogenase [Thiothrix nivea]
 gb|EIJ33192.1| glycine dehydrogenase (decarboxylating) beta subunit ;glycine 
dehydrogenase (decarboxylating) alpha subunit [Thiothrix nivea 
DSM 5205]
Length=960

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  486
            L+  D F  RH   +  D   M +  G  SLDALI++TVP SIRL++      D   TE 
Sbjct  7    LEQHDDFIARHIGPSDADTQAMLQTVGAESLDALINSTVPASIRLNAPL--AMDGSRTET  64

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            ++++++K LA +NKV KSYIGMGYY+T VPPVILRN++ENPGWYT YTPYQ
Sbjct  65   EVLDYLKQLAMQNKVNKSYIGMGYYDTIVPPVILRNVLENPGWYTAYTPYQ  115



>ref|WP_012627655.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
 gb|ACL44578.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
Length=996

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = +1

Query  319  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMI  495
            D F +RH    P D  +M E  G  SLD LID TVP  IRLD  +  P+   G +E++ +
Sbjct  44   DRFAQRHIGPPPHDVQQMVEDLGLDSLDELIDQTVPAPIRLDRPLDLPE---GRSESEAL  100

Query  496  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            E +K +A +N++F+S+IGMGYY  F PPVI RNI+ENPGWYTQYTPYQ
Sbjct  101  EMLKTIARQNQIFRSFIGMGYYGCFTPPVIQRNILENPGWYTQYTPYQ  148



>ref|WP_044226980.1| glycine dehydrogenase [Phaeodactylibacter xiamenensis]
 gb|KGE85945.1| glycine dehydrogenase [Phaeodactylibacter xiamenensis]
Length=961

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +1

Query  319  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMI  495
            D F  RHN  +  D  KM E  G PSLD LID TVP  IRL   M  P+    LTE   +
Sbjct  8    DQFVTRHNGVSNRDLPKMLETIGVPSLDQLIDETVPDKIRLKKEMDLPE---ALTEFDFL  64

Query  496  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              +K  A+KNKV+K+YIGMGY+ T  P VILRN+ +NPGWYTQYTPYQ
Sbjct  65   NELKRTAAKNKVYKTYIGMGYHGTITPSVILRNVFQNPGWYTQYTPYQ  112



>emb|CDH56548.1| glycine dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1016

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 85/141 (60%), Gaps = 4/141 (3%)
 Frame = +1

Query  223  TKTSGGTPAPELGFRRAISRGGPFSV--EALKPSDTFPRRHNSATPEDQSKMAEFCGFPS  396
            T  +  T AP   F R      P     +  KP DTFPRRH      D++ M +  G   
Sbjct  35   TAMARNTAAPRQMFVRLQHASKPAGATHQVFKPLDTFPRRHIGPDDADKAAMLKSIGLKD  94

Query  397  LDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVP  576
            +D L+  T+P +IR  S K      G+ E ++++ +K++ASKNKV++SYIGMGY +T VP
Sbjct  95   IDELLSKTIPPAIR--SPKALALSEGVPERELLKRLKSIASKNKVYRSYIGMGYTDTVVP  152

Query  577  PVILRNIMENPGWYTQYTPYQ  639
             VILRN++ENP WYTQYTPYQ
Sbjct  153  NVILRNVLENPAWYTQYTPYQ  173



>ref|WP_009032864.1| glycine dehydrogenase [Indibacter alkaliphilus]
Length=965

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  483
            L PS  F +RHN  +P++ ++M +     S+D LID T+P++I+L+  +  PK     TE
Sbjct  5    LTPSTKFEQRHNGPSPQEITEMLDQIQAASIDELIDQTIPKAIQLEKPLDLPK---SKTE  61

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            A  ++  K LASKNK++KS+IG+GYY+T VP VILRNI+ENPGWYT YTPYQ
Sbjct  62   ASFLKEFKKLASKNKIYKSFIGLGYYDTIVPGVILRNILENPGWYTAYTPYQ  113



>ref|WP_007581597.1| glycine dehydrogenase [Burkholderia terrae]
 gb|EIN00160.1| glycine dehydrogenase [Burkholderia terrae BS001]
Length=976

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +P++IR  D++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDTADQQSMLEALGFASRAALMDAVIPKTIRRQDALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYNT  P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNTHTPAVILRNVLENPAWYTAYTPYQ  131



>ref|WP_015130859.1| glycine dehydrogenase [Calothrix sp. PCC 7507]
 gb|AFY35062.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 7507]
Length=980

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +1

Query  310  KPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEA  486
            K S+ F +RH   + +D  +M E  G P+LDALI+ TVPQ+IRL  S++ P      +E 
Sbjct  22   KSSNNFAQRHIGPSSDDIQQMLEVLGIPNLDALINQTVPQAIRLHQSLQLPTAQ---SEY  78

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              +  +K LA+KN+VF+S+IGMGYY+   PPVI RNI+ENPGWYT YTPYQ
Sbjct  79   AALAKLKQLATKNQVFRSFIGMGYYDCVTPPVIARNILENPGWYTAYTPYQ  129



>ref|WP_040728598.1| glycine dehydrogenase [Thiomicrospira sp. Kp2]
Length=972

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 78/115 (68%), Gaps = 2/115 (2%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  474
            ++E L+ S++F +RH      +Q  M +  G  S+D L++  +PQSIR  ++   + ++G
Sbjct  5    TLEELQQSESFVKRHLGPDATEQQAMLDLLGMASIDELLEKVIPQSIRRRALM--ELENG  62

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            LTE Q +  +K +AS+N+V KSYIGMGYYNT  PP I RNI+ENP WYT YTPYQ
Sbjct  63   LTEHQSLAKLKAIASQNRVLKSYIGMGYYNTHTPPTIQRNILENPAWYTAYTPYQ  117



>ref|XP_007270989.1| glycine dehydrogenase [Fomitiporia mediterranea MF3/22]
 gb|EJC98691.1| glycine dehydrogenase [Fomitiporia mediterranea MF3/22]
Length=1010

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = +1

Query  310  KPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEA  486
            KP DTF  RH      +Q  M    GF S+DA +DA+VP SIRL +        H  +E+
Sbjct  45   KPLDTFTERHIGPNESEQKMMLGALGFESMDAFVDASVPPSIRLPAGTMDDAVIHSFSES  104

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +++   ++LA KNK FKSYIGMGY+N  VPPVILRNI+ENP WYT YTPYQ
Sbjct  105  ELLRRARDLAKKNKPFKSYIGMGYHNAVVPPVILRNIIENPAWYTPYTPYQ  155



>ref|WP_002694452.1| glycine dehydrogenase [Microscilla marina]
 gb|EAY30753.1| glycine dehydrogenase [Microscilla marina ATCC 23134]
Length=969

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQ-SKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKFDHGLT  480
            L+ S+ F +RHNS+  EDQ ++M +  G  S+DALID T+P +IR   ++  P     LT
Sbjct  5    LQYSEKFEQRHNSSATEDQIAEMLKTVGEASVDALIDKTIPAAIRKQQALNLPD---ALT  61

Query  481  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            E Q +   K LA KNKVF SYIG GYY+  VP VILRN++ENPGWYT YTPYQ
Sbjct  62   EHQFLAEFKQLAQKNKVFTSYIGQGYYDCIVPNVILRNVLENPGWYTAYTPYQ  114



>ref|WP_021833183.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii]
 emb|CCQ56429.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0005]
Length=800

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  483
            L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ IRL  ++  P+     +E
Sbjct  25   LAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLILPE---AQSE  81

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   YGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  133



>ref|WP_012402353.1| glycine dehydrogenase [Burkholderia phymatum]
 gb|ACC72175.1| glycine dehydrogenase [Burkholderia phymatum STM815]
Length=976

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +PQ+IR  D++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDGADQQSMLEALGFASRAALMDAVIPQAIRRQDALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   GQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPAVILRNVLENPAWYTAYTPYQ  131



>ref|WP_024850811.1| glycine dehydrogenase [Thiomicrospira kuenenii]
Length=950

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  477
            +  L  +D F +RH  +  E Q  M    G+ SL+AL+DA VPQSIR  S       +GL
Sbjct  5    IAGLMKNDDFSQRHIGSNTEQQQAMLSALGYDSLEALLDAIVPQSIRRQSSM--ALGNGL  62

Query  478  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +E   +E +K++A KN+  KS+IGMG+YNT  PPV+LRN++ENP WYT YTPYQ
Sbjct  63   SEHDALEKLKSMADKNQSVKSFIGMGFYNTLTPPVVLRNVLENPAWYTAYTPYQ  116



>ref|XP_004343370.1| glycine dehydrogenase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE97008.1| glycine dehydrogenase [Capsaspora owczarzaki ATCC 30864]
Length=1029

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPE-DQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTE  483
            L+P D+F RRH   T E D   M + C   SL+ LID T+P  IRL   +        +E
Sbjct  78   LEPLDSFERRHIGVTTESDVKTMLDACKVDSLEQLIDKTIPAGIRLH--RELAIGAAQSE  135

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            + + + +K++AS+NK+F+SYIGMGYYNT  PPVI RN++ENPGWYTQYTPYQ
Sbjct  136  STLHKTLKSIASENKIFRSYIGMGYYNTLTPPVIQRNVIENPGWYTQYTPYQ  187



>ref|WP_007096761.1| glycine dehydrogenase [Kordia algicida]
 gb|EDP97713.1| glycine dehydrogenase (decarboxylating), glycine cleavage system 
P-protein [Kordia algicida OT-1]
Length=948

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 4/109 (4%)
 Frame = +1

Query  316  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQM  492
            +D+F  RHN    +D   M +  G  SL+ LID T+P  IRL +++  P+   GL+E + 
Sbjct  3    TDSFSLRHNGTRAKDVPHMLQTIGVDSLEQLIDETIPDEIRLKNALALPE---GLSENEF  59

Query  493  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            + HM+NLA  NK+FKSYIG+GY+    PPVI RNI ENPGWYT YTPYQ
Sbjct  60   LSHMQNLAGHNKIFKSYIGLGYHEAVTPPVIQRNIFENPGWYTAYTPYQ  108



>ref|WP_012166094.1| glycine dehydrogenase [Acaryochloris marina]
 gb|ABW30892.1| glycine dehydrogenase [Acaryochloris marina MBIC11017]
Length=984

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTE  483
            LKPSDTF  RH   +  D ++M +      L+ALIDA VP  IRL   K P K  H   E
Sbjct  31   LKPSDTFAHRHIGPSESDINQMLDTMNVEDLEALIDAAVPTQIRL---KQPLKLGHERGE  87

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             ++I+ ++++A+KN++F+SYIGMGY     PPVI RNI+ENPGWYTQYTPYQ
Sbjct  88   YELIQELRSIAAKNQIFRSYIGMGYAGCITPPVIQRNILENPGWYTQYTPYQ  139



>ref|WP_035827440.1| glycine dehydrogenase [Crocosphaera watsonii]
Length=985

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  483
            L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ IRL  ++  P+     +E
Sbjct  25   LAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLILPE---AQSE  81

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   YGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  133



>emb|CCQ61793.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0401]
Length=985

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  483
            L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ IRL  ++  P+     +E
Sbjct  25   LAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLILPE---AQSE  81

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   YGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  133



>ref|WP_028471416.1| glycine dehydrogenase [Neptunomonas japonica]
Length=960

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  474
            ++  L+  + F RRH     EDQ  M E  G  SL+ LI  TVP SIRLD          
Sbjct  5    TLSELEQKNDFTRRHIGLQGEDQQAMLESLGVSSLEELITQTVPDSIRLDDA--LDMADS  62

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             TE + + ++K+LA +NKV KSYIGMGY+NT VP VILRN++ENPGWYT YTPYQ
Sbjct  63   ETEVEALAYLKSLAVQNKVNKSYIGMGYHNTLVPNVILRNVLENPGWYTAYTPYQ  117



>ref|WP_044206069.1| glycine dehydrogenase [Coleofasciculus chthonoplastes]
Length=992

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDH  471
            + + L  +D+F RRH     ED ++M E  G+ SLD LID  VP  IRL+  +  P    
Sbjct  27   AADHLLSTDSFARRHIGVNAEDVAQMLEALGYSSLDELIDVAVPSIIRLNHPLNLPPAQ-  85

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              +E   + H++++ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  86   --SEKAALAHLRDIASKNQVFRSFIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  139



>emb|CDS12383.1| hypothetical protein LRAMOSA04578 [Absidia idahoensis var. thermophila]
Length=1015

 Score =   122 bits (305),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +1

Query  301  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  480
            +  KP DTFPRRH      D++ M +  G   +D L+  T+P +IR  S K      G+ 
Sbjct  62   QVFKPLDTFPRRHIGPDDADKAAMLKSIGLKDIDELLSKTIPPAIR--SPKTLALSEGVP  119

Query  481  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            E ++++ +K++ASKNKV++SYIGMGY +T VP VILRN++ENP WYTQYTPYQ
Sbjct  120  ERELLKRLKSIASKNKVYRSYIGMGYTDTVVPNVILRNVLENPAWYTQYTPYQ  172



>ref|WP_018979919.1| glycine dehydrogenase [Saccharibacter floricola]
Length=963

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +1

Query  283  GGPFSVEALKPSDTFP--RRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  456
            GG   +    P  T P  RRHN  +P DQ +M    G  SLD L+D  VPQSIR  S+K 
Sbjct  7    GGAAPMSLCWPEQTVPFSRRHNGPSPADQQEMLRTLGLESLDELVDQVVPQSIR-PSIKG  65

Query  457  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  636
                 G++EA+ +E ++ +A KN+   S IG GYY+TF+P V++RN+MENP WYT YTPY
Sbjct  66   ASIGQGVSEAEALERLRRMARKNRPMTSMIGQGYYDTFMPSVVMRNVMENPAWYTAYTPY  125

Query  637  Q  639
            Q
Sbjct  126  Q  126



>ref|WP_018476108.1| glycine dehydrogenase [Pontibacter roseus]
Length=972

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 4/111 (4%)
 Frame = +1

Query  310  KPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEA  486
            KP+DTF  RHN    E    M +  G  SLD LI+ TVP +IRL   +  PK    L+E 
Sbjct  6    KPADTFKERHNGPDKEQMQDMLKTIGVDSLDQLIEETVPAAIRLKKPLNLPK---ALSER  62

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              ++    +A +NKV+KSYIG+GY +T +PPVILRNIMENPGWYT YTPYQ
Sbjct  63   DFLKKFGEIARQNKVYKSYIGLGYNDTIMPPVILRNIMENPGWYTAYTPYQ  113



>gb|EDX77003.1| glycine dehydrogenase [Coleofasciculus chthonoplastes PCC 7420]
Length=997

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDH  471
            + + L  +D+F RRH     ED ++M E  G+ SLD LID  VP  IRL+  +  P    
Sbjct  32   AADHLLSTDSFARRHIGVNAEDVAQMLEALGYSSLDELIDVAVPSIIRLNHPLNLPP---  88

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              +E   + H++++ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  89   AQSEKAALAHLRDIASKNQVFRSFIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  144



>ref|WP_028364014.1| glycine dehydrogenase [Burkholderia sp. UYPR1.413]
Length=976

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +P+SIR  D++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDGADQQSMLEALGFASRAALMDAVIPKSIRRQDALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   GQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>gb|KGT34387.1| glycine dehydrogenase, partial [Vibrio parahaemolyticus]
Length=197

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHG  474
            +++L   + F  RHN     DQ KM E     SLDALI  TVP +IRL+  M   +    
Sbjct  5    LQSLSTQNEFVGRHNGPKLSDQQKMLEAINAVSLDALISETVPANIRLEQPMTLAE---A  61

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +EA M+  MK  A +N+V +++IG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  62   KSEADMLATMKQFAEQNQVKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  116



>ref|WP_044145105.1| glycine dehydrogenase, partial [Aphanocapsa montana]
Length=589

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +1

Query  319  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMI  495
            D F  RHN  + +D  KM +  G  SLD LID TVP  IRL   M  P+    LTE   +
Sbjct  8    DQFVNRHNGVSNKDLPKMLDTIGVRSLDQLIDETVPDKIRLKKEMDLPE---ALTEFDFL  64

Query  496  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              +K  A+KNKV+K+YIGMGY+ T  P VILRN+ +NPGWYTQYTPYQ
Sbjct  65   NELKRTAAKNKVYKTYIGMGYHGTITPSVILRNVFQNPGWYTQYTPYQ  112



>gb|EVU15264.1| glycine cleavage system P-family protein, partial [Vibrio parahaemolyticus 
V-223/04]
Length=200

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHG  474
            +++L   + F  RHN     DQ KM E     SLDALI  TVP +IRL+  M   +    
Sbjct  5    LQSLSTQNEFVGRHNGPKLSDQQKMLEAINAVSLDALISETVPANIRLEQPMTLAE---A  61

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +EA M+  MK  A +N+V +++IG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  62   KSEADMLATMKQFAKQNQVKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  116



>ref|WP_035987447.1| glycine dehydrogenase [Burkholderia caribensis]
 gb|ETY81107.1| Glycine dehydrogenase, glycine cleavage system P protein [Burkholderia 
caribensis MBA4]
Length=976

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +P++IR  D++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDTADQQSMLEALGFASRAALMDAVIPKAIRRQDALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPAVILRNVLENPAWYTAYTPYQ  131



>ref|WP_024162626.1| Glycine dehydrogenase (decarboxylating) [Burkholderia sp. BT03]
 gb|EUC21269.1| Glycine dehydrogenase (decarboxylating) [Burkholderia sp. BT03]
Length=976

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +P++IR  D++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDTADQQSMLEALGFASRAALMDAVIPKTIRRQDALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPAVILRNVLENPAWYTAYTPYQ  131



>gb|ELS34041.1| Glycine dehydrogenase (decarboxylating) [Pseudanabaena biceps 
PCC 7429]
Length=994

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             S +AL P+D+F RRH   T  +  +M    G  SLD +ID TVP +IR  + +  +   
Sbjct  43   LSNDALAPTDSFIRRHVGVTSAEIQQMLAVIGCESLDEMIDKTVPNAIR--TRQPLQLGE  100

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               E ++++ +K +ASKN+V++SYIG GYYN   PP+I RNI+ENPGWYTQYTPYQ
Sbjct  101  ARGEYELLQELKAIASKNQVWRSYIGTGYYNCITPPIIQRNILENPGWYTQYTPYQ  156



>ref|WP_025918361.1| glycine dehydrogenase [Herminiimonas sp. CN]
Length=967

 Score =   121 bits (303),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/116 (51%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDH  471
            S+  L+  D F  RH   +  +Q  M    G+PS  ALIDA VP  IR  D++    F  
Sbjct  5    SLPQLEARDAFIARHIGPSESEQQAMLAVLGYPSRSALIDAIVPAGIRRKDALPLGPFSE  64

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +TE   +  +KNLA KN+VFKS IG GYYNTF P VILRN+ ENP WYT YTPYQ
Sbjct  65   AMTEQAALAKLKNLAGKNRVFKSMIGQGYYNTFTPGVILRNLFENPAWYTAYTPYQ  120



>ref|WP_042305123.1| glycine dehydrogenase [Burkholderia terrae]
Length=976

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +P++IR  D++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDTADQQSMLEALGFASRAALMDAVIPKTIRRQDALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPAVILRNVLENPAWYTAYTPYQ  131



>ref|WP_042302959.1| glycine dehydrogenase [Burkholderia kururiensis]
Length=983

 Score =   120 bits (302),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH       Q  M +  GF S  ALIDA +P++IR  D +    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDAAGQQAMLDALGFASRAALIDAVIPKAIRRADPLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               L+EA+ +  ++ LA+KN+VF++YIG GYYN   PPVILRN++ENP WYT YTPYQ
Sbjct  74   AQPLSEAEALAALRELANKNQVFRTYIGQGYYNAHTPPVILRNVLENPAWYTAYTPYQ  131



>ref|WP_017772230.1| glycine dehydrogenase [Burkholderia kururiensis]
Length=983

 Score =   120 bits (302),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH       Q  M +  GF S  ALIDA +P++IR  D +    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDAAGQQAMLDALGFASRAALIDAVIPKAIRRADPLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               L+EA+ +  ++ LA+KN+VF++YIG GYYN   PPVILRN++ENP WYT YTPYQ
Sbjct  74   AQPLSEAEALAALRELANKNQVFRTYIGQGYYNAHTPPVILRNVLENPAWYTAYTPYQ  131



>ref|WP_040687253.1| glycine dehydrogenase [Pseudanabaena biceps]
Length=974

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDH  471
             S +AL P+D+F RRH   T  +  +M    G  SLD +ID TVP +IR  + +  +   
Sbjct  23   LSNDALAPTDSFIRRHVGVTSAEIQQMLAVIGCESLDEMIDKTVPNAIR--TRQPLQLGE  80

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               E ++++ +K +ASKN+V++SYIG GYYN   PP+I RNI+ENPGWYTQYTPYQ
Sbjct  81   ARGEYELLQELKAIASKNQVWRSYIGTGYYNCITPPIIQRNILENPGWYTQYTPYQ  136



>ref|WP_041919296.1| glycine dehydrogenase [Gloeocapsa sp. PCC 7428]
Length=969

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  477
            VEA + S +F +RH  + PE+  +M +  G  +LDALID TVPQ+IRL+  +  + +   
Sbjct  6    VEAAQESFSFAQRHIGSKPEEIQQMLDELGLATLDALIDQTVPQAIRLN--RPLQLEPAQ  63

Query  478  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +E   +  +K +ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  64   SEYAALAKLKEIASKNQVFRSFIGMGYHDCVTPPVIQRNILENPGWYTAYTPYQ  117



>ref|WP_035151567.1| glycine dehydrogenase [Calothrix sp. 336/3]
 gb|KFB82829.1| glycine dehydrogenase [Calothrix sp. 336/3]
Length=964

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 4/109 (4%)
 Frame = +1

Query  316  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQM  492
            S  FP RH   + ED  +M +  G  SLD LI  TVPQ IRL  S+  P      +E   
Sbjct  26   SSDFPARHIGVSTEDIPQMLDVLGVASLDDLISKTVPQGIRLAQSLNLPA---AKSEYAA  82

Query  493  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            ++H+K +AS+NK+++S+IGMGYY+T  P VILRNI+ENPGWYT YTPYQ
Sbjct  83   LQHLKEIASQNKIYRSFIGMGYYDTITPTVILRNILENPGWYTAYTPYQ  131



>ref|WP_044171749.1| glycine dehydrogenase [Oscillatoria sp. PCC 10802]
Length=977

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  483
            L P+D+F RRH    P++  +M E  G PSLDALI+ TVP +IRL   ++ P      +E
Sbjct  23   LAPADSFVRRHIGPRPDEIRQMLEVLGVPSLDALIEKTVPAAIRLKQPLQLPAAG---SE  79

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K +ASKN++F+S+ G GY++   PPVILRNI+ENPGWYT YTPYQ
Sbjct  80   YAALAQLKEIASKNEIFRSFTGTGYHDCITPPVILRNILENPGWYTAYTPYQ  131



>gb|AFZ32122.1| Glycine dehydrogenase (decarboxylating) [Gloeocapsa sp. PCC 7428]
Length=979

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  477
            VEA + S +F +RH  + PE+  +M +  G  +LDALID TVPQ+IRL+  +  + +   
Sbjct  16   VEAAQESFSFAQRHIGSKPEEIQQMLDELGLATLDALIDQTVPQAIRLN--RPLQLEPAQ  73

Query  478  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +E   +  +K +ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  74   SEYAALAKLKEIASKNQVFRSFIGMGYHDCVTPPVIQRNILENPGWYTAYTPYQ  127



>ref|WP_019586329.1| glycine dehydrogenase [Deinococcus apachensis]
Length=953

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  486
            L  +D F RRH   +  +Q++M    G  SLD L+++T+P+SIR +     +    +TEA
Sbjct  7    LMQTDEFTRRHIGPSEAEQAEMLAALGVSSLDELVESTLPESIRFEGEL--QVGGPVTEA  64

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            Q +  +K +A+KNKVF+SYIGMGYY T VPPVI RN++ENPGWYT YTPYQ
Sbjct  65   QALADLKAVAAKNKVFRSYIGMGYYGTHVPPVIGRNMLENPGWYTAYTPYQ  115



>ref|WP_009544701.1| MULTISPECIES: glycine dehydrogenase [Cyanothece]
 gb|ACB51957.1| glycine cleavage system protein P [Cyanothece sp. ATCC 51142]
Length=985

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  483
            L P+D+F  RH     ++  KM +  GF +L+ LIDATVPQ IRL  S+  P+     +E
Sbjct  25   LAPTDSFINRHIGPNRQEIDKMLKMLGFSTLEQLIDATVPQGIRLSKSLNLPE---AQSE  81

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   YGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  133



>ref|WP_027857624.1| glycine dehydrogenase [Marinobacterium jannaschii]
Length=963

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 71/111 (64%), Gaps = 2/111 (2%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  486
            L+  + F RRH      +Q  M E  G  +LD LI  TVP SIRLD       D G++E+
Sbjct  11   LEQRNEFTRRHVGPDAAEQQAMLETLGVNTLDELIAQTVPDSIRLDDAL--DMDLGISES  68

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              +  ++ +A KN V KSYIGMGYYNT VP VILRN+MENPGWYT YTPYQ
Sbjct  69   DALAELRAMADKNTVNKSYIGMGYYNTKVPNVILRNVMENPGWYTAYTPYQ  119



>ref|XP_010875485.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Esox lucius]
Length=1028

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +1

Query  298  VEALKPS-DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  474
            +E + P  D F  RH      ++ +M EF G  S+  LI+ TVP+SIR+   +  K D  
Sbjct  62   IERILPRHDDFAERHIGPGEREKREMLEFLGLESIAQLIEDTVPESIRIQ--RSMKMDDP  119

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            L E +++EH++ +ASKNKV++SYIGMGYYN  VPPVI RN++EN GW TQYTPYQ
Sbjct  120  LCENEVLEHLQKIASKNKVWRSYIGMGYYNCSVPPVIQRNLLENSGWVTQYTPYQ  174



>ref|WP_017294248.1| glycine dehydrogenase [Geminocystis herdmanii]
Length=979

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +1

Query  307  LKPS---DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHG  474
            L+PS   DTF  RH       Q  M E  G+ SLD+LID  VP+SIRL + +K P+    
Sbjct  23   LQPSMMEDTFKHRHLGVDRTAQQLMLETLGYDSLDSLIDTAVPESIRLHNPLKLPQ---P  79

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            LTE Q +  +K++A +NKV++SYIGMGYYN   P VI RNI+ENP WYT YTPYQ
Sbjct  80   LTETQALNQLKSIAQQNKVYRSYIGMGYYNCITPAVIQRNILENPNWYTAYTPYQ  134



>ref|WP_012410110.1| glycine dehydrogenase [Nostoc punctiforme]
 sp|B2J427.1|GCSP_NOSP7 RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Nostoc punctiforme PCC 73102]
 gb|ACC82139.1| glycine dehydrogenase [Nostoc punctiforme PCC 73102]
Length=979

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +1

Query  322  TFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMIE  498
            +F  RH     +D  +M +  GFPSLDALID TVPQ+IRL   +K P+ +   +E   + 
Sbjct  25   SFAPRHIGPNSDDIQQMLKVLGFPSLDALIDKTVPQTIRLKQPLKLPEAE---SEYAALA  81

Query  499  HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +K +A+KN+VF+SYIGMGYY+T  P VI RNI+ENPGWYT YTPYQ
Sbjct  82   SLKKIAAKNQVFRSYIGMGYYDTITPLVIGRNILENPGWYTAYTPYQ  128



>ref|WP_031817094.1| glycine dehydrogenase, partial [Vibrio parahaemolyticus]
Length=224

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHG  474
            +++L   + F  RHN     DQ KM E     SLDALI  TVP +IRL+  M   +    
Sbjct  5    LQSLSTQNEFVGRHNGPKLSDQQKMLEAINAVSLDALISETVPANIRLEQPMTLAE---A  61

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +EA M+  MK  A +N+V +++IG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  62   KSEADMLATMKQFAEQNQVKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  116



>ref|WP_008692424.1| glycine dehydrogenase [Rhodopirellula maiorica]
 gb|EMI22017.1| glycine dehydrogenase [Rhodopirellula maiorica SM1]
Length=623

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDH  471
            +  A+   D F RRH  ++  + ++M +  GF SLDAL DATVP  IRLD+ +  P    
Sbjct  15   ATNAIDFVDGFARRHIGSSETELAEMLKLLGFDSLDALSDATVPADIRLDAPLDIPD---  71

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               E + ++ +K +ASKNK+++S IGMGY  T  PPVILRN++ENPGWYTQYTPYQ
Sbjct  72   PRGERECLQGLKAIASKNKMYRSCIGMGYTGTVTPPVILRNVLENPGWYTQYTPYQ  127



>ref|WP_039413576.1| glycine dehydrogenase [Pandoraea pulmonicola]
 gb|AJC23149.1| glycine dehydrogenase [Pandoraea pulmonicola]
Length=972

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 77/120 (64%), Gaps = 6/120 (5%)
 Frame = +1

Query  295  SVEALKPSDTFPRRH-NSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPK---  462
            S+  L+  D F  RH    TPE Q+ +AE  G+ S  ALIDA VP SIR D  +F     
Sbjct  7    SLAELEQRDNFSARHIGPDTPEQQAMLAEL-GYASRAALIDAVVPASIRRDGKQFAATLG  65

Query  463  -FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             F    TE+Q +  ++ LA +N+VFKS+IG GYYNTF P VILRN++ENP WYT YTPYQ
Sbjct  66   PFAAPKTESQALAQLRELADRNQVFKSFIGQGYYNTFTPGVILRNVLENPAWYTAYTPYQ  125



>ref|WP_044179699.1| glycine dehydrogenase [Photobacterium damselae]
Length=957

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 72/108 (67%), Gaps = 4/108 (4%)
 Frame = +1

Query  319  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQMI  495
            +TF  RHN  T E Q  M    G  SLD LID TVP +IRL   ++ PK    + E  ++
Sbjct  11   NTFVNRHNGPTLEQQQTMLAAIGVDSLDQLIDQTVPANIRLPQPLQLPK---AINEEMLL  67

Query  496  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            + +K++A KN + KSYIG GYYNT+ P VILRNI+ENPGWYT YTPYQ
Sbjct  68   QQLKHIAQKNIINKSYIGQGYYNTYTPSVILRNILENPGWYTAYTPYQ  115



>ref|WP_044451621.1| glycine dehydrogenase, partial [Mastigocladus laminosus]
 gb|KIY11150.1| glycine dehydrogenase, partial [Mastigocladus laminosus UU774]
Length=736

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 4/118 (3%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKF  465
            P   E+ + S  F +RH     +D  +M +  G  S+DALI+ TVPQSIRL  ++  P+ 
Sbjct  14   PILGESTEKSSDFKQRHIGPNADDMQQMLDLLGVSSVDALINQTVPQSIRLSRALNLPE-  72

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               L+E   +  +K++A KN++F+S+IGMGYY+T  P VI RNI+ENPGWYT YTPYQ
Sbjct  73   --ALSEYAAVAKLKDIALKNQIFRSFIGMGYYDTITPAVIQRNILENPGWYTAYTPYQ  128



>ref|WP_028946840.1| glycine dehydrogenase [Synechocystis sp. PCC 6714]
 gb|AIE72693.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Synechocystis sp. PCC 6714]
Length=984

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 75/114 (66%), Gaps = 4/114 (4%)
 Frame = +1

Query  301  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  477
            E L P++ F  RH      +Q +M +  GF SL  LID  VPQ+IRL  S+K P      
Sbjct  27   EKLAPAEAFVDRHLGPGEGEQQQMLQELGFQSLGELIDQAVPQAIRLHGSLKLPSPQ---  83

Query  478  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             E   I  +K++ASKN+VF+SYIGMGYY+T  PPVI RNI+ENPGWYT YTPYQ
Sbjct  84   GEYGAIAQLKSIASKNQVFRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPYQ  137



>gb|EJK45128.1| hypothetical protein THAOC_36273 [Thalassiosira oceanica]
Length=1020

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = +1

Query  268  RAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  447
            R I        +AL  +DTF RRH     ED   M +  GF S ++L+++TVP +I   S
Sbjct  30   RTIHSTSVACADALDMADTFSRRHLGPAEEDTKVMLQSIGFDSFESLVNSTVPANIL--S  87

Query  448  MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQY  627
             K    +  L+E + ++ +K++A KN V KSYIGMGYY+T VP VILRN++ENPGWYT Y
Sbjct  88   GKELNLEPALSETEALKRIKSMADKNTVMKSYIGMGYYDTIVPNVILRNMLENPGWYTAY  147

Query  628  TPYQ  639
            TPYQ
Sbjct  148  TPYQ  151



>ref|WP_019556676.1| glycine dehydrogenase [Thiomicrospira arctica]
Length=973

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 76/123 (62%), Gaps = 4/123 (3%)
 Frame = +1

Query  274  ISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSM  450
            +S+    S+E L+ SD F  RH     ++Q  M       SL+ L+D  VP SIR  D M
Sbjct  6    LSQLADCSLEELQQSDKFITRHLGPDDDEQLAMLRSLKMASLNELLDKVVPSSIRRHDPM  65

Query  451  KFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYT  630
               +   GLTE Q +E +K +ASKN V KSYIGMGYYNTF PP I RNI+ENP WYT YT
Sbjct  66   DLAE---GLTEQQSLEKLKAIASKNIVLKSYIGMGYYNTFTPPTIQRNILENPAWYTAYT  122

Query  631  PYQ  639
            PYQ
Sbjct  123  PYQ  125



>ref|WP_005365623.1| glycine dehydrogenase [Photobacterium angustum]
 gb|EAS66237.1| glycine dehydrogenase [Photobacterium angustum S14]
Length=959

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  474
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  118



>gb|KJG15141.1| glycine dehydrogenase [Photobacterium angustum]
 gb|KJG24771.1| glycine dehydrogenase [Photobacterium angustum]
Length=959

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  474
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  118



>ref|WP_010472943.1| glycine dehydrogenase [Acaryochloris sp. CCMEE 5410]
Length=984

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  486
            LKPSDTF  RH   +  D ++M +      L+ALIDA VP  IRL       ++ G  E 
Sbjct  31   LKPSDTFAHRHIGPSESDINQMLDTMNVEDLEALIDAAVPAQIRLKQPLKLGYERG--EY  88

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            ++I+ ++++A+KN++F+SYIGMGY     PPVI RNI+ENPGWYTQYTPYQ
Sbjct  89   ELIQELRSIAAKNQIFRSYIGMGYAGCITPPVIQRNILENPGWYTQYTPYQ  139



>ref|WP_006643852.1| glycine dehydrogenase [Photobacterium sp. SKA34]
 gb|EAR53855.1| glycine dehydrogenase [Photobacterium sp. SKA34]
Length=959

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  474
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  118



>gb|KJF83041.1| glycine dehydrogenase [Photobacterium damselae subsp. damselae]
 gb|KJG47351.1| glycine dehydrogenase [Photobacterium angustum]
 gb|KJG49422.1| glycine dehydrogenase [Photobacterium angustum]
Length=959

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  474
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  118



>gb|KJG39760.1| glycine dehydrogenase [Photobacterium angustum]
Length=959

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  474
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  118



>ref|WP_013340914.1| glycine dehydrogenase [Burkholderia sp. CCGE1003]
 gb|ADN59370.1| glycine dehydrogenase [Burkholderia sp. CCGE1003]
Length=978

 Score =   119 bits (299),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 73/118 (62%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +PQ+IR  + +    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDSADQQAMLEALGFASRAALIDAVIPQTIRRTEPLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>ref|WP_026736448.1| glycine dehydrogenase [Fischerella sp. PCC 9605]
Length=973

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 4/114 (4%)
 Frame = +1

Query  301  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGL  477
            E+ + S  F  RH     +D  +M    G  SLDALID TVPQSIRL   +K P+    L
Sbjct  18   ESTQKSSNFKERHIGPNADDIQQMLAVLGISSLDALIDQTVPQSIRLSRPLKLPE---AL  74

Query  478  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +E   +  +K +A KN+VF+S+IGMGYY+T  P VI RNI+ENPGWYT YTPYQ
Sbjct  75   SEYAALTKLKEIALKNQVFRSFIGMGYYDTITPAVIQRNILENPGWYTAYTPYQ  128



>ref|WP_044106198.1| glycine dehydrogenase [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17488.1| glycine dehydrogenase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=984

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  483
            LK +D+F +RH  A  E+  +M +  GF +L+ LI+AT+P+SIR+   +K P      +E
Sbjct  25   LKTTDSFVKRHIGANKEEIKQMLKVLGFSTLEQLIEATIPKSIRMSQPLKLPASQ---SE  81

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K++ASKN++++S+IGMGYY++  PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   YAALVQLKSIASKNQIYRSFIGMGYYDSITPPVIQRNILENPGWYTAYTPYQ  133



>ref|WP_015145532.1| glycine dehydrogenase, decarboxylating [Pleurocapsa minor]
 gb|AFY79234.1| glycine dehydrogenase, decarboxylating [Pleurocapsa sp. PCC 7327]
Length=987

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 84/127 (66%), Gaps = 5/127 (4%)
 Frame = +1

Query  265  RRAISRGGPFSVE-ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  441
            R+   R  P S E +L P+D+F +RH   +P +  +M E  GF SL+ L++ TVP +IRL
Sbjct  10   RQTNQRQQPLSPETSLAPTDSFVKRHIGPSPNEIEQMLEVLGFSSLEQLVEKTVPAAIRL  69

Query  442  DS-MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWY  618
               ++ P+     +E   +  +K++ASKN++F+SYIGMGYY+   P VI RNI+ENPGWY
Sbjct  70   AQPLQLPE---AQSEYAALAQLKSIASKNEIFRSYIGMGYYDCITPSVIERNILENPGWY  126

Query  619  TQYTPYQ  639
            T YTPYQ
Sbjct  127  TAYTPYQ  133



>ref|WP_007306344.1| glycine dehydrogenase [Crocosphaera watsonii]
 gb|EAM49945.1| Glycine cleavage system P-protein [Crocosphaera watsonii WH 8501]
Length=985

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  483
            L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ I L  ++  P+     +E
Sbjct  25   LAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIHLSKTLILPE---AQSE  81

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   YGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  133



>ref|WP_008684764.1| glycine dehydrogenase [Rhodopirellula sallentina]
 gb|EMI53503.1| glycine dehydrogenase [Rhodopirellula sallentina SM41]
Length=990

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 75/116 (65%), Gaps = 4/116 (3%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDH  471
            +  A+   D F RRH   +  DQ+ M    GF SLDAL DATVP  IRLD  +  P    
Sbjct  19   TTNAIDFVDGFARRHIGPSDRDQAAMLGTLGFDSLDALSDATVPADIRLDEPLDIPD---  75

Query  472  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               E + ++ ++ +ASKNKV++S IGMGY  T  PPVILRN++ENPGWYTQYTPYQ
Sbjct  76   PRGERETLQGLRTIASKNKVYRSCIGMGYTGTVTPPVILRNVLENPGWYTQYTPYQ  131



>ref|WP_028220613.1| glycine dehydrogenase [Burkholderia oxyphila]
Length=987

 Score =   119 bits (299),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFD  468
             S+ AL+  D F  RH    P DQ  M +  GF S  ALIDA +P +IR  D++    F 
Sbjct  17   LSLAALEAHDAFAARHIGPDPADQQAMLDTLGFASRAALIDAVIPAAIRRKDALPLGPFG  76

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +EA+ I  ++ LA KN+VF+SYIG GYY+T  P VILRN++ENP WYT YTPYQ
Sbjct  77   EPRSEAEAIAALRALADKNQVFRSYIGQGYYDTHTPAVILRNVLENPAWYTAYTPYQ  133



>ref|WP_015784226.1| glycine dehydrogenase [Cyanothece sp. PCC 8802]
 gb|ACV01421.1| glycine dehydrogenase [Cyanothece sp. PCC 8802]
Length=983

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 4/112 (4%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  483
            L P+D+F  RH     ++  +M +  GF +LD LIDATVP+SIRL   +K P+     +E
Sbjct  25   LAPTDSFINRHIGPNSDEIDQMLKVLGFSTLDQLIDATVPESIRLSQPLKLPEPQ---SE  81

Query  484  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               +  +K++ASKN++++S+IGMGYY+   PPVI RNI+ENPGWYT YTPYQ
Sbjct  82   YGALAQLKSIASKNQIYRSFIGMGYYDCITPPVIQRNILENPGWYTAYTPYQ  133



>ref|WP_025598176.1| glycine dehydrogenase [Burkholderia sp. WSM2230]
Length=979

 Score =   119 bits (299),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 73/118 (62%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +PQ+IR  + +    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDSADQHAMLEALGFASRAALIDAVIPQTIRRTEPLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>ref|WP_039743276.1| glycine dehydrogenase [Hassallia byssoidea]
 gb|KIF35727.1| glycine dehydrogenase [Hassallia byssoidea VB512170]
Length=1019

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 4/111 (4%)
 Frame = +1

Query  310  KPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEA  486
            + S  FP RH     +D  +M E  G  +LD LID TVPQ+IRL  S++ P+    L+E 
Sbjct  21   QKSSNFPERHIGPNCDDIQQMLELLGISNLDTLIDKTVPQAIRLKQSLQLPE---ALSEY  77

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              +  +K +A KN+V++S+IGMGYY+   PPVI RNI+ENPGWYT YTPYQ
Sbjct  78   AALAKLKQIAVKNEVYRSFIGMGYYDCITPPVIQRNILENPGWYTAYTPYQ  128



>ref|WP_012434789.1| glycine dehydrogenase [Burkholderia phytofirmans]
 sp|B2T7I8.1|GCSP_BURPP RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Burkholderia phytofirmans PsJN]
 gb|ACD18269.1| glycine dehydrogenase [Burkholderia phytofirmans PsJN]
Length=978

 Score =   119 bits (298),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +P++IR  +++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDAADQHAMLEALGFASRAALIDAVIPKTIRRTETLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   TQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>ref|WP_019499546.1| glycine dehydrogenase [Pseudanabaena sp. PCC 6802]
Length=1041

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +1

Query  295  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS---MKFPKF  465
            S +   P+DTF  RH  + PE+  +M    GF  LDALID  VP SIR      +  P  
Sbjct  34   STDPFVPTDTFVHRHIGSNPEEIQQMLASMGFDDLDALIDKAVPPSIRQKQPLKLGDPGV  93

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              G  E +++E +K +ASKN++ +S+IGMGY+N   PPVI RNI+ENPGWYTQYTPYQ
Sbjct  94   QRG--ERELLEELKAIASKNQLCRSFIGMGYHNCITPPVIQRNILENPGWYTQYTPYQ  149



>dbj|GAL17115.1| glycine dehydrogenase [Vibrio maritimus]
Length=298

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  477
            + +L   + F  RHN     DQ KM +     +LD LID TVP  IRL+  +    D  +
Sbjct  5    LNSLSTQNEFVARHNGPNKSDQQKMLDAINVLNLDTLIDETVPAQIRLE--QPMTLDAPM  62

Query  478  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            +EA M+  MK  A  N+V +++IG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  63   SEADMLVEMKKFADLNQVKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  116



>ref|WP_020402760.1| glycine dehydrogenase [Gracilimonas tropica]
Length=964

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 71/108 (66%), Gaps = 4/108 (4%)
 Frame = +1

Query  319  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMI  495
            + F  RHN    E   KM E     SLD LID T+P+ IRL+  ++ P     L+EA  +
Sbjct  8    EVFAHRHNGPNSESIKKMLEVIKADSLDKLIDETIPEGIRLEKPLELPD---SLSEADFL  64

Query  496  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               K LAS+NK+FKS+IGMGYY+T +P VI RNI+ENPGWYT YTPYQ
Sbjct  65   AEFKKLASRNKIFKSFIGMGYYDTLMPNVIKRNILENPGWYTAYTPYQ  112



>ref|WP_018418838.1| glycine dehydrogenase [Burkholderia sp. WSM4176]
Length=978

 Score =   119 bits (298),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +P++IR  +++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDTADQQAMLEALGFASRAALIDAVIPKTIRRTETLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>ref|WP_007107330.1| glycine dehydrogenase [Glaciecola polaris]
 dbj|GAC35568.1| glycine dehydrogenase [Glaciecola polaris LMG 21857]
Length=968

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 80/117 (68%), Gaps = 4/117 (3%)
 Frame = +1

Query  292  FSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFD  468
            FS+  L+ +  F RRH   +  + ++M EF G  SLD L+  TVP+ IRL +++   +  
Sbjct  6    FSLSQLEQTQDFIRRHIGPSEAEMAEMLEFVGAESLDDLMQQTVPEGIRLPEALSVGESQ  65

Query  469  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               TEAQ + ++K++ASKNKV +SYIGMGY +T  P VILRN++ENPGWYT YTPYQ
Sbjct  66   ---TEAQALAYLKSVASKNKVHRSYIGMGYSDTLTPNVILRNVLENPGWYTAYTPYQ  119



>ref|WP_008917902.1| glycine dehydrogenase [Burkholderia sp. H160]
 gb|EEA03779.1| glycine dehydrogenase [Burkholderia sp. H160]
Length=978

 Score =   119 bits (298),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +P++IR  +++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDAADQQAMLEALGFASRAALIDAVIPKTIRRTEALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>ref|WP_037439120.1| glycine dehydrogenase [Shewanella sp. YQH10]
 gb|KFZ39174.1| glycine dehydrogenase [Shewanella sp. YQH10]
Length=962

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = +1

Query  307  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  486
            L+  D F RRH  +  E Q +M  + G  SL+ L    VP +IRL   +    D   TEA
Sbjct  9    LEQHDLFIRRHIGSDAEQQHQMLNYVGADSLEDLTAQIVPGAIRLG--RELALDDSCTEA  66

Query  487  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
              IE+++ +A KN+VFKSYIGMGYY T VP VILRN++ENPGWYT YTPYQ
Sbjct  67   AGIEYLREIADKNQVFKSYIGMGYYGTEVPNVILRNVLENPGWYTAYTPYQ  117



>ref|WP_018432467.1| glycine dehydrogenase [Burkholderia sp. JPY251]
Length=978

 Score =   119 bits (298),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +P++IR  +++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDTADQQAMLEAIGFASRAALIDAVIPKTIRRTEALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>ref|WP_042327162.1| glycine dehydrogenase [Burkholderia ginsengisoli]
Length=978

 Score =   119 bits (298),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +P++IR  +++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDSADQQAMLEALGFASRAALIDAVIPKTIRRTETLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>ref|WP_013090938.1| glycine dehydrogenase [Burkholderia sp. CCGE1002]
 gb|ADG17132.1| glycine dehydrogenase [Burkholderia sp. CCGE1002]
Length=978

 Score =   119 bits (298),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +P++IR  +++    F
Sbjct  14   PLSLAALEVHDAFAERHIGPDTADQQAMLEAIGFASRAALIDAVIPKTIRRTEALPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
                +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPYQ  131



>ref|WP_017309685.1| glycine dehydrogenase [Fischerella sp. PCC 9339]
Length=980

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 4/118 (3%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKF  465
            P   E+ + S  F +RH     +D  +M +  G  S+DALI+ TVPQSIRL  ++  P+ 
Sbjct  14   PILGESTEKSSDFKQRHIGPNADDMQQMLDLLGVSSVDALINQTVPQSIRLSRALNLPE-  72

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               L+E   +  +K++A KN++F+S+IGMGYY+T  P VI RNI+ENPGWYT YTPYQ
Sbjct  73   --ALSEYAAVAKLKDIALKNQIFRSFIGMGYYDTITPAVIQRNILENPGWYTAYTPYQ  128



>gb|KDN53552.1| putative GCV2-glycine decarboxylase P subunit [Tilletiaria anomala 
UBC 951]
Length=1080

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 81/138 (59%), Gaps = 8/138 (6%)
 Frame = +1

Query  229  TSGGTPAPELGFRRAISRGGPFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  408
             +G   AP+LG           S     P D+F  RH     +D   M E  G+  L A 
Sbjct  65   VAGTQNAPKLG-------AAEVSRSLFAPLDSFRERHLGPREKDTHFMLETLGYKDLQAF  117

Query  409  IDATVPQSIRLD-SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  585
            I   VPQ+IRLD S++ P+    L+E +++     +AS+NKVFKS IGMGY+NT VPPVI
Sbjct  118  IADAVPQNIRLDTSVESPESMRPLSENELLRRGDEIASQNKVFKSLIGMGYHNTLVPPVI  177

Query  586  LRNIMENPGWYTQYTPYQ  639
             RN++ENPGWYT YTPYQ
Sbjct  178  ARNVLENPGWYTSYTPYQ  195



>gb|EEX32328.1| glycine dehydrogenase [decarboxylating] [Vibrio coralliilyticus 
ATCC BAA-450]
Length=921

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +1

Query  298  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHG  474
            +++L   + F  RHN     DQ KM +     SLDALID TVP  IRL+  M   +    
Sbjct  5    LQSLSTQNEFVARHNGPNKSDQQKMLDAINVASLDALIDETVPAQIRLEQPMTMAE---A  61

Query  475  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
            L+EA M+  M+  A +N++ +++IG GYYNTF P VILRN++ENPGWYT YTPYQ
Sbjct  62   LSEADMLAAMREFADQNQIKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPYQ  116



>ref|WP_025404644.1| glycine dehydrogenase [Burkholderia thailandensis]
 gb|AHI64695.1| glycine dehydrogenase [Burkholderia thailandensis H0587]
Length=975

 Score =   119 bits (297),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH       Q  M +  GF S  ALIDA +P SIR  +++    F
Sbjct  14   PLSLAALETHDAFAERHIGPDAASQQAMLDTLGFASRAALIDAVIPASIRRAETLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               L+EA+ +  ++ LA KN+VF+SYIG GYY+T  P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPLSEAEALAALRELADKNQVFRSYIGQGYYDTHTPAVILRNVLENPAWYTAYTPYQ  131



>ref|WP_009906657.1| glycine dehydrogenase [Burkholderia thailandensis]
 gb|AIP64477.1| glycine dehydrogenase [Burkholderia thailandensis]
Length=975

 Score =   119 bits (297),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = +1

Query  289  PFSVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  465
            P S+ AL+  D F  RH       Q  M +  GF S  ALIDA +P SIR  +++    F
Sbjct  14   PLSLAALETHDAFAERHIGPDAASQQAMLDTLGFASRAALIDAVIPASIRRAETLPLGPF  73

Query  466  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  639
               L+EA+ +  ++ LA KN+VF+SYIG GYY+T  P VILRN++ENP WYT YTPYQ
Sbjct  74   AQPLSEAEALAALRELADKNQVFRSYIGQGYYDTHTPAVILRNVLENPAWYTAYTPYQ  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750