BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF037N03

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338076.1|  PREDICTED: aspartic proteinase nepenthesin-1...    221   5e-66   Solanum tuberosum [potatoes]
ref|XP_010060093.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    220   1e-65   Eucalyptus grandis [rose gum]
ref|XP_009588036.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    220   2e-65   Nicotiana tomentosiformis
ref|XP_007018203.1|  Eukaryotic aspartyl protease family protein        219   2e-65   
ref|XP_009770124.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    218   1e-64   Nicotiana sylvestris
ref|XP_011091829.1|  PREDICTED: aspartic proteinase nepenthesin-1       218   1e-64   Sesamum indicum [beniseed]
ref|XP_004252715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    218   2e-64   Solanum lycopersicum
ref|XP_006366418.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    217   3e-64   Solanum tuberosum [potatoes]
gb|KJB29357.1|  hypothetical protein B456_005G096500                    214   4e-63   Gossypium raimondii
ref|XP_004237984.1|  PREDICTED: aspartic proteinase nepenthesin-1...    214   4e-63   Solanum lycopersicum
emb|CDP11493.1|  unnamed protein product                                213   2e-62   Coffea canephora [robusta coffee]
ref|XP_010272925.1|  PREDICTED: aspartic proteinase nepenthesin-1...    212   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_009618058.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    209   3e-61   Nicotiana tomentosiformis
gb|EYU36857.1|  hypothetical protein MIMGU_mgv1a022460mg                209   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_009757207.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    208   5e-61   Nicotiana sylvestris
ref|XP_002283889.2|  PREDICTED: aspartic proteinase nepenthesin-1       207   2e-60   Vitis vinifera
gb|EYU42951.1|  hypothetical protein MIMGU_mgv1a027000mg                206   5e-60   Erythranthe guttata [common monkey flower]
ref|XP_010266126.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    204   2e-59   Nelumbo nucifera [Indian lotus]
gb|KJB58890.1|  hypothetical protein B456_009G230400                    203   3e-59   Gossypium raimondii
gb|ACJ85275.1|  unknown                                                 193   5e-57   Medicago truncatula
gb|KDP41467.1|  hypothetical protein JCGZ_15874                         195   9e-56   Jatropha curcas
ref|XP_003602931.1|  Aspartic proteinase nepenthesin-1                  194   1e-55   Medicago truncatula
gb|AFK46294.1|  unknown                                                 194   2e-55   Medicago truncatula
ref|XP_004501630.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   1e-54   Cicer arietinum [garbanzo]
ref|XP_004148418.1|  PREDICTED: aspartic proteinase nepenthesin-1...    192   1e-54   Cucumis sativus [cucumbers]
ref|XP_011016906.1|  PREDICTED: aspartic proteinase nepenthesin-1       192   1e-54   Populus euphratica
ref|XP_010675271.1|  PREDICTED: aspartic proteinase nepenthesin-1       191   3e-54   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAE71208.1|  hypothetical protein                                   191   3e-54   Trifolium pratense [peavine clover]
ref|XP_002302336.2|  chloroplast nucleoid DNA-binding family protein    189   2e-53   Populus trichocarpa [western balsam poplar]
gb|ACU24323.1|  unknown                                                 185   4e-53   Glycine max [soybeans]
ref|XP_003522749.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   5e-53   Glycine max [soybeans]
ref|XP_009373927.1|  PREDICTED: aspartic proteinase nepenthesin-1...    187   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_008444946.1|  PREDICTED: aspartic proteinase nepenthesin-1       186   1e-52   Cucumis melo [Oriental melon]
ref|XP_009342559.1|  PREDICTED: aspartic proteinase nepenthesin-1...    186   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_010107692.1|  Aspartic proteinase nepenthesin-1                  186   2e-52   Morus notabilis
gb|ABK95290.1|  unknown                                                 185   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_009376250.1|  PREDICTED: aspartic proteinase nepenthesin-1...    185   5e-52   Pyrus x bretschneideri [bai li]
ref|XP_007222165.1|  hypothetical protein PRUPE_ppa005789mg             182   4e-51   Prunus persica
ref|XP_003526531.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   9e-51   Glycine max [soybeans]
ref|XP_004299721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   1e-50   Fragaria vesca subsp. vesca
ref|XP_007137648.1|  hypothetical protein PHAVU_009G144100g             179   6e-50   Phaseolus vulgaris [French bean]
ref|XP_002514026.1|  Aspartic proteinase nepenthesin-1 precursor,...    175   3e-48   Ricinus communis
ref|XP_008219289.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    170   2e-46   Prunus mume [ume]
gb|ACE96805.1|  aspartyl protease                                       166   7e-46   Populus tremula [European aspen]
gb|ACE96817.1|  aspartyl protease                                       166   7e-46   Populus tremula [European aspen]
ref|XP_006841210.1|  hypothetical protein AMTR_s00135p00030880          164   3e-44   
ref|XP_008378576.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    162   2e-43   
ref|XP_007141254.1|  hypothetical protein PHAVU_008G180500g             161   5e-43   Phaseolus vulgaris [French bean]
ref|XP_006307264.1|  hypothetical protein CARUB_v10008880mg             160   2e-42   
ref|XP_006417541.1|  hypothetical protein EUTSA_v10007613mg             157   1e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010276658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010269414.1|  PREDICTED: aspartic proteinase nepenthesin-1...    156   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009110804.1|  PREDICTED: aspartic proteinase nepenthesin-1       153   5e-40   Brassica rapa
emb|CDY31067.1|  BnaA08g26170D                                          153   6e-40   Brassica napus [oilseed rape]
ref|XP_010067725.1|  PREDICTED: aspartic proteinase nepenthesin-1...    148   2e-38   Eucalyptus grandis [rose gum]
ref|XP_003519197.1|  PREDICTED: aspartic proteinase nepenthesin-1...    148   3e-38   Glycine max [soybeans]
ref|XP_003522900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    148   4e-38   Glycine max [soybeans]
gb|ACJ85302.1|  unknown                                                 144   4e-38   Medicago truncatula
ref|XP_003538263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   8e-38   Glycine max [soybeans]
ref|XP_007148927.1|  hypothetical protein PHAVU_005G025900g             146   1e-37   Phaseolus vulgaris [French bean]
gb|KFK43273.1|  hypothetical protein AALP_AA1G102700                    146   2e-37   Arabis alpina [alpine rockcress]
ref|XP_002513044.1|  Aspartic proteinase nepenthesin-1 precursor,...    146   2e-37   Ricinus communis
gb|KDP40540.1|  hypothetical protein JCGZ_24539                         145   2e-37   Jatropha curcas
gb|KJB74994.1|  hypothetical protein B456_012G018300                    145   3e-37   Gossypium raimondii
ref|XP_006432439.1|  hypothetical protein CICLE_v10001212mg             145   5e-37   Citrus clementina [clementine]
ref|XP_010458274.1|  PREDICTED: aspartic proteinase nepenthesin-1...    144   6e-37   Camelina sativa [gold-of-pleasure]
emb|CDY20675.1|  BnaC08g13830D                                          144   6e-37   Brassica napus [oilseed rape]
ref|XP_002264626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   6e-37   Vitis vinifera
gb|KHN21324.1|  Aspartic proteinase nepenthesin-1                       143   7e-37   Glycine soja [wild soybean]
gb|KJB60281.1|  hypothetical protein B456_009G297800                    144   7e-37   Gossypium raimondii
gb|AGV54394.1|  aspartic proteinase nepenthesin-1-like protein          144   8e-37   Phaseolus vulgaris [French bean]
gb|KHN26127.1|  Aspartic proteinase nepenthesin-1                       143   1e-36   Glycine soja [wild soybean]
gb|KEH40928.1|  aspartic proteinase nepenthesin-like protein            144   1e-36   Medicago truncatula
gb|EPS72919.1|  hypothetical protein M569_01840                         143   1e-36   Genlisea aurea
ref|XP_010095993.1|  Aspartic proteinase nepenthesin-1                  143   2e-36   
ref|XP_009122387.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   2e-36   Brassica rapa
emb|CDX70001.1|  BnaA10g23500D                                          143   2e-36   
emb|CDX99015.1|  BnaC09g48200D                                          143   2e-36   
ref|XP_006399181.1|  hypothetical protein EUTSA_v10013504mg             143   3e-36   Eutrema salsugineum [saltwater cress]
ref|XP_004498691.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   3e-36   Cicer arietinum [garbanzo]
ref|XP_002873291.1|  hypothetical protein ARALYDRAFT_487523             142   4e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_009130976.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   5e-36   Brassica rapa
emb|CDY58878.1|  BnaA03g55560D                                          142   5e-36   Brassica napus [oilseed rape]
ref|XP_004307094.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   7e-36   Fragaria vesca subsp. vesca
gb|KHG09833.1|  Asparticase nepenthesin-1                               141   8e-36   Gossypium arboreum [tree cotton]
dbj|BAB11161.1|  nucleoid DNA-binding-like protein                      141   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563851.1|  aspartyl protease-like protein                        141   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490295.1|  PREDICTED: aspartic proteinase nepenthesin-1...    141   1e-35   Camelina sativa [gold-of-pleasure]
ref|NP_196320.2|  aspartyl protease family protein                      140   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782021.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   3e-35   Phoenix dactylifera
ref|XP_010547361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   4e-35   Tarenaya hassleriana [spider flower]
gb|AFK39308.1|  unknown                                                 139   4e-35   Medicago truncatula
ref|XP_009593615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   5e-35   Nicotiana tomentosiformis
ref|XP_009778175.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   6e-35   Nicotiana sylvestris
ref|XP_002889768.1|  hypothetical protein ARALYDRAFT_471076             139   9e-35   
ref|XP_003627883.1|  Aspartic proteinase nepenthesin-1                  138   1e-34   Medicago truncatula
gb|AFK35790.1|  unknown                                                 138   1e-34   Medicago truncatula
gb|KJB73116.1|  hypothetical protein B456_011G215800                    135   2e-34   Gossypium raimondii
ref|XP_007010960.1|  Eukaryotic aspartyl protease family protein        137   3e-34   
ref|XP_008446966.1|  PREDICTED: aspartic proteinase nepenthesin-1       137   3e-34   Cucumis melo [Oriental melon]
gb|KFK25095.1|  hypothetical protein AALP_AA8G065800                    137   3e-34   Arabis alpina [alpine rockcress]
ref|XP_004142420.1|  PREDICTED: aspartic proteinase nepenthesin-1...    137   4e-34   Cucumis sativus [cucumbers]
ref|XP_010557871.1|  PREDICTED: aspartic proteinase nepenthesin-1...    137   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_011091849.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   5e-34   Sesamum indicum [beniseed]
ref|XP_010926983.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   5e-34   Elaeis guineensis
gb|KHG22262.1|  Asparticase nepenthesin-1                               136   6e-34   Gossypium arboreum [tree cotton]
ref|XP_010553675.1|  PREDICTED: aspartic proteinase nepenthesin-1       136   7e-34   Tarenaya hassleriana [spider flower]
gb|KJB73114.1|  hypothetical protein B456_011G215800                    136   7e-34   Gossypium raimondii
ref|XP_008348078.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   8e-34   Malus domestica [apple tree]
ref|XP_009372766.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_009380234.1|  PREDICTED: aspartic proteinase nepenthesin-1...    135   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010495094.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   2e-33   
emb|CDP17284.1|  unnamed protein product                                134   2e-33   Coffea canephora [robusta coffee]
ref|XP_006403579.1|  hypothetical protein EUTSA_v10010398mg             133   2e-33   
ref|XP_009411751.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004511040.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   3e-33   Cicer arietinum [garbanzo]
ref|XP_010452650.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   4e-33   
ref|XP_008375374.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   4e-33   Malus domestica [apple tree]
ref|XP_007218027.1|  hypothetical protein PRUPE_ppa005966mg             134   5e-33   Prunus persica
ref|XP_010938557.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   5e-33   Elaeis guineensis
ref|XP_010504244.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010515967.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   6e-33   Camelina sativa [gold-of-pleasure]
gb|EYU38286.1|  hypothetical protein MIMGU_mgv1a006610mg                133   8e-33   Erythranthe guttata [common monkey flower]
ref|XP_010475821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006403580.1|  hypothetical protein EUTSA_v10010398mg             133   8e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010427138.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   9e-33   Camelina sativa [gold-of-pleasure]
emb|CDX81031.1|  BnaC03g02850D                                          133   9e-33   
ref|XP_010423263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008231689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   1e-32   Prunus mume [ume]
ref|NP_001241567.1|  uncharacterized protein LOC100819698 precursor     132   1e-32   Glycine max [soybeans]
gb|KHN37680.1|  Aspartic proteinase nepenthesin-1                       132   2e-32   Glycine soja [wild soybean]
ref|XP_007133749.1|  hypothetical protein PHAVU_011G206100g             131   3e-32   Phaseolus vulgaris [French bean]
ref|XP_010032289.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   4e-32   Eucalyptus grandis [rose gum]
ref|XP_010523939.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_006291188.1|  hypothetical protein CARUB_v10017317mg             131   5e-32   Capsella rubella
ref|XP_011020416.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   6e-32   Populus euphratica
ref|XP_010530469.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   6e-32   Tarenaya hassleriana [spider flower]
ref|XP_006347658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   8e-32   Solanum tuberosum [potatoes]
ref|XP_010032290.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   9e-32   Eucalyptus grandis [rose gum]
ref|XP_006368623.1|  hypothetical protein POPTR_0001s06560g             130   1e-31   
gb|ABK92955.1|  unknown                                                 130   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006287717.1|  hypothetical protein CARUB_v10000927mg             130   1e-31   Capsella rubella
ref|XP_002299201.1|  aspartyl protease family protein                   130   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002303933.2|  hypothetical protein POPTR_0003s19490g             129   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_004230031.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   1e-31   Solanum lycopersicum
gb|AAM66983.1|  nucleoid DNA-binding-like protein                       128   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877976.1|  hypothetical protein ARALYDRAFT_906847             128   4e-31   Arabidopsis lyrata subsp. lyrata
gb|AES68738.2|  aspartic proteinase nepenthesin-like protein            127   7e-31   Medicago truncatula
ref|XP_009116125.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   8e-31   Brassica rapa
emb|CDX78233.1|  BnaA09g34280D                                          127   8e-31   
emb|CDY13202.1|  BnaC04g26330D                                          127   1e-30   Brassica napus [oilseed rape]
ref|NP_191008.1|  aspartyl protease family protein                      127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011000582.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   2e-30   Populus euphratica
ref|XP_009139245.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   2e-30   Brassica rapa
emb|CDX76150.1|  BnaA04g04140D                                          126   3e-30   
gb|KFK34672.1|  hypothetical protein AALP_AA5G176500                    125   3e-30   Arabis alpina [alpine rockcress]
ref|XP_002461152.1|  hypothetical protein SORBIDRAFT_02g041760          125   6e-30   Sorghum bicolor [broomcorn]
ref|XP_010670495.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001060521.1|  Os07g0658600                                       124   1e-29   
ref|XP_003598487.1|  Peptidase A1, putative                             124   1e-29   
gb|EYU42928.1|  hypothetical protein MIMGU_mgv1a0098261mg               119   2e-29   Erythranthe guttata [common monkey flower]
ref|NP_001130306.1|  uncharacterized protein LOC100191400 precursor     122   5e-29   Zea mays [maize]
ref|NP_001266528.1|  aspartic proteinase nepenthesin-1 precursor        122   1e-28   
dbj|BAJ92880.1|  predicted protein                                      120   4e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004958568.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   5e-28   Setaria italica
ref|XP_006854820.1|  hypothetical protein AMTR_s00063p00187740          119   7e-28   Amborella trichopoda
ref|XP_011088726.1|  PREDICTED: aspartic proteinase nepenthesin-1...    119   7e-28   Sesamum indicum [beniseed]
emb|CAN69536.1|  hypothetical protein VITISV_043237                     118   1e-27   Vitis vinifera
ref|XP_008803347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   2e-27   
gb|KHN13065.1|  Aspartic proteinase nepenthesin-1                       116   7e-27   Glycine soja [wild soybean]
gb|AAK44106.2|AF370291_1  unknown protein                               112   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EPS64285.1|  hypothetical protein M569_10492                         108   5e-24   Genlisea aurea
ref|XP_008806589.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   
ref|XP_003559856.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   Brachypodium distachyon [annual false brome]
emb|CAN74010.1|  hypothetical protein VITISV_003547                     103   3e-22   Vitis vinifera
dbj|BAJ04354.1|  pollen allergen CPA63                                  102   7e-22   Cryptomeria japonica
ref|XP_004170756.1|  PREDICTED: aspartic proteinase nepenthesin-1...    100   1e-21   
ref|XP_004971304.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Setaria italica
gb|ABR18297.1|  unknown                                                 101   2e-21   Picea sitchensis
gb|EEE56022.1|  hypothetical protein OsJ_04800                          100   3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645377.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   Oryza brachyantha
gb|EAY77272.1|  hypothetical protein OsI_05246                        99.8    5e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_003567490.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   6e-21   Brachypodium distachyon [annual false brome]
ref|NP_001045434.1|  Os01g0954900                                     99.8    6e-21   
gb|ACN40790.1|  unknown                                               99.4    9e-21   Picea sitchensis
ref|XP_010916666.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    6e-19   Elaeis guineensis
gb|EPS70765.1|  hypothetical protein M569_03988                       92.4    1e-18   Genlisea aurea
gb|EEE67743.1|  hypothetical protein OsJ_25435                        91.3    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010922206.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    5e-18   Elaeis guineensis
ref|XP_008656859.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    3e-16   
gb|EAY88829.1|  hypothetical protein OsI_10302                        85.1    1e-15   Oryza sativa Indica Group [Indian rice]
gb|AFG60356.1|  hypothetical protein 2_5996_01                        81.3    1e-15   Pinus taeda
gb|AFB33415.1|  hypothetical protein 2_5996_01                        81.3    1e-15   Pinus mugo [mountain pine]
ref|NP_001049205.1|  Os03g0186900                                     84.3    2e-15   
gb|AEW08302.1|  hypothetical protein 2_5996_01                        80.9    2e-15   Pinus radiata
gb|AFB33417.1|  hypothetical protein 2_5996_01                        80.9    2e-15   Pinus mugo [mountain pine]
gb|AFG60347.1|  hypothetical protein 2_5996_01                        80.5    2e-15   Pinus taeda
gb|AEW08303.1|  hypothetical protein 2_5996_01                        80.5    3e-15   Pinus lambertiana
ref|XP_009387158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003558637.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    8e-15   Brachypodium distachyon [annual false brome]
ref|XP_006649524.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    1e-14   Oryza brachyantha
dbj|BAJ99659.1|  predicted protein                                    81.6    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008795166.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.3    2e-14   Phoenix dactylifera
gb|EYU29201.1|  hypothetical protein MIMGU_mgv1a005225mg              80.9    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_010913225.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    4e-14   Elaeis guineensis
gb|ABR16115.1|  unknown                                               80.5    5e-14   Picea sitchensis
emb|CAJ26370.1|  chloroplast nucleoid binding protein                 80.1    5e-14   Brachypodium sylvaticum
ref|NP_001266543.1|  aspartic proteinase nepenthesin-1 precursor      79.7    7e-14   
gb|ACF83459.1|  unknown                                               79.7    7e-14   Zea mays [maize]
ref|NP_001131154.1|  uncharacterized protein LOC100192462 precursor   79.7    7e-14   
ref|XP_009390623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004985428.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.3    1e-13   
ref|XP_002460431.1|  hypothetical protein SORBIDRAFT_02g028000        79.3    1e-13   Sorghum bicolor [broomcorn]
ref|XP_010108295.1|  Aspartic proteinase nepenthesin-2                78.2    2e-13   
ref|XP_006287637.1|  hypothetical protein CARUB_v10000848mg           78.6    2e-13   Capsella rubella
gb|ABK24493.1|  unknown                                               78.2    3e-13   Picea sitchensis
ref|XP_008811141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.8    3e-13   Phoenix dactylifera
gb|EAZ09523.1|  hypothetical protein OsI_31798                        77.4    6e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002460430.1|  hypothetical protein SORBIDRAFT_02g027990        77.4    6e-13   Sorghum bicolor [broomcorn]
ref|XP_008452815.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.0    7e-13   Cucumis melo [Oriental melon]
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg           76.6    1e-12   Capsella rubella
ref|XP_003563922.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.9    1e-12   Brachypodium distachyon [annual false brome]
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  76.3    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.9    2e-12   Nicotiana sylvestris
ref|NP_001063501.1|  Os09g0482200                                     75.9    2e-12   
ref|XP_002885261.1|  aspartyl protease family protein                 75.9    2e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.9    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.5    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.5    2e-12   Camelina sativa [gold-of-pleasure]
gb|ACN85295.1|  aspartic proteinase nepenthesin-1 precursor           75.5    3e-12   Oryza coarctata
ref|XP_004150866.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.1    3e-12   Cucumis sativus [cucumbers]
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.7    3e-12   Phoenix dactylifera
emb|CDY24483.1|  BnaC05g34710D                                        74.7    4e-12   Brassica napus [oilseed rape]
ref|XP_006660750.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.7    4e-12   Oryza brachyantha
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1           74.7    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein     74.3    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.3    6e-12   Brassica rapa
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.9    6e-12   
ref|XP_010256102.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.3    6e-12   Nelumbo nucifera [Indian lotus]
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                  74.3    6e-12   Arabis alpina [alpine rockcress]
emb|CDX92240.1|  BnaA05g21670D                                        73.9    6e-12   
ref|XP_010928895.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.9    7e-12   Elaeis guineensis
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.9    7e-12   Brassica rapa
emb|CDY69364.1|  BnaCnng63170D                                        73.9    7e-12   Brassica napus [oilseed rape]
gb|KJB55135.1|  hypothetical protein B456_009G064900                  73.9    8e-12   Gossypium raimondii
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.6    9e-12   Brassica rapa
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg           73.6    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009390625.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    1e-11   
ref|XP_009390626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    1e-11   Elaeis guineensis
ref|NP_001041979.1|  Os01g0140100                                     73.2    1e-11   
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    1e-11   Fragaria vesca subsp. vesca
gb|EAY72467.1|  hypothetical protein OsI_00323                        73.2    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_003576664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_010928159.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.8    1e-11   Elaeis guineensis
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.8    2e-11   
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.8    2e-11   Populus euphratica
ref|XP_008377499.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.8    2e-11   
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g           72.8    2e-11   Populus trichocarpa [western balsam poplar]
emb|CDY24395.1|  BnaCnng04620D                                        72.4    2e-11   Brassica napus [oilseed rape]
ref|XP_002515387.1|  Aspartic proteinase nepenthesin-2 precursor,...  72.4    2e-11   Ricinus communis
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  72.4    2e-11   
ref|NP_001141706.1|  hypothetical protein precursor                   72.4    2e-11   Zea mays [maize]
ref|XP_010266607.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.4    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010259084.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.4    2e-11   Nelumbo nucifera [Indian lotus]
gb|KJB52970.1|  hypothetical protein B456_008G285900                  72.4    2e-11   Gossypium raimondii
ref|XP_010065986.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.0    3e-11   Eucalyptus grandis [rose gum]
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g           72.0    3e-11   Phaseolus vulgaris [French bean]
ref|XP_010913256.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.0    3e-11   Elaeis guineensis
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.0    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_008777074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    3e-11   Phoenix dactylifera
gb|KHG10166.1|  Asparticase nepenthesin-2                             72.0    3e-11   Gossypium arboreum [tree cotton]
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    4e-11   Zea mays [maize]
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504            71.6    4e-11   
gb|KJB55136.1|  hypothetical protein B456_009G065000                  71.6    4e-11   Gossypium raimondii
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016            71.6    4e-11   
ref|XP_009391129.1|  PREDICTED: aspartic proteinase nepenthesin-2...  71.6    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048            71.2    5e-11   
ref|XP_008806169.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    6e-11   
ref|XP_007011661.1|  Eukaryotic aspartyl protease family protein,...  71.2    6e-11   
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    8e-11   
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    8e-11   
gb|EAY72465.1|  hypothetical protein OsI_00321                        70.1    8e-11   
ref|XP_008379433.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    8e-11   
ref|XP_010108293.1|  Aspartic proteinase nepenthesin-2                70.9    9e-11   
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630        70.5    9e-11   
ref|XP_009363292.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    9e-11   
ref|XP_006646269.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.1    9e-11   
ref|XP_007223563.1|  hypothetical protein PRUPE_ppa014553mg           70.5    9e-11   
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    1e-10   
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    1e-10   
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    1e-10   
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135            69.7    1e-10   
emb|CDP18857.1|  unnamed protein product                              70.1    1e-10   
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134            69.7    1e-10   
ref|XP_007011664.1|  Eukaryotic aspartyl protease family protein ...  69.7    1e-10   
ref|XP_002320868.1|  aspartyl protease family protein                 70.1    1e-10   
ref|XP_006857554.1|  hypothetical protein AMTR_s00061p00053330        69.7    1e-10   
ref|XP_007011663.1|  Eukaryotic aspartyl protease family protein,...  69.7    1e-10   
emb|CAB96832.1|  nucleoid DNA-binding protein cnd41-like protein      69.7    1e-10   
ref|XP_009390624.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    2e-10   
ref|XP_011080092.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.1    2e-10   
ref|NP_196638.2|  aspartyl protease family protein                    69.7    2e-10   
ref|XP_010068511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    2e-10   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    2e-10   
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein        69.7    2e-10   
ref|XP_004959563.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    2e-10   
gb|ABK24480.1|  unknown                                               69.7    2e-10   
ref|XP_007147550.1|  hypothetical protein PHAVU_006G134200g           69.7    2e-10   
gb|KCW63888.1|  hypothetical protein EUGRSUZ_G01561                   69.3    2e-10   
ref|XP_010913226.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    2e-10   
ref|XP_007011665.1|  Eukaryotic aspartyl protease family protein,...  69.7    2e-10   
ref|XP_007011662.1|  Eukaryotic aspartyl protease family protein,...  69.3    2e-10   
emb|CDP20730.1|  unnamed protein product                              69.3    2e-10   
ref|XP_002873476.1|  hypothetical protein ARALYDRAFT_325615           69.3    2e-10   
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg           69.3    2e-10   
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    3e-10   
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900        69.3    3e-10   
ref|XP_002892074.1|  aspartyl protease family protein                 69.3    3e-10   
gb|KCW44808.1|  hypothetical protein EUGRSUZ_L01627                   68.9    3e-10   
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
ref|NP_001047956.1|  Os02g0720900                                     68.9    3e-10   
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
ref|XP_008652856.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
ref|XP_008220627.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
ref|XP_004246049.1|  PREDICTED: aspartic proteinase CDR1-like         68.9    3e-10   
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg              68.9    3e-10   
ref|NP_171637.1|  aspartyl protease family protein                    68.9    3e-10   
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative    68.9    3e-10   
ref|XP_003570481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    4e-10   
ref|XP_002468370.1|  hypothetical protein SORBIDRAFT_01g044790        68.6    4e-10   
gb|ABK25248.1|  unknown                                               68.2    4e-10   
ref|XP_009390629.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    4e-10   
emb|CDX75968.1|  BnaC03g40510D                                        68.6    4e-10   
emb|CDY46510.1|  BnaA02g27600D                                        68.6    4e-10   
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein      68.6    4e-10   
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    4e-10   
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...  68.6    5e-10   
ref|XP_010514187.1|  PREDICTED: aspartic proteinase nepenthesin-1...  68.6    5e-10   
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    5e-10   
emb|CDX82342.1|  BnaA03g34790D                                        68.6    5e-10   
ref|XP_009129037.1|  PREDICTED: aspartic proteinase nepenthesin-2...  68.2    5e-10   
ref|XP_010453111.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.2    5e-10   
ref|XP_003613583.1|  Aspartic proteinase nepenthesin-1                68.2    5e-10   
ref|XP_010502452.1|  PREDICTED: aspartic proteinase nepenthesin-2...  68.2    5e-10   
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750        68.6    5e-10   
ref|XP_008796557.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.2    5e-10   
ref|XP_010913303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.2    5e-10   
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g           68.2    5e-10   
gb|KJB55134.1|  hypothetical protein B456_009G064800                  68.2    6e-10   
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.2    6e-10   
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg           68.2    6e-10   
gb|ABR17085.1|  unknown                                               68.2    6e-10   
ref|XP_002875271.1|  hypothetical protein ARALYDRAFT_484331           68.2    6e-10   
emb|CDP19504.1|  unnamed protein product                              68.2    6e-10   
ref|NP_001154646.1|  aspartyl protease family protein                 67.4    6e-10   
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.2    6e-10   
gb|AEM05966.1|  nodulin 41                                            67.8    6e-10   
ref|XP_004965303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    7e-10   
emb|CDX90023.1|  BnaA10g00590D                                        67.8    7e-10   
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    7e-10   
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    7e-10   
ref|XP_002523993.1|  Aspartic proteinase nepenthesin-1 precursor,...  67.8    7e-10   
emb|CDY15187.1|  BnaC05g00660D                                        67.8    7e-10   
ref|XP_009411894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    7e-10   
ref|XP_001757102.1|  predicted protein                                67.4    8e-10   
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    8e-10   
ref|XP_010422809.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    8e-10   
ref|XP_003614084.1|  Aspartic proteinase nepenthesin-1                67.4    9e-10   
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    9e-10   
ref|XP_008776166.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    9e-10   
ref|XP_006395632.1|  hypothetical protein EUTSA_v10004188mg           67.4    9e-10   
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    9e-10   
gb|ACN85242.1|  aspartic proteinase nepenthesin-1 precursor           67.4    9e-10   
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    9e-10   
ref|NP_189198.1|  aspartyl protease family protein                    67.4    1e-09   
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  67.4    1e-09   
gb|KGN55408.1|  hypothetical protein Csa_4G651750                     67.0    1e-09   
emb|CDX99757.1|  BnaC02g35630D                                        67.4    1e-09   
ref|XP_010491758.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    1e-09   
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    1e-09   
ref|XP_008386742.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    1e-09   
emb|CBI21177.3|  unnamed protein product                              67.0    1e-09   
ref|XP_010066088.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    1e-09   
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039            67.4    1e-09   
ref|XP_003532147.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    1e-09   
gb|KJB37242.1|  hypothetical protein B456_006G195400                  67.0    1e-09   
gb|KCW44810.1|  hypothetical protein EUGRSUZ_L01629                   67.0    1e-09   
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    1e-09   
gb|AFG47109.1|  hypothetical protein UMN_5224_01                      63.5    1e-09   
ref|XP_004308644.1|  PREDICTED: aspartic proteinase CDR1-like         67.0    1e-09   
emb|CBI21175.3|  unnamed protein product                              66.6    1e-09   
ref|XP_010913306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.3    1e-09   
ref|XP_002285593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    1e-09   
gb|EEE57700.1|  hypothetical protein OsJ_08178                        67.0    1e-09   
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    1e-09   
gb|AAK64003.1|  AT3g61820/F15G16_210                                  66.6    1e-09   
gb|KHN16429.1|  Aspartic proteinase nepenthesin-1                     62.8    1e-09   
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    1e-09   
ref|XP_006291121.1|  hypothetical protein CARUB_v10017234mg           66.6    1e-09   
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    2e-09   
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    2e-09   
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    2e-09   
gb|ACN85264.1|  aspartic proteinase nepenthesin-1 precursor           67.0    2e-09   
ref|XP_002283470.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
gb|KEH33910.1|  eukaryotic aspartyl protease family protein           66.6    2e-09   
gb|EAZ13356.1|  hypothetical protein OsJ_03278                        66.6    2e-09   
ref|XP_009409855.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
ref|XP_010425220.1|  PREDICTED: aspartic proteinase nepenthesin-1...  66.6    2e-09   
ref|XP_010913305.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    2e-09   
gb|EAY75637.1|  hypothetical protein OsI_03542                        66.6    2e-09   
ref|XP_003637421.1|  Aspartic proteinase nepenthesin-1                65.5    2e-09   
ref|XP_004513891.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like  66.6    2e-09   
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
ref|XP_002437273.1|  hypothetical protein SORBIDRAFT_10g023970        66.6    2e-09   
ref|XP_010050794.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
gb|EYU22027.1|  hypothetical protein MIMGU_mgv1a005281mg              66.6    2e-09   
ref|XP_008220632.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
ref|XP_008220631.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    2e-09   
gb|KDO67377.1|  hypothetical protein CISIN_1g011600mg                 66.2    2e-09   
gb|EMT14793.1|  Aspartic proteinase nepenthesin-2                     66.2    2e-09   
ref|XP_002878415.1|  aspartyl protease family protein                 66.2    2e-09   
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g           66.2    2e-09   
dbj|BAJ91382.1|  predicted protein                                    66.2    2e-09   
dbj|BAK02683.1|  predicted protein                                    66.2    2e-09   
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    2e-09   
gb|KCW80528.1|  hypothetical protein EUGRSUZ_C01882                   66.2    2e-09   
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg              66.2    2e-09   
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor           66.2    2e-09   
gb|EMS50115.1|  Aspartic proteinase nepenthesin-2                     64.3    2e-09   
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    2e-09   
emb|CDX89133.1|  BnaA04g00530D                                        66.2    3e-09   
ref|XP_008805509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    3e-09   
ref|XP_004291984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    3e-09   
ref|XP_010928184.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    3e-09   
emb|CBI35120.3|  unnamed protein product                              65.5    3e-09   
dbj|BAJ97639.1|  predicted protein                                    66.2    3e-09   
ref|XP_009391801.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    3e-09   
gb|ACN85252.1|  aspartic proteinase nepenthesin-1 precursor           66.2    3e-09   
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g           66.2    3e-09   
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    3e-09   
gb|KDO67374.1|  hypothetical protein CISIN_1g011556mg                 65.9    3e-09   
gb|ACN85225.1|  aspartic proteinase nepenthesin-1 precursor           65.9    3e-09   
ref|XP_006483510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    3e-09   
ref|XP_009359073.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  65.9    3e-09   
ref|XP_006483727.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    3e-09   
ref|XP_010266606.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    3e-09   
gb|AFG47108.1|  hypothetical protein UMN_5224_01                      62.4    3e-09   
gb|AFG47106.1|  hypothetical protein UMN_5224_01                      62.4    3e-09   
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    4e-09   
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg           65.9    4e-09   
dbj|BAK07248.1|  predicted protein                                    65.9    4e-09   
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg           65.9    4e-09   
gb|AFG47112.1|  hypothetical protein UMN_5224_01                      62.4    4e-09   
ref|XP_008223730.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    4e-09   
emb|CDY56047.1|  BnaCnng29770D                                        65.1    4e-09   
emb|CDY43952.1|  BnaC04g21580D                                        65.5    4e-09   
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    4e-09   
gb|EMS52672.1|  Aspartic proteinase nepenthesin-2                     65.5    4e-09   
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    4e-09   
ref|XP_004307176.1|  PREDICTED: aspartic proteinase CDR1-like         65.5    4e-09   
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                  65.5    4e-09   
gb|ACN85278.1|  aspartic proteinase nepenthesin-1 precursor           65.5    5e-09   
ref|NP_191741.1|  aspartyl protease                                   65.5    5e-09   
ref|XP_010262754.1|  PREDICTED: aspartic proteinase nepenthesin-1     65.5    5e-09   
emb|CDX67868.1|  BnaA07g19080D                                        65.5    5e-09   
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    5e-09   
gb|KFK35067.1|  hypothetical protein AALP_AA5G230900                  65.5    5e-09   
ref|XP_009391894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    5e-09   
ref|XP_009407227.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    5e-09   
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    5e-09   
ref|XP_008368954.1|  PREDICTED: aspartic proteinase CDR1-like         65.1    5e-09   
ref|XP_007149205.1|  hypothetical protein PHAVU_005G050500g           65.1    5e-09   
emb|CDM80984.1|  unnamed protein product                              65.5    5e-09   
ref|NP_196637.1|  aspartyl protease family protein                    65.1    5e-09   
gb|AAN60226.1|  unknown                                               65.1    5e-09   
ref|XP_003530761.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    5e-09   
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg              65.1    5e-09   
ref|XP_009359074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    5e-09   
gb|ACG34391.1|  aspartic proteinase nepenthesin-2 precursor           65.1    6e-09   
ref|XP_008357233.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    6e-09   
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    6e-09   
gb|ACN85284.1|  aspartic proteinase nepenthesin-1 precursor           65.1    6e-09   
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    6e-09   
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    6e-09   
ref|XP_009359069.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    6e-09   
ref|XP_010556388.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  65.1    6e-09   
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    6e-09   
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g           65.1    7e-09   
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.7    7e-09   
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    7e-09   
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein          64.7    7e-09   
ref|XP_004957153.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.7    7e-09   



>ref|XP_006338076.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Solanum tuberosum]
Length=435

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 123/153 (80%), Gaps = 5/153 (3%)
 Frame = +1

Query  211  ANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPI  390
            +N +LSV+ IYGKCSPFN P PTS W  TV+NMA KDP RLSYLSSL A KP    + PI
Sbjct  27   SNEQLSVIPIYGKCSPFNTPKPTS-WENTVINMASKDPQRLSYLSSLVAQKPN---SAPI  82

Query  391  ASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFG  570
            ASGQ V N GNYV+RA+IGTPGQ+M+MVLDTSSD AWVPCSGC GC+ TVF PNTSST+G
Sbjct  83   ASGQQVFNIGNYVVRAKIGTPGQLMFMVLDTSSDTAWVPCSGCTGCTSTVFTPNTSSTYG  142

Query  571  SVECSVPECSMVNGMSCPTGGS-GACNFNQSYG  666
            S +CSVPEC+ V G SCPT G+ GAC FNQSYG
Sbjct  143  STDCSVPECTQVKGQSCPTAGAPGACFFNQSYG  175



>ref|XP_010060093.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW66621.1| hypothetical protein EUGRSUZ_F00411 [Eucalyptus grandis]
Length=436

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 126/163 (77%), Gaps = 4/163 (2%)
 Frame = +1

Query  178  ASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTA  357
            A AT  CA    +S+LS++HIYGKCSPFN P P  SW+ TV++MA KDP R+ YLS+L A
Sbjct  18   ALATSPCASPSDDSDLSIVHIYGKCSPFNPPKP-ESWVNTVLDMASKDPERVEYLSTLVA  76

Query  358  LKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET  537
             K    T+VPIA GQ  +N GNYV+R +IGTPGQ+MYMVLDTS+D AWVPCSGCVGCS T
Sbjct  77   QK---TTSVPIAPGQQTINIGNYVVRVKIGTPGQLMYMVLDTSNDEAWVPCSGCVGCSTT  133

Query  538  VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             F PNTSST+GS++CS+P+C+ V G  CPT GSG C FNQSYG
Sbjct  134  TFLPNTSSTYGSLDCSMPQCTQVRGFQCPTTGSGGCFFNQSYG  176



>ref|XP_009588036.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=434

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 124/166 (75%), Gaps = 6/166 (4%)
 Frame = +1

Query  169  SNTASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSS  348
            S  ASA   CA    N +LSV+ IYGKCSPFN P PTS W  TV+NMA KDP RLSYLSS
Sbjct  15   STKASAFDSCA--STNEDLSVIPIYGKCSPFNTPKPTS-WENTVINMASKDPQRLSYLSS  71

Query  349  LTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC  528
            L   KP    + PIASGQ V N GNYV+RA+IGTPGQ+++MVLDTSSD AWVPCSGC GC
Sbjct  72   LVDQKPN---SAPIASGQQVFNIGNYVVRAKIGTPGQLLFMVLDTSSDTAWVPCSGCTGC  128

Query  529  SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            + T+FAPN SST+GS ECS P+C+ V G SCP G  GAC FNQSYG
Sbjct  129  TSTMFAPNMSSTYGSTECSAPQCTQVRGQSCPAGAPGACFFNQSYG  174



>ref|XP_007018203.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY15428.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=435

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            CA    NS LS++ IYGKCSPFN P P  SW+ TV+NMA KDPAR+ YLSSL A K    
Sbjct  23   CAAQADNSGLSIIPIYGKCSPFNPPKP-DSWVNTVINMAAKDPARVKYLSSLAAQK---T  78

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            T VPIASGQ VLN GNYV+R ++GTPGQ+M+MVLDTS+D AWVPCSGC+GCS T F+PNT
Sbjct  79   TAVPIASGQQVLNIGNYVVRVKLGTPGQLMFMVLDTSNDAAWVPCSGCIGCSATTFSPNT  138

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SS++GS++CS+P+CS V G+SCP  G+ AC+FNQSYG
Sbjct  139  SSSYGSLDCSLPQCSQVRGLSCPATGAAACSFNQSYG  175



>ref|XP_009770124.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
sylvestris]
Length=434

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 124/166 (75%), Gaps = 6/166 (4%)
 Frame = +1

Query  169  SNTASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSS  348
            S  +SA   CA    N +LSV+ +YGKCSPFN P P SSW  TV+NMA KDP RLSYLSS
Sbjct  15   STKSSAFDSCA--STNEDLSVIPVYGKCSPFNTPKP-SSWENTVINMASKDPQRLSYLSS  71

Query  349  LTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC  528
            L A KP    + PIASGQ V N GNYV+RA+IGTPGQ+M+MVLDTSSD  WVPCSGC GC
Sbjct  72   LVAQKPN---SAPIASGQQVFNIGNYVVRAKIGTPGQLMFMVLDTSSDTGWVPCSGCTGC  128

Query  529  SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            + T+FAPNTSST+GS ECS P+C+ V   SCP G  GAC FNQSYG
Sbjct  129  TSTMFAPNTSSTYGSTECSAPQCTQVRRQSCPAGAPGACFFNQSYG  174



>ref|XP_011091829.1| PREDICTED: aspartic proteinase nepenthesin-1 [Sesamum indicum]
Length=437

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 129/153 (84%), Gaps = 4/153 (3%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K+ S+LSV+ IYGKCSPFN+P P SSW+ TV++MA  DP R++YLSSL A KP   T+VP
Sbjct  29   KSGSDLSVIPIYGKCSPFNSPEPASSWVNTVLDMASGDPKRVTYLSSLVARKP---TSVP  85

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTF  567
            IA GQ V+N GNYV+RA+IGTPGQ+M+MVLDTS+D AWVPCSGC+GCS   FAPNTSST+
Sbjct  86   IAPGQ-VINVGNYVLRAKIGTPGQLMFMVLDTSNDAAWVPCSGCIGCSSNAFAPNTSSTY  144

Query  568  GSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            GS++CSVPEC+ V+G+SCPT GS +C FN+SYG
Sbjct  145  GSLDCSVPECTQVSGLSCPTVGSSSCLFNRSYG  177



>ref|XP_004252715.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=446

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 132/166 (80%), Gaps = 11/166 (7%)
 Frame = +1

Query  196  CAPN--KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPK  369
            CA N  K NS+L+V+HIYGKCSPFN+P P+SSW+ TV+NMA KDP RLSYLSSL     K
Sbjct  23   CAFNSKKGNSDLTVIHIYGKCSPFNSPKPSSSWINTVINMASKDPQRLSYLSSLVV--SK  80

Query  370  GKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE-TVFA  546
              TNVPIASGQ + N GNYV+R ++GTPGQ MYMVLDTS+D A+VPCSGCVGCS  T+FA
Sbjct  81   KPTNVPIASGQQLFNIGNYVVRVKMGTPGQQMYMVLDTSNDAAFVPCSGCVGCSSNTLFA  140

Query  547  PNTSSTFGSVECSVPECSMVNG-MSCPT-----GGSGACNFNQSYG  666
            P+TS+T+GSV+CSVPEC+ V G +SCPT     G S AC FNQSYG
Sbjct  141  PSTSTTYGSVDCSVPECTQVRGSLSCPTTGSVVGSSTACFFNQSYG  186



>ref|XP_006366418.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=447

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 128/161 (80%), Gaps = 9/161 (6%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
             K NS+LSV+HIYGKCSPFN+P P+SSW+ TV+NMA KDP RLSYLSSL     K  TNV
Sbjct  29   KKGNSDLSVIHIYGKCSPFNSPKPSSSWINTVINMASKDPQRLSYLSSLVV--SKKPTNV  86

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE-TVFAPNTSS  561
            PIASGQ + N GNYV+R ++GTPGQ MYMVLDTS+D A+VPC GCVGCS  T+FAP+TS+
Sbjct  87   PIASGQQLFNIGNYVVRVKMGTPGQQMYMVLDTSNDAAFVPCGGCVGCSSNTLFAPSTST  146

Query  562  TFGSVECSVPECSMVNG-MSCPT-----GGSGACNFNQSYG  666
            TFGSV+CSVPEC+ V G +SCPT     G S AC FNQSYG
Sbjct  147  TFGSVDCSVPECTQVRGSLSCPTTGSVVGSSTACFFNQSYG  187



>gb|KJB29357.1| hypothetical protein B456_005G096500 [Gossypium raimondii]
Length=435

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 122/157 (78%), Gaps = 4/157 (3%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C P   +S+L V+ IYGKCSPFN P P  S   TVMNMA KDPAR+ YLSSL A K    
Sbjct  23   CGPQPDDSDLLVIPIYGKCSPFNPPKP-DSLFNTVMNMASKDPARVKYLSSLVAQK---T  78

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            T VPIASGQ VLN GNY++R +IGTPGQ+M+MVLDTS+D AWVPCSGC GCS T F+PNT
Sbjct  79   TAVPIASGQQVLNIGNYIVRVKIGTPGQLMFMVLDTSNDVAWVPCSGCNGCSATTFSPNT  138

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SST+GS++C +P+C+ V G+SCP  GS AC+FNQSYG
Sbjct  139  SSTYGSLDCGLPQCAQVRGLSCPATGSAACSFNQSYG  175



>ref|XP_004237984.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Solanum lycopersicum]
Length=435

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 5/153 (3%)
 Frame = +1

Query  211  ANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPI  390
            +N +LSV+ IYGKCSPFN P PTS W  T++NMA KDP RLSYLSSL A KP    + PI
Sbjct  27   SNEQLSVIPIYGKCSPFNTPKPTS-WENTLINMASKDPQRLSYLSSLVAQKPN---SAPI  82

Query  391  ASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFG  570
            ASGQ V N GNYV+RA+IGTPGQ+M+MVLDTSSD AWVPCSGC GC+ +VF PN SST+G
Sbjct  83   ASGQQVFNIGNYVVRAKIGTPGQLMFMVLDTSSDTAWVPCSGCTGCTSSVFTPNISSTYG  142

Query  571  SVECSVPECSMVNGMSCPTGGS-GACNFNQSYG  666
            S+ CSVPEC+ V G SCP  G+ GAC FNQSYG
Sbjct  143  SMGCSVPECTQVKGQSCPAAGAPGACFFNQSYG  175



>emb|CDP11493.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 11/175 (6%)
 Frame = +1

Query  169  SNTASATQF-CAPNKANSELSVMHIYGKCSPFNNPNPT-------SSWLTTVMNMAVKDP  324
            S TA A+   CA +K  S+LSV+HIYGKCSPF             SSWL T++NMA KDP
Sbjct  17   STTAGASHDPCASSK--SDLSVIHIYGKCSPFTPQTKPAPAPAAASSWLNTILNMASKDP  74

Query  325  ARLSYLSSL-TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAW  501
             R++YLSSL TA K    T++PIASGQNVLN GNY++RA+IGTP Q+++MVLDTS+D AW
Sbjct  75   QRVAYLSSLVTAKKATKATSIPIASGQNVLNVGNYIVRAKIGTPAQLLFMVLDTSNDLAW  134

Query  502  VPCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            VPCSGC GCS TVF+PNTS+++ + +CS+PEC+ V G+SCPT G+GAC FNQSYG
Sbjct  135  VPCSGCTGCSSTVFSPNTSTSYAASDCSLPECTQVRGLSCPTTGAGACLFNQSYG  189



>ref|XP_010272925.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Nelumbo nucifera]
Length=443

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +1

Query  220  ELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASG  399
            ELSV HIYGKCSPF+ P    SW+ TV+NMA KDP R++YLSSL + K    T+VPIASG
Sbjct  39   ELSVFHIYGKCSPFSTPK-RESWVDTVINMATKDPERVTYLSSLVSRK---ATSVPIASG  94

Query  400  QNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVE  579
            Q  +N GNYV+R +IGTPGQVM+MV+DTS+D AWVPCSGC GCS TVF PNTSSTFGS++
Sbjct  95   QQAMNIGNYVVRVKIGTPGQVMFMVIDTSNDAAWVPCSGCSGCSNTVFTPNTSSTFGSMD  154

Query  580  CSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            C +PEC+ V GMSCPT  S  C FNQ+YG
Sbjct  155  CKMPECAQVRGMSCPTADSSPCLFNQTYG  183



>ref|XP_009618058.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=443

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 126/158 (80%), Gaps = 7/158 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K NS+LS++HIYGKCSPFN P P+SS+L TV+NMA KDP RLSYLSSL     K  T VP
Sbjct  28   KGNSDLSIIHIYGKCSPFNPPKPSSSFLNTVINMASKDPQRLSYLSSLVV--SKKPTIVP  85

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSST  564
            IA GQN+ N GNYV++A+IGTPGQ+MYMVLDTS+D+AWVPCSGCVGC S T+FAP TSST
Sbjct  86   IAPGQNLFNIGNYVVKAKIGTPGQLMYMVLDTSNDDAWVPCSGCVGCTSNTLFAPTTSST  145

Query  565  FGSVECSVPECSMVNGM----SCPTGGSGACNFNQSYG  666
            +GSV+CSVPEC+ V G+    +    GS AC FNQSYG
Sbjct  146  YGSVDCSVPECTQVRGLSCSTTGSGSGSSACFFNQSYG  183



>gb|EYU36857.1| hypothetical protein MIMGU_mgv1a022460mg [Erythranthe guttata]
Length=443

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 131/168 (78%), Gaps = 6/168 (4%)
 Frame = +1

Query  169  SNTASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSS  348
            S+ A+    C   K  S+LSV+HIYGKCSPFN P P +SW+ TV+NMA  DP R++YLSS
Sbjct  20   SSNAAIRDPCPVPKTGSDLSVIHIYGKCSPFNPPKPATSWVNTVLNMASSDPERVTYLSS  79

Query  349  LTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC  528
            L A KP   T+VP+ASGQ V++TGNYV+RA+IGTPGQ+M+MV+DTS+D AWVPC+ C GC
Sbjct  80   LAAQKP---TSVPVASGQ-VISTGNYVVRAKIGTPGQLMFMVMDTSNDAAWVPCTACNGC  135

Query  529  SET--VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S T   FAPNTS+T+G V+CSVP+C+ V+G++CPT GSG C F + YG
Sbjct  136  SSTAAAFAPNTSTTYGPVDCSVPDCTAVSGLACPTDGSGNCQFTRPYG  183



>ref|XP_009757207.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=443

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 125/158 (79%), Gaps = 7/158 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K NS+LS++HIYGKCSPFN P P+SS+L TV+NMA KDP RLSYLSSL     K  T VP
Sbjct  28   KGNSDLSIIHIYGKCSPFNPPKPSSSFLNTVINMASKDPQRLSYLSSLVV--SKKPTIVP  85

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSST  564
            IA  QN+ N GNYV++A+IGTPGQ+MYMVLDTS+DNAWVPCSGCVGC S T+FAP TSST
Sbjct  86   IAPAQNLFNIGNYVVKAKIGTPGQLMYMVLDTSNDNAWVPCSGCVGCTSNTLFAPTTSST  145

Query  565  FGSVECSVPECSMVNGM----SCPTGGSGACNFNQSYG  666
            +GSV+CSVPEC+ V G+    +    GS AC FNQSYG
Sbjct  146  YGSVDCSVPECTQVRGLSCTSTGSGSGSSACFFNQSYG  183



>ref|XP_002283889.2| PREDICTED: aspartic proteinase nepenthesin-1 [Vitis vinifera]
Length=439

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S+LSV+H+YG+CSPFN  +   SW+ TV+NMA KDPAR++YLSSL A  PK  T+VPIAS
Sbjct  33   SDLSVIHVYGQCSPFNQ-HKAGSWVNTVINMASKDPARVTYLSSLVA-SPKA-TSVPIAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            GQ VLN GNYV+R ++GTPGQ+M+MVLDTS D AWVPC+ C GCS   F+PNTSST+ S+
Sbjct  90   GQQVLNIGNYVVRVKLGTPGQLMFMVLDTSRDAAWVPCADCAGCSSPTFSPNTSSTYASL  149

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +CSVP+C+ V G+SCPT G+ AC FNQ+YG
Sbjct  150  QCSVPQCTQVRGLSCPTTGTAACFFNQTYG  179



>gb|EYU42951.1| hypothetical protein MIMGU_mgv1a027000mg [Erythranthe guttata]
Length=443

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 125/159 (79%), Gaps = 6/159 (4%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C   K  S+LSV+HIY KCSPFN P P SSW+ TV+NMA  DP R++YLSSL   KP   
Sbjct  29   CPSPKTGSDLSVIHIYDKCSPFNPPKPASSWVNTVLNMASSDPERVTYLSSLAGQKP---  85

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET--VFAP  549
            T+VP+ASGQ V++TGNYV+RA+IGTPGQ+M+MV+DTS+D AWVPC+ C GCS T   FAP
Sbjct  86   TSVPVASGQ-VISTGNYVVRAKIGTPGQLMFMVMDTSNDAAWVPCTACNGCSSTAAAFAP  144

Query  550  NTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            NTS+T+G V+CSVP+C+ V+G++CPT GSG C F + YG
Sbjct  145  NTSTTYGPVDCSVPDCTAVSGLACPTDGSGNCQFTRPYG  183



>ref|XP_010266126.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nelumbo 
nucifera]
Length=443

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = +1

Query  220  ELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASG  399
            ELSV HIYGKCSPF++P    SW+ TV+NMA KDP R++YLSSL A +    T+VP+ASG
Sbjct  38   ELSVFHIYGKCSPFSSPK-RESWIDTVINMASKDPERVAYLSSLVAQR---ATSVPVASG  93

Query  400  QNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGSV  576
            Q + N GNYV+RA+IGTPGQ+M+MV+DTS+D AWVPCSGC GC S TVF PNTSST+GS+
Sbjct  94   QQMFNIGNYVVRAKIGTPGQLMFMVMDTSNDAAWVPCSGCTGCSSSTVFTPNTSSTYGSM  153

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +C +P+C+ V G+SCPT  +  C FNQSYG
Sbjct  154  DCKLPQCAQVRGLSCPTAVASPCLFNQSYG  183



>gb|KJB58890.1| hypothetical protein B456_009G230400 [Gossypium raimondii]
Length=408

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 4/157 (3%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C     N +LSV+ IYGKCSPF  P P  SW+ TV+NMA KDPARL YLSSL A K    
Sbjct  23   CGSRPQNKDLSVIPIYGKCSPFKPPKP-ESWVDTVINMASKDPARLKYLSSLVAQK---T  78

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            T VPIASGQ VL+ GNYV++ ++GTPGQV++MVLDTS++ AWVPCSGC GCS T F P+ 
Sbjct  79   TAVPIASGQQVLSIGNYVVKVKLGTPGQVIFMVLDTSNNVAWVPCSGCTGCSATTFLPSA  138

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SS++GS++CS+P+C+ V+G+SCP  G+ AC FNQSYG
Sbjct  139  SSSYGSLDCSLPQCNQVHGLSCPATGAAACFFNQSYG  175



>gb|ACJ85275.1| unknown [Medicago truncatula]
Length=267

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 122/161 (76%), Gaps = 4/161 (2%)
 Frame = +1

Query  184  ATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALK  363
            AT  CA    +S+L+V+ +YGKCSPFN P  T SW   V+NMA KDPAR+SYLSSL A  
Sbjct  22   ATDPCASQPDDSDLNVIPMYGKCSPFN-PQKTDSWDNRVLNMASKDPARMSYLSSLVA--  78

Query  364  PKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVF  543
             K  ++ PIASGQ   N GNY++R +IGTPGQ+++MVLDTS+D A++P SGC+GCS T F
Sbjct  79   QKTVSSAPIASGQ-AFNIGNYIVRVKIGTPGQLLFMVLDTSTDEAFIPSSGCIGCSATTF  137

Query  544  APNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +PN S+++  +ECSVP+CS V G+SCP  GSGAC+FN+SY 
Sbjct  138  SPNASTSYVPLECSVPQCSQVRGLSCPATGSGACSFNKSYA  178



>gb|KDP41467.1| hypothetical protein JCGZ_15874 [Jatropha curcas]
Length=439

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = +1

Query  169  SNTASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSS  348
            S+T +    CA     S+LS++ IY KCSPFN     +S L TV+NMA KDP RL YLSS
Sbjct  17   SSTRALVDSCASQADESDLSIIPIYSKCSPFNPHKQETSLLNTVINMATKDPQRLKYLSS  76

Query  349  LTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC  528
            L A   +  T VPIA GQ VLN GNYV+R ++GTPGQVM MVLDTS+D AWVPCSGC GC
Sbjct  77   LQA---QMTTAVPIAPGQQVLNIGNYVVRVKLGTPGQVMNMVLDTSNDAAWVPCSGCTGC  133

Query  529  SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S T F  N SST+GS++CS+ +C+ V G SCP  G+  C FNQSYG
Sbjct  134  SSTTFITNISSTYGSLDCSMAQCTQVRGFSCPDTGTSYCLFNQSYG  179



>ref|XP_003602931.1| Aspartic proteinase nepenthesin-1 [Medicago truncatula]
 gb|AES73182.1| aspartic proteinase nepenthesin-like protein [Medicago truncatula]
Length=438

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +1

Query  178  ASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTA  357
            ++AT  CA    +S+L+V+ +YGKCSPFN P  T SW   V+NMA KDPAR+SYLSSL A
Sbjct  20   SNATDPCASQPDDSDLNVIPMYGKCSPFN-PQKTDSWDNRVLNMASKDPARMSYLSSLVA  78

Query  358  LKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET  537
               K  ++ PIASGQ   N GNY++R +IGTPGQ+++MVLDTS+D A++P SGC+GCS T
Sbjct  79   --QKTVSSAPIASGQ-AFNIGNYIVRVKIGTPGQLLFMVLDTSTDEAFIPSSGCIGCSAT  135

Query  538  VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             F+PN S+++  +ECSVP+CS V G+SCP  GSGAC+FN+SY 
Sbjct  136  TFSPNASTSYVPLECSVPQCSQVRGLSCPATGSGACSFNKSYA  178



>gb|AFK46294.1| unknown [Medicago truncatula]
Length=434

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +1

Query  178  ASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTA  357
            ++AT  CA    +S+L+V+ +YGKCSPFN P  T SW   V+NMA KDPAR+SYLSSL A
Sbjct  20   SNATDPCASQPDDSDLNVIPMYGKCSPFN-PQKTDSWDNRVLNMASKDPARMSYLSSLVA  78

Query  358  LKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET  537
               K  ++ PIASGQ   N GNY++R +IGTPGQ+++MVLDTS+D A++P SGC+GCS T
Sbjct  79   --QKTVSSAPIASGQ-AFNIGNYIVRVKIGTPGQLLFMVLDTSTDEAFIPSSGCIGCSAT  135

Query  538  VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             F+PN S+++  +ECSVP+CS V G+SCP  GSGAC+FN+SY 
Sbjct  136  TFSPNASTSYVPLECSVPQCSQVRGLSCPATGSGACSFNKSYA  178



>ref|XP_004501630.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=437

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 119/157 (76%), Gaps = 4/157 (3%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            CA    +++L+V+ IYGKCSPFN P  T SW   V+NMA KDPAR++YLS+L  L  K  
Sbjct  26   CASQADDTDLNVIPIYGKCSPFNPPK-TDSWENRVINMASKDPARMNYLSTL--LAQKTI  82

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            ++ PIASGQ   N GNYV+R +IGTPGQ+ +MVLDTS+D A+ PCSGC+GCS T F+PN+
Sbjct  83   SSAPIASGQ-AFNIGNYVVRVKIGTPGQLFFMVLDTSTDEAFAPCSGCIGCSSTTFSPNS  141

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+++G ++CSVP+C  V G SCP  GSGAC+FNQ+Y 
Sbjct  142  STSYGPLDCSVPQCGQVRGFSCPATGSGACSFNQTYA  178



>ref|XP_004148418.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus]
 ref|XP_004166061.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus]
 gb|KGN62761.1| hypothetical protein Csa_2G371100 [Cucumis sativus]
Length=436

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 121/165 (73%), Gaps = 6/165 (4%)
 Frame = +1

Query  175  TASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLT  354
            T++A   CA + ++ +LSV+ IYGKCSPF  P  + SW+ TV++MA KDPAR+ YLSSLT
Sbjct  17   TSNAFDLCA-SGSDGDLSVIPIYGKCSPFTAPK-SESWMNTVIDMASKDPARIRYLSSLT  74

Query  355  ALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE  534
            A K       PIASGQ VLN GNYV+R ++GTPGQ MYMVLDTS+D AW PCSGC+GCS 
Sbjct  75   AQK---TVAAPIASGQQVLNVGNYVVRVQLGTPGQTMYMVLDTSNDAAWAPCSGCIGCSS  131

Query  535  -TVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             T F+   SSTF +++CS PEC+   G+SCPT G+  C FNQ+YG
Sbjct  132  TTTFSAQNSSTFATLDCSKPECTQARGLSCPTTGNVDCLFNQTYG  176



>ref|XP_011016906.1| PREDICTED: aspartic proteinase nepenthesin-1 [Populus euphratica]
Length=458

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 114/165 (69%), Gaps = 4/165 (2%)
 Frame = +1

Query  172  NTASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSL  351
            +T  A   CA    NS+LSV+ IY KCSPF  P    SW+ TV+ MA KDP RL+YLS+L
Sbjct  38   STTKAVDPCATQSDNSDLSVIPIYSKCSPFVPPK-QDSWVNTVITMASKDPERLTYLSTL  96

Query  352  TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS  531
               K    T+VPIA GQ VL   NYV+R ++GTPGQ M+MVLDTS+D AWVPCSGC GCS
Sbjct  97   ADQK---TTSVPIAPGQQVLKIANYVVRVKLGTPGQQMFMVLDTSNDAAWVPCSGCTGCS  153

Query  532  ETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             T F PN S+T GS++CS  +CS V G SCP  GS AC FNQSYG
Sbjct  154  STTFLPNASTTIGSLDCSGAQCSQVRGFSCPATGSSACLFNQSYG  198



>ref|XP_010675271.1| PREDICTED: aspartic proteinase nepenthesin-1 [Beta vulgaris subsp. 
vulgaris]
Length=439

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 121/168 (72%), Gaps = 7/168 (4%)
 Frame = +1

Query  169  SNTASATQFCAPNKANS-ELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLS  345
            + +A  +  C  +K +S +LS++HIYG CSPF    P   W   V+NMA KD  R++YL 
Sbjct  19   TQSAKPSLLCPSSKPDSSDLSILHIYGGCSPFKARKP-EPWSNIVLNMASKDTKRVAYLD  77

Query  346  SLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVG  525
            SL A     KT+ PIASGQ VLN GNY++RA+IGTP Q+M+MVLDTS+DNAWVPC+GC+G
Sbjct  78   SLAA----RKTSAPIASGQQVLNIGNYLVRAKIGTPAQLMFMVLDTSTDNAWVPCTGCLG  133

Query  526  CSETVFAPNTSSTFGSVECSVPECSMVNGM-SCPTGGSGACNFNQSYG  666
            CS   F PN+SSTFG ++CS  +C+ V G+ SCPT G GAC FNQSYG
Sbjct  134  CSPNTFFPNSSSTFGPMDCSSAQCTQVYGLISCPTTGYGACRFNQSYG  181



>dbj|BAE71208.1| hypothetical protein [Trifolium pratense]
 dbj|BAE71210.1| hypothetical protein [Trifolium pratense]
Length=437

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 117/157 (75%), Gaps = 4/157 (3%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            CA    +S+L+V+ +YGKCSPFN P    SW   V+NMA KDPAR+SYLS+L A   K  
Sbjct  26   CASQPDDSDLNVIPMYGKCSPFNPPK-ADSWDNRVINMASKDPARMSYLSTLVA--QKTA  82

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            T+ PIASGQ   N GNYV+R +IGTPGQ+++MVLDTS+D A+VP SGC+GCS T F PN 
Sbjct  83   TSAPIASGQT-FNIGNYVVRVKIGTPGQLLFMVLDTSTDEAFVPSSGCIGCSATTFYPNV  141

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S++F  ++CSVP+C  V G+SCP  GSGAC+FNQSY 
Sbjct  142  STSFVPLDCSVPQCGQVRGLSCPATGSGACSFNQSYA  178



>ref|XP_002302336.2| chloroplast nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEE81609.2| chloroplast nucleoid DNA-binding family protein [Populus trichocarpa]
Length=458

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 111/165 (67%), Gaps = 4/165 (2%)
 Frame = +1

Query  172  NTASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSL  351
            +T  A   CA     S+LSV+ IY KCSPF  P    SW+ TV+ MA KDP RL YLS+L
Sbjct  38   STTKAVDPCATQSDTSDLSVIPIYSKCSPFVPPK-QESWVNTVITMASKDPERLKYLSTL  96

Query  352  TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS  531
               K    T VPIA GQ VL   NYV+R ++GTPGQ M+MVLDTS+D AWVPCSGC GCS
Sbjct  97   ADQK---TTAVPIAPGQQVLKIANYVVRVKLGTPGQQMFMVLDTSNDAAWVPCSGCTGCS  153

Query  532  ETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             T F PN S+T GS++CS  +CS V G SCP  GS AC FNQSYG
Sbjct  154  STTFLPNASTTLGSLDCSGAQCSQVRGFSCPATGSSACLFNQSYG  198



>gb|ACU24323.1| unknown [Glycine max]
Length=334

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 112/156 (72%), Gaps = 3/156 (2%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            CA    NS+L+V+ IY KCSPF  P   SSW   ++NMA KDP R  YLS+L   K    
Sbjct  27   CASQADNSDLNVIPIYSKCSPFKPPKSDSSWDNRIINMASKDPLRFKYLSTLVGQK--TV  84

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            +  PIASGQ   N GNYV+R ++GTPGQ+++MVLDTS+D A+VPCSGC GCS+  F+P  
Sbjct  85   STAPIASGQT-FNIGNYVVRVKLGTPGQLLFMVLDTSTDEAFVPCSGCTGCSDATFSPKA  143

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
            S+++G ++CSVP+C  V G+SCP  G+GAC+FNQSY
Sbjct  144  STSYGPLDCSVPQCGQVRGLSCPATGTGACSFNQSY  179



>ref|XP_003522749.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Glycine 
max]
Length=440

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            CA    NS+L+V+ IY KCSPF  P   SSW   ++NMA KDP R  YLS+L     K  
Sbjct  27   CASQADNSDLNVIPIYSKCSPFKPPKSDSSWDNRIINMASKDPLRFKYLSTLVG--QKTV  84

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            +  PIASGQ   N GNYV+R ++GTPGQ+++MVLDTS+D A+VPCSGC GCS+T F+P  
Sbjct  85   STAPIASGQT-FNIGNYVVRVKLGTPGQLLFMVLDTSTDEAFVPCSGCTGCSDTTFSPKA  143

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
            S+++G ++CSVP+C  V G+SCP  G+GAC+FNQSY
Sbjct  144  STSYGPLDCSVPQCGQVRGLSCPATGTGACSFNQSY  179



>ref|XP_009373927.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Pyrus x bretschneideri]
Length=442

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 115/157 (73%), Gaps = 7/157 (4%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +  + +LS++  Y KCSPF+ P  T S  TTV+NMA KDPAR +YLSSL A K    T+ 
Sbjct  30   SDGSDDLSIIPTYSKCSPFSPPK-TDSLFTTVLNMASKDPARFNYLSSLVAQK---TTSA  85

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
            PIASGQ VLN  NYV+R ++GTPGQ+M MVLDTS+D AW PCSGC GCS T F PN+SST
Sbjct  86   PIASGQQVLNIANYVVRLKLGTPGQLMNMVLDTSNDIAWAPCSGCTGCSSTTFLPNSSST  145

Query  565  FGSVECSVPECSMVNGMSCPTGGSGA---CNFNQSYG  666
            +GS++CSVPEC+   G+SC T GS A   C FNQSYG
Sbjct  146  YGSLDCSVPECAQARGLSCSTTGSPAANGCFFNQSYG  182



>ref|XP_008444946.1| PREDICTED: aspartic proteinase nepenthesin-1 [Cucumis melo]
Length=436

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = +1

Query  211  ANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPI  390
            ++ +LSV+ IYGKCSPF  P  + SW+ TV++MA KDPAR+ YLSSLTA K       PI
Sbjct  28   SDGDLSVIPIYGKCSPFTAPK-SESWMNTVIDMASKDPARIRYLSSLTAQK---SVAAPI  83

Query  391  ASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS-ETVFAPNTSSTF  567
            ASGQ VLN GNYV+R ++GTPGQ MYMVLDTS+D AW PCSGC GCS    F+   SSTF
Sbjct  84   ASGQQVLNIGNYVVRVQLGTPGQTMYMVLDTSNDAAWAPCSGCTGCSGPATFSAKNSSTF  143

Query  568  GSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             +++CS P+CS   G+SCPT G+  C FNQ+YG
Sbjct  144  ATLDCSKPQCSQARGLSCPTTGNADCLFNQTYG  176



>ref|XP_009342559.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Pyrus x bretschneideri]
Length=442

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 115/157 (73%), Gaps = 7/157 (4%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +  + +LS++  Y KCSPF+ P  T S  TTV+NMA KDPAR +YLSSL A K    T+ 
Sbjct  30   SDGSDDLSIIPTYSKCSPFSPPK-TDSLFTTVLNMASKDPARFNYLSSLVAQK---TTSA  85

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
            PIASGQ VLN  NYV+R ++GTPGQ+M MVLDTS+D AW PCSGC GCS T F PN+SST
Sbjct  86   PIASGQQVLNIANYVVRLKLGTPGQLMNMVLDTSNDIAWAPCSGCTGCSSTTFLPNSSST  145

Query  565  FGSVECSVPECSMVNGMSCPTGGSGA---CNFNQSYG  666
            +GS++C+VPEC+   G+SC T GS A   C FNQSYG
Sbjct  146  YGSLDCTVPECAQARGLSCSTTGSTAANGCFFNQSYG  182



>ref|XP_010107692.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXC16665.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=439

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 115/158 (73%), Gaps = 6/158 (4%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S+LSV+ IY KCSPF  P    S + TV+NMA KDP RL YLSSL A K    
Sbjct  27   CVSQSDGSDLSVIPIYSKCSPFKPPK-ADSMVNTVINMASKDPQRLKYLSSLAAQK---T  82

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            T+ PIASGQ  L+ GNYV+RA+IGTPGQ+++MVLDTS+D AW PCSGC GCS T F+PN 
Sbjct  83   TSAPIASGQQ-LHIGNYVVRAKIGTPGQLLFMVLDTSNDAAWAPCSGCTGCSSTTFSPNL  141

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGA-CNFNQSYG  666
            SSTFG ++CSV +C+ V G+SCPT G+ + C FNQSYG
Sbjct  142  SSTFGPLDCSVAQCTQVRGLSCPTTGAASPCLFNQSYG  179



>gb|ABK95290.1| unknown [Populus trichocarpa]
Length=438

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 110/165 (67%), Gaps = 4/165 (2%)
 Frame = +1

Query  172  NTASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSL  351
            +T  A   CA     S+LSV+ IY KCSPF  P    SW+ TV+ MA KDP RL YLS+L
Sbjct  18   STTKAVDPCATQSDTSDLSVIPIYSKCSPFVPPK-QESWVNTVITMASKDPERLKYLSTL  76

Query  352  TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS  531
               K    T VPIA GQ VL   NYV+R ++GTPGQ M+MVLDTS+D AWVPCSGC G S
Sbjct  77   ADQK---TTAVPIAPGQQVLKIANYVVRVKLGTPGQQMFMVLDTSNDAAWVPCSGCTGFS  133

Query  532  ETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             T F PN S+T GS++CS  +CS V G SCP  GS AC FNQSYG
Sbjct  134  STTFLPNASTTLGSLDCSGAQCSQVRGFSCPATGSSACLFNQSYG  178



>ref|XP_009376250.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Pyrus x bretschneideri]
Length=442

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 119/157 (76%), Gaps = 7/157 (4%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +  + ++S++  Y KCSPF+ P  T S +TTV+NMA KDPAR++YLS+L A K    T+ 
Sbjct  30   SDGSDDISIIPTYSKCSPFSPPK-TDSLVTTVLNMASKDPARVNYLSTLVAQK---TTSA  85

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
            PIASGQ VLN  NYV++ ++GTPGQ+M MVLDTS+D  W PCSGC GCS T F+PN+SST
Sbjct  86   PIASGQQVLNIANYVVQLKLGTPGQLMNMVLDTSNDITWAPCSGCTGCSSTTFSPNSSST  145

Query  565  FGSVECSVPECSMVNGMSCP-TGGSGA--CNFNQSYG  666
            +GS+ECSVPEC+   G+SCP TG +GA  C FNQSYG
Sbjct  146  YGSLECSVPECAQARGLSCPATGSTGANVCFFNQSYG  182



>ref|XP_007222165.1| hypothetical protein PRUPE_ppa005789mg [Prunus persica]
 gb|EMJ23364.1| hypothetical protein PRUPE_ppa005789mg [Prunus persica]
Length=443

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 7/152 (5%)
 Frame = +1

Query  220  ELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASG  399
            +LS++  Y KCSPF+ P    SW+TTV+NMA KDPAR++YLS+L A K    T+ PIASG
Sbjct  36   DLSIIPTYSKCSPFSPPK-ADSWVTTVLNMASKDPARINYLSTLVAQK---TTSAPIASG  91

Query  400  QNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVE  579
            Q VLN  NYV+R ++GTPGQ+M+MVLDTS+D AW PCSGC GCS T F  N+S+T+ S++
Sbjct  92   QQVLNIANYVVRLKLGTPGQLMFMVLDTSNDIAWAPCSGCTGCSATTFLTNSSTTYRSLD  151

Query  580  CSVPECSMVNGMSCP-TGGSGA--CNFNQSYG  666
            CSV EC+   G+SCP TG +GA  C FNQSYG
Sbjct  152  CSVHECAQARGLSCPATGSTGANGCFFNQSYG  183



>ref|XP_003526531.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=454

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 114/157 (73%), Gaps = 4/157 (3%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            CA    NS+L+V+ IY KCSPF  P    +W   ++NMA KDP R+ YLS+L +   K  
Sbjct  42   CASQPDNSDLNVIPIYSKCSPFKPPK-ADTWDNRIINMASKDPVRVKYLSTLVS--QKTV  98

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            +  PIASGQ   N GNYV+R ++GTPGQ+++MVLDTS+D A+VPCSGC GCS+T F+P  
Sbjct  99   STAPIASGQ-AFNIGNYVVRVKLGTPGQLLFMVLDTSTDEAFVPCSGCTGCSDTTFSPKA  157

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+++G ++CSVP+C  V G+SCP  G+GAC+FNQSY 
Sbjct  158  STSYGPLDCSVPQCGQVRGLSCPATGTGACSFNQSYA  194



>ref|XP_004299721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 5/149 (3%)
 Frame = +1

Query  220  ELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASG  399
            +LS++  Y KCSP  +P   S    TV+ MA KDP R  YLS+L A K    T+ PIASG
Sbjct  34   DLSIIPTYSKCSPITSPKTDS--FNTVLTMASKDPERFKYLSTLVAQK---TTSAPIASG  88

Query  400  QNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVE  579
            Q VLN  NY+++ ++GTPGQ+MYMVLDTS+D AWVPCSGC GCS   F+PNTS+TFG ++
Sbjct  89   QQVLNIPNYIVQIKLGTPGQLMYMVLDTSNDIAWVPCSGCTGCSSIAFSPNTSTTFGQLD  148

Query  580  CSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            CSVP+C+   G+SCP G    C+FNQSYG
Sbjct  149  CSVPQCAQARGLSCPAGSPAGCSFNQSYG  177



>ref|XP_007137648.1| hypothetical protein PHAVU_009G144100g [Phaseolus vulgaris]
 gb|ESW09642.1| hypothetical protein PHAVU_009G144100g [Phaseolus vulgaris]
Length=436

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = +1

Query  175  TASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLT  354
            + +AT  CA     S+L+V+ IY KCSPF  P    SW T ++ MA KDP R+ YLS+L 
Sbjct  18   SGNATDPCASQPDESDLNVIPIYSKCSPFKPPK-ADSWETRIVTMASKDPLRVRYLSTL-  75

Query  355  ALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE  534
             L  K  ++ PIASGQ   N GNYV+R ++GTPGQ+++MVLDTS+D A+VPCSGC GCS 
Sbjct  76   -LAQKTVSSAPIASGQ-AFNIGNYVVRVKLGTPGQLLFMVLDTSTDEAFVPCSGCTGCST  133

Query  535  TVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            T F+P  S+++  ++CSVP+C  V G+SCP  G+GAC+FNQSY 
Sbjct  134  TTFSPKASTSYSPLDCSVPQCGQVRGLSCPATGTGACSFNQSYA  177



>ref|XP_002514026.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF48609.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=437

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            CA    +S+LS++ IY KCSPF  P      + TV++MA KDPARL YLSSL A   +  
Sbjct  25   CASQADDSDLSIIPIYSKCSPFIPPK-QEPLVNTVIDMASKDPARLKYLSSLAA---QMT  80

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            T VPIA GQ VLN GNYV+R ++GTPGQ M+MVLDTS+D AWVPCSGC GCS T F+ NT
Sbjct  81   TAVPIAPGQQVLNIGNYVVRVKLGTPGQFMFMVLDTSNDAAWVPCSGCTGCSSTTFSTNT  140

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SST+GS++CS+ +C+ V G SCP  GS +C FNQSYG
Sbjct  141  SSTYGSLDCSMAQCTQVRGFSCPATGSSSCVFNQSYG  177



>ref|XP_008219289.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=443

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +  + +LS++  Y KCSPF+ P    SW+TTV+NMA +DPAR++YLS+L A K    T+ 
Sbjct  31   SDGSQDLSIIPTYSKCSPFSPPK-ADSWVTTVLNMASRDPARVNYLSTLVAQK---TTSA  86

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
            PIASGQ VLN  NYV+R ++GTPGQ+M+MVLDTS+D AW PCSGC GCS T F+ N+S+T
Sbjct  87   PIASGQQVLNIANYVVRLKLGTPGQLMFMVLDTSNDIAWAPCSGCTGCSSTTFSTNSSTT  146

Query  565  FGSVECSVPECSMVNGMSCP-TGGSGA--CNFNQSYG  666
            + S++CSVPEC+   G+SCP TG  GA  C FNQSYG
Sbjct  147  YKSLDCSVPECAQARGLSCPATGSPGANGCFFNQSYG  183



>gb|ACE96805.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96806.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96807.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96808.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96809.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96810.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96811.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96812.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96813.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96814.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96815.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96816.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96818.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96819.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96820.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96821.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96822.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96823.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96824.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96825.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96826.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96827.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96828.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96829.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96830.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96831.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96832.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96833.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96834.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96835.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96836.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96837.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96838.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96839.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96840.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96841.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96842.1| aspartyl protease, partial [Populus tremula]
Length=339

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  SWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQV  462
            SW+ TV+ MA KDP RL YLS+L   K    T VPIA GQ VL   NYV+R ++GTPGQ 
Sbjct  1    SWVNTVITMASKDPERLKYLSTLADQK---TTAVPIAPGQQVLKIANYVVRVKLGTPGQQ  57

Query  463  MYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGA  642
            M+MVLDTS+D AWVPCSGC GCS T F PN S+T GS++CS  +CS V G SCP  GS A
Sbjct  58   MFMVLDTSNDAAWVPCSGCTGCSSTTFLPNASTTLGSLDCSEAQCSQVRGFSCPATGSSA  117

Query  643  CNFNQSYG  666
            C FNQSYG
Sbjct  118  CLFNQSYG  125



>gb|ACE96817.1| aspartyl protease, partial [Populus tremula]
Length=339

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  SWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQV  462
            SW+ TV+ MA KDP RL YLS+L   K    T VPIA GQ VL   NYV+R ++GTPGQ 
Sbjct  1    SWVNTVITMASKDPERLKYLSTLADQK---TTAVPIAPGQQVLKIANYVVRVKLGTPGQQ  57

Query  463  MYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGA  642
            M+MVLDTS+D AWVPCSGC GCS T F PN S+T GS++CS  +CS V G SCP  GS A
Sbjct  58   MFMVLDTSNDAAWVPCSGCTGCSSTTFLPNASTTLGSLDCSEAQCSQVRGFSCPATGSSA  117

Query  643  CNFNQSYG  666
            C FNQSYG
Sbjct  118  CLFNQSYG  125



>ref|XP_006841210.1| hypothetical protein AMTR_s00135p00030880 [Amborella trichopoda]
 gb|ERN02885.1| hypothetical protein AMTR_s00135p00030880 [Amborella trichopoda]
Length=430

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 16/159 (10%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P+ A++ L ++HI+GKCSPF  P+ TSSW  TVM+MA  DPARL+YL++L        T 
Sbjct  30   PDDADT-LPILHIHGKCSPFAAPS-TSSWPDTVMHMANNDPARLAYLANL-------ATV  80

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET----VFAP  549
            VPIAS Q +L+TGNY++RA+ GTPGQ+M+MVLDTS+D AWVPC+ C GC  T     F P
Sbjct  81   VPIASAQQILHTGNYIVRAKFGTPGQLMFMVLDTSNDAAWVPCTNCSGCPSTPSAASFTP  140

Query  550  NTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            N+SST+  + C+VP C+     SC    SG C FNQSYG
Sbjct  141  NSSSTYAPLPCTVPACTQARLPSC---VSGLCYFNQSYG  176



>ref|XP_008378576.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2 [Malus domestica]
Length=424

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 106/146 (73%), Gaps = 4/146 (3%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +  + +LS++  Y KCSPF++P  T S +T V+NMA KDP R++YLS+     P+  T+ 
Sbjct  30   SDGSDDLSIIPTYSKCSPFSSPK-TDSLVTXVLNMASKDPTRVNYLSTPV---PQKTTSA  85

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
             IASGQ VLN  NYV++ ++GTP Q+M +VLDTS+D AW PCSGC GCS T F+PN+SST
Sbjct  86   SIASGQQVLNIANYVVQLKLGTPSQLMNIVLDTSNDIAWAPCSGCTGCSSTTFSPNSSST  145

Query  565  FGSVECSVPECSMVNGMSCPTGGSGA  642
            +GS+ECSV EC+   G+SCP  GS A
Sbjct  146  YGSLECSVSECAQARGLSCPATGSTA  171



>ref|XP_007141254.1| hypothetical protein PHAVU_008G180500g [Phaseolus vulgaris]
 gb|ESW13248.1| hypothetical protein PHAVU_008G180500g [Phaseolus vulgaris]
Length=470

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 111/170 (65%), Gaps = 7/170 (4%)
 Frame = +1

Query  169  SNTASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSS  348
            S  A AT  CA    +S + V+ IYG CSPF N   + SW TT+++MA KDP R+ YL  
Sbjct  45   STLAIATDPCASEHDDSGIVVIPIYGNCSPFKNL--SDSWDTTIIDMASKDPLRVEYLFG  102

Query  349  LTA-LKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVG  525
            L A L+ K  +  PIASGQ   N GNYV+R ++GTPGQ+ +MVLDTS+D AWVPC+GC G
Sbjct  103  LDASLRKKRVSAAPIASGQ-AFNIGNYVVRVKLGTPGQLFFMVLDTSTDEAWVPCTGCTG  161

Query  526  C-SETVFAPNTSSTF-GSVECSVPECSMVNG-MSCPTGGSGACNFNQSYG  666
            C S T ++P  S+T+ G+V C  P C+   G + CP  GS AC FNQSY 
Sbjct  162  CSSSTTYSPQASTTYGGAVACYAPRCAQARGSLPCPNTGSNACIFNQSYA  211



>ref|XP_006307264.1| hypothetical protein CARUB_v10008880mg [Capsella rubella]
 gb|EOA40162.1| hypothetical protein CARUB_v10008880mg [Capsella rubella]
Length=513

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP+ ++ +LS++ I  KCSPF   +P+SS +  V++MA  D  RL+YLSSL A KPK  T
Sbjct  97   APDGSD-DLSIIPINAKCSPFAPTHPSSSVIDNVLHMASSDSHRLTYLSSLVAGKPK-PT  154

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS--ETVFAPN  552
            + PIASG N L+TGNYV+RAR+GTP Q+M+MVLDTS+D  W+PCSGC GCS     F PN
Sbjct  155  SAPIASG-NQLHTGNYVVRARLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSAASAAFNPN  213

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGG--SGACNFNQSYG  666
            +SST+ +V CS  +C+  +G++CP+       C+FNQSYG
Sbjct  214  SSSTYSTVSCSTAQCTQAHGLTCPSSSPQPSVCSFNQSYG  253



>ref|XP_006417541.1| hypothetical protein EUTSA_v10007613mg [Eutrema salsugineum]
 gb|ESQ35894.1| hypothetical protein EUTSA_v10007613mg [Eutrema salsugineum]
Length=450

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 114/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFN-NPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            AP+ ++ +LS++ I  KCSPF   PN  SS + TV++MA  D  RL+YLSSL A KPK  
Sbjct  32   APDGSD-DLSIIPINAKCSPFAAKPNSASSVMDTVLHMASTDSHRLTYLSSLVASKPK-P  89

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            T+VP+AS   +L+TGNYV+RAR+GTP Q+M+MVLDTS+D  W+PCSGC GCS    F PN
Sbjct  90   TSVPVASANQLLHTGNYVVRARLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSTAAYFNPN  149

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGA---CNFNQSYG  666
            +SST+ +V CS  +C+   G++CP+        C+FNQSYG
Sbjct  150  SSSTYSTVSCSTAQCTQSRGLTCPSSSPSPPSICSFNQSYG  190



>ref|XP_010276658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=440

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 99/151 (66%), Gaps = 5/151 (3%)
 Frame = +1

Query  214  NSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIA  393
            +S L VMHIY  CSPF  P    SW  TV++MA +D ARL YLSSL A    G++ VPIA
Sbjct  36   DSTLPVMHIYSPCSPFRPPK-ALSWEQTVLDMAARDEARLQYLSSLVA----GRSVVPIA  90

Query  394  SGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGS  573
            SG+ +L T  Y++R +IGTP Q + M +DTSSD AW+PC+GCVGCS  VF+   S+T+ +
Sbjct  91   SGRQLLQTPTYIVRTKIGTPAQTLLMAMDTSSDVAWIPCTGCVGCSPNVFSTGKSTTYKA  150

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V C  P+C  V   SC      AC+FN +YG
Sbjct  151  VGCQAPQCKQVPNPSCIGTLRKACSFNLTYG  181



>ref|XP_010269414.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Nelumbo nucifera]
Length=434

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 99/150 (66%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L +MHIY  CSPF  P+   SW  TV++MA KD ARL YLSSL A     ++ VPIAS
Sbjct  35   STLQIMHIYSPCSPFR-PSRQLSWEQTVLDMAAKDEARLQYLSSLVA----KRSIVPIAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ +L T  Y++RA++GTP Q + M +DTSSD AW+PCSGCVGCS  VF  N S+T+ +V
Sbjct  90   GRQLLQTPTYIVRAKLGTPAQTLLMAMDTSSDAAWIPCSGCVGCSSNVFVANLSTTYKTV  149

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C  P+C  V     PT    AC+FN +YG
Sbjct  150  GCQSPQCKQVPN---PTCAGTACSFNLTYG  176



>ref|XP_009110804.1| PREDICTED: aspartic proteinase nepenthesin-1 [Brassica rapa]
Length=452

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 116/165 (70%), Gaps = 12/165 (7%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTS-SWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            AP+ ++ +LS++ +  +CSPF   NPTS S + TV++MA  D  RL+YLSSL A KP  +
Sbjct  31   APDGSD-DLSIIPVNARCSPFA-ANPTSTSVMDTVLHMASADSHRLAYLSSLVADKPN-R  87

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV----F  543
            T+VP+AS   +L+TGNYV+RAR+GTP Q+M+MVLDTS+D  W+PCSGC GCS       F
Sbjct  88   TSVPVASANQLLHTGNYVVRARLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSTAATAAYF  147

Query  544  APNTSSTFGSVECSVPECSMVNGMSC----PTGGSGACNFNQSYG  666
             PN+SST+ +V CS  +C+   G++C    P+  S  C+FNQSYG
Sbjct  148  NPNSSSTYSTVSCSAAQCTQARGLTCPSSSPSPPSSVCSFNQSYG  192



>emb|CDY31067.1| BnaA08g26170D [Brassica napus]
Length=452

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 116/165 (70%), Gaps = 12/165 (7%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTS-SWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            AP+ ++ +LS++ +  +CSPF   NPTS S + TV++MA  D  RL+YLSSL A KP  +
Sbjct  31   APDGSD-DLSIIPVNARCSPFA-ANPTSTSVMDTVLHMASADSHRLAYLSSLVADKPN-R  87

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV----F  543
            T+VP+AS   +L+TGNYV+RAR+GTP Q+M+MVLDTS+D  W+PCSGC GCS       F
Sbjct  88   TSVPVASANQLLHTGNYVVRARLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSTAATAAYF  147

Query  544  APNTSSTFGSVECSVPECSMVNGMSC----PTGGSGACNFNQSYG  666
             PN+SST+ +V CS  +C+   G++C    P+  S  C+FNQSYG
Sbjct  148  NPNSSSTYSTVSCSAAQCTQARGLTCPSSSPSPPSSVCSFNQSYG  192



>ref|XP_010067725.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Eucalyptus 
grandis]
 gb|KCW65904.1| hypothetical protein EUGRSUZ_G03227 [Eucalyptus grandis]
Length=439

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 103/158 (65%), Gaps = 8/158 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C+     S L V+HIY  CSPF  P P+ SW  +V+ M  +D ARL +LSSL A    GK
Sbjct  30   CSVQDQGSTLEVLHIYSPCSPFRPPTPSLSWEESVLQMQQEDQARLQFLSSLVA----GK  85

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPN  552
            + VP+ASG+ ++ +  Y++RA+IGTP Q M M +DTS+D AWVPCSGCVGC S   FA  
Sbjct  86   SVVPVASGRQIIQSPTYILRAKIGTPPQTMLMAMDTSNDAAWVPCSGCVGCPSSAAFASA  145

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             S+T+ ++ C  P+CS V   S PT G GAC FN +YG
Sbjct  146  KSTTYKNLPCKSPQCSQV---SKPTCGGGACLFNMTYG  180



>ref|XP_003519197.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max]
Length=451

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 107/159 (67%), Gaps = 8/159 (5%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTA-LKPKGKTN  381
            +  +S+++++ IYG CSPF N   ++SW   +++MA KDP R+ YLSSL A L+ K  + 
Sbjct  37   DDDDSDITMIPIYGNCSPFKNY--STSWENIIIDMASKDPERVVYLSSLDASLRRKPISA  94

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC--SETVFAPNT  555
             PIASGQ     G+YV+R ++G+P Q+ +MVLDTS+D AWVPC+GC GC  S T ++P  
Sbjct  95   APIASGQ-AFGIGSYVVRVKLGSPNQLFFMVLDTSTDEAWVPCTGCTGCSSSSTYYSPQA  153

Query  556  SSTF-GSVECSVPECSMVNG-MSCPTGGSGACNFNQSYG  666
            S+T+ G+V C  P C+   G + CP  GS AC FNQSY 
Sbjct  154  STTYGGAVACYAPRCAQARGALPCPYTGSKACTFNQSYA  192



>ref|XP_003522900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
 gb|KHN06647.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=439

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 100/157 (64%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H++  CSPF  P P S W  +V+ +  KD ARL +L+S+ A    G+
Sbjct  27   CDTQDHGSTLEVFHVFSPCSPFRPPKPLS-WAESVLQLQAKDQARLQFLASMVA----GR  81

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IG+P Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  82   SVVPIASGRQIIQSPTYIVRAKIGSPPQTLLLAMDTSNDAAWIPCTACDGCTSTLFAPEK  141

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C  P+C+ V   SC   G+ AC FN +YG
Sbjct  142  STTFKNVSCGSPQCNQVPNPSC---GTSACTFNLTYG  175



>gb|ACJ85302.1| unknown [Medicago truncatula]
Length=259

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V+H++  CSPF    P S W  +V+ M  KD  RL +L SL A     K
Sbjct  22   CDVQDNGSTLQVIHVFSPCSPFRPSKPLS-WEESVLQMQAKDTTRLQFLDSLVA----RK  76

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  77   SIVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAMDTSNDAAWIPCTACDGCASTLFAPEK  136

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C+ PEC  V    C   G  +CNFN +YG
Sbjct  137  STTFKNVSCAAPECKQVPNPGC---GVSSCNFNLTYG  170



>ref|XP_003538263.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=438

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H++  CSPF    P S W  +V+ +  KD ARL +L+S+ A    G+
Sbjct  26   CDTQDHGSTLEVFHVFSPCSPFRPSKPLS-WAESVLQLQAKDQARLQFLASMVA----GR  80

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  81   SIVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAIDTSNDAAWIPCTACDGCTSTLFAPEK  140

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C  PEC+ V   SC   G+ AC FN +YG
Sbjct  141  STTFKNVSCGSPECNKVPSPSC---GTSACTFNLTYG  174



>ref|XP_007148927.1| hypothetical protein PHAVU_005G025900g [Phaseolus vulgaris]
 gb|ESW20921.1| hypothetical protein PHAVU_005G025900g [Phaseolus vulgaris]
Length=436

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 100/157 (64%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H++  CSPF  P+   SW  +V+ +  KD +R+ +L+SL A    G+
Sbjct  26   CDTQDHGSTLQVFHVFSPCSPFR-PSKALSWEESVLQLQAKDQSRMQFLASLVA----GR  80

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  81   SVVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAMDTSNDAAWIPCTACEGCTSTLFAPEK  140

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C  PEC  V   SC   GS +C+FN +YG
Sbjct  141  STTFKNVSCGAPECKQVPNPSC---GSSSCSFNLTYG  174



>gb|KFK43273.1| hypothetical protein AALP_AA1G102700 [Arabis alpina]
Length=473

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 111/160 (69%), Gaps = 6/160 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP+ ++ +LS++ I  KCSPF     +SS + TV++MA  D  RL+YLSSL A KPK  T
Sbjct  33   APDGSD-DLSIIPINAKCSPFAVKPSSSSVMDTVLHMANADSHRLNYLSSLVAGKPK-PT  90

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS-ETVFAPNT  555
            +VP+ASG    +TGNYV+RA++GTP Q+M+MVLDTS+D  W+PC+GC  CS    F PN+
Sbjct  91   SVPVASGNQNFHTGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCTGCSDCSTAATFNPNS  150

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGA---CNFNQSYG  666
            S+T+ ++ CS  +C+   G++CP+        C+FNQSYG
Sbjct  151  STTYSTLSCSTAQCTQARGLTCPSSSPSPPSICSFNQSYG  190



>ref|XP_002513044.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49547.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=431

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 94/157 (60%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H+Y  CSPF    P   W  +V+ M  KD ARL +LSSL A     K
Sbjct  25   CGIQDQGSNLQVFHVYSPCSPFWPSKPLK-WEESVLQMQAKDQARLQFLSSLVA----RK  79

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q M + +DTS+D AW+PCSGCVGCS TVF    
Sbjct  80   SVVPIASGRQIVQSPTYIVRAKIGTPAQTMLLAMDTSNDAAWIPCSGCVGCSSTVFNNVK  139

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C  P+C  V    C   G  AC FN +YG
Sbjct  140  STTFKTVGCEAPQCKQVPNSKC---GGSACAFNMTYG  173



>gb|KDP40540.1| hypothetical protein JCGZ_24539 [Jatropha curcas]
Length=431

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C+     S L V H+Y  CSPF    P S W  +V+ M  KD ARL +LSSL A    G+
Sbjct  25   CSSQDQGSTLQVFHVYSPCSPFRPSKPLS-WEESVLQMQAKDQARLQFLSSLVA----GR  79

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PCSGC GCS TVF    
Sbjct  80   SFVPIASGRQIIQSPTYIVRAKIGTPAQTLLLAVDTSNDAAWIPCSGCDGCSSTVFDSVK  139

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S++F +V C  P+C  V     PT    AC FN +YG
Sbjct  140  STSFQTVGCGAPQCKQVPN---PTCSGSACTFNTTYG  173



>gb|KJB74994.1| hypothetical protein B456_012G018300 [Gossypium raimondii]
Length=429

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V HIY +CSPF    P S W   +++M  KD ARL YLSSL A    GK
Sbjct  23   CDTQDHGSTLQVFHIYSQCSPFKPSKPLS-WEEDMLSMLAKDQARLQYLSSLVA----GK  77

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VP+ASG+ ++ +  Y++RA+IGTP Q M M +DTS+D AW+PC+GC+GCS  VF    
Sbjct  78   SVVPVASGRQIVQSPTYIVRAKIGTPPQTMLMAMDTSNDAAWIPCNGCIGCSSKVFNTAK  137

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF ++ C   +C  V     PT G  AC FN +YG
Sbjct  138  STTFNTLGCHAAQCKQVPN---PTCGGSACVFNMTYG  171



>ref|XP_006432439.1| hypothetical protein CICLE_v10001212mg [Citrus clementina]
 ref|XP_006465750.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|ESR45679.1| hypothetical protein CICLE_v10001212mg [Citrus clementina]
 gb|KDO58854.1| hypothetical protein CISIN_1g039412mg [Citrus sinensis]
Length=433

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 96/158 (61%), Gaps = 7/158 (4%)
 Frame = +1

Query  193  FCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKG  372
             C     +S L V H++  CSPF    P S W  +V+ M  KD ARL +LSSL   +   
Sbjct  24   ICDTQDHSSTLQVFHVFSPCSPFKPSKPLS-WEESVLEMLAKDQARLQFLSSLAVAR---  79

Query  373  KTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPN  552
            K+ VPIASG+ +  +  Y++RA+IGTP Q + M +DTS+D AWVPC+GCVGCS TVF   
Sbjct  80   KSVVPIASGRQITQSPTYIVRAKIGTPAQTLLMAMDTSNDAAWVPCTGCVGCSSTVFNSA  139

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             S+TF ++ C   +C  V     PT G GAC FN +YG
Sbjct  140  QSTTFKNLGCQAAQCKQVPN---PTCGGGACAFNLTYG  174



>ref|XP_010458274.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Camelina sativa]
Length=448

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP+ ++ +LS++ I  KCSPF   + +SS + TV++MA  D  RL+YLSSL + KPK   
Sbjct  32   APDGSD-DLSIIPINAKCSPFAPTHASSSVIDTVLHMASSDSHRLTYLSSLVSGKPK-PI  89

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE--TVFAPN  552
            +VPIASG N L+TGNYV+RA++GTP Q+M+MVLDTS+D  WVPCSGC GCS     F PN
Sbjct  90   SVPIASG-NQLHTGNYVVRAKLGTPPQLMFMVLDTSNDAVWVPCSGCSGCSADSPSFNPN  148

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGG--SGACNFNQSYG  666
            +SST+ +V CS  +C+  +G++CP+       C+FNQSYG
Sbjct  149  SSSTYSTVSCSTAQCTQAHGLTCPSSSLQPSICSFNQSYG  188



>emb|CDY20675.1| BnaC08g13830D [Brassica napus]
Length=451

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 11/164 (7%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTS-SWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            AP+ ++ +LS++ +  +CSPF   NPTS S + TV++MA  D  RL YLSSL A KP  +
Sbjct  31   APDGSD-DLSIIPVNARCSPFA-ANPTSTSVMDTVLHMASADSHRLIYLSSLVADKPN-R  87

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV----F  543
            T+VPIAS   +L+TGNYV+R+R+GTP Q+M+MVLDTS+D  W+PCSGC GCS       F
Sbjct  88   TSVPIASANQLLHTGNYVVRSRLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSTAATAACF  147

Query  544  APNTSSTFGSVECSVPECSMVNGM---SCPTGGSGACNFNQSYG  666
             PN+SST+ +V CS  EC+   G+   S        C+FNQSYG
Sbjct  148  NPNSSSTYSTVSCSAAECTQARGLTCPSSSPSPPSTCSFNQSYG  191



>ref|XP_002264626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=437

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V+H+Y  CSPF    P S W  +V+ M  KD ARL +LSSL A     K
Sbjct  30   CETPDQGSTLQVLHVYSPCSPFRPKEPLS-WEESVLQMQAKDKARLQFLSSLVA----RK  84

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++    Y++RA+IGTP Q M M +DTSSD AW+PC+GC+GCS T+F    
Sbjct  85   SVVPIASGRQIVQNPTYIVRAKIGTPAQTMLMAMDTSSDVAWIPCNGCLGCSSTLFNSPA  144

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+T+ S+ C   +C  V     PT G G C+FN +YG
Sbjct  145  STTYKSLGCQAAQCKQVPK---PTCGGGVCSFNLTYG  178



>gb|KHN21324.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=353

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 10/157 (6%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H++  CSP   P+   SW  +V+ +  KD ARL +L+S+ A    G+
Sbjct  26   CDTQDHGSTLEVFHVFSPCSP---PSKPLSWAESVLQLQAKDQARLQFLASMVA----GR  78

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  79   SIVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAIDTSNDAAWIPCTACDGCTSTLFAPEK  138

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C  PEC+ V   SC   G+ AC FN +YG
Sbjct  139  STTFKNVSCGSPECNKVPSPSC---GTSACTFNLTYG  172



>gb|KJB60281.1| hypothetical protein B456_009G297800 [Gossypium raimondii]
Length=432

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 93/157 (59%), Gaps = 6/157 (4%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V HIY  CSPF  P+   SW   V+    KD ARL YLSSL A     K
Sbjct  24   CETQDHGSNLQVFHIYSPCSPFK-PSKPLSWEEDVLQTQAKDQARLQYLSSLVA----KK  78

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA IGTP Q + M +DTS+D AW+PC+GC+GCS TVF    
Sbjct  79   SVVPIASGRQIVQSPTYIVRANIGTPPQTLLMAMDTSNDAAWIPCTGCLGCSSTVFDNAK  138

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF S+ C  P+C  V   SC  G    C FN +YG
Sbjct  139  STTFQSLGCQAPQCKQVQNPSC-DGSGNTCIFNMTYG  174



>gb|AGV54394.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=436

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 100/157 (64%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H++  CSPF  P+   SW  +V+ +  KD +R+ +L+SL A    G+
Sbjct  26   CDTQDHGSTLQVFHVFSPCSPFR-PSKALSWEESVLQLQAKDQSRMQFLASLVA----GR  80

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  81   SVVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAMDTSNDAAWIPCTACDGCTSTLFAPEK  140

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C  PEC  V   SC   G+ +C+FN +YG
Sbjct  141  STTFKNVSCGAPECHQVPNPSC---GNSSCSFNLTYG  174



>gb|KHN26127.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=391

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = +1

Query  229  VMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTA-LKPKGKTNVPIASGQN  405
            ++ IYG CSPF N   ++SW   +++MA KDP R+ YLSSL A L+ K  +  PIASGQ 
Sbjct  1    MIPIYGNCSPFKNY--STSWENIIIDMASKDPERVVYLSSLDASLRRKPISAAPIASGQ-  57

Query  406  VLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC--SETVFAPNTSSTF-GSV  576
                G+YV+R ++G+P Q+ +MVLDTS+D AWVPC+GC GC  S T ++P  S+T+ G+V
Sbjct  58   AFGIGSYVVRVKLGSPNQLFFMVLDTSTDEAWVPCTGCTGCSSSSTYYSPQASTTYGGAV  117

Query  577  ECSVPECSMVNG-MSCPTGGSGACNFNQSY  663
             C  P C+   G + CP  GS AC FNQSY
Sbjct  118  ACYAPRCAQARGALPCPYTGSKACTFNQSY  147



>gb|KEH40928.1| aspartic proteinase nepenthesin-like protein [Medicago truncatula]
Length=429

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V+H++  CSPF    P S W  +V+ M  KD  RL +L SL A     K
Sbjct  22   CDVQDNGSTLQVIHVFSPCSPFRPSKPLS-WEESVLQMQAKDTTRLQFLDSLVA----RK  76

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  77   SIVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAMDTSNDAAWIPCTACDGCASTLFAPEK  136

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C+ PEC  V    C   G  +CNFN +YG
Sbjct  137  STTFKNVSCAAPECKQVPNPGC---GVSSCNFNLTYG  170



>gb|EPS72919.1| hypothetical protein M569_01840 [Genlisea aurea]
Length=431

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 102/154 (66%), Gaps = 15/154 (10%)
 Frame = +1

Query  211  ANSELSVMHIYGKCSPFNNPNPTSS--WLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            ++S+LS++HI+G CSPF  P   S   WL        KD  R+SYL++    +P    + 
Sbjct  29   SHSDLSIVHIHGPCSPFRRPRAASPMPWLD-----ETKDLERVSYLAN----RP---ISA  76

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
            P+ASGQ V   GNYV+R +IG+PGQ MY VLDTSSD  WVPC+GC GC    F  ++S++
Sbjct  77   PVASGQAVGIIGNYVVRIKIGSPGQTMYTVLDTSSDVGWVPCTGCTGCGTAQFDTSSSTS  136

Query  565  FGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +  ++C++P+C+  NG SCPT GS +C FNQSYG
Sbjct  137  YEPLDCTLPQCTFANGASCPTTGS-SCLFNQSYG  169



>ref|XP_010095993.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62686.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=435

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 93/150 (62%), Gaps = 6/150 (4%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L V H+Y  CSP   P+  +SW  +V+ M  +D  RL YLSSL      GK+ VPIAS
Sbjct  34   STLQVFHVYSPCSPLRPPHAAASWEESVLQMQAEDKVRLQYLSSLAV---AGKSVVPIAS  90

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ ++ +  Y++RA+IGTP Q   + LDTS+D AW+PC GC+GCS TVF+P  S+++  +
Sbjct  91   GRQIVQSPTYIVRAKIGTPPQAFLLALDTSNDAAWIPCDGCLGCSSTVFSPLKSTSYKPL  150

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             CS  +C  V     PT    AC FN +YG
Sbjct  151  PCSAAQCKQVPN---PTCDGSACGFNLTYG  177



>ref|XP_009122387.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=439

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL+SL A    G++ VP+AS
Sbjct  35   STLRIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLTSLVA----GRSVVPVAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A+IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S+TF +
Sbjct  90   GRQMLQSTTYIVKAKIGTPAQSLLLAMDTSSDVAWLPCSGCVGCPSTTAFSPAKSTTFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT GS AC+FN +YG
Sbjct  150  VSCSAPQCKQVPN---PTCGSRACSFNLTYG  177



>emb|CDX70001.1| BnaA10g23500D [Brassica napus]
Length=439

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL+SL A    G++ VP+AS
Sbjct  35   STLRIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLTSLVA----GRSVVPVAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A+IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S+TF +
Sbjct  90   GRQMLQSTTYIVKAKIGTPAQSLLLAMDTSSDVAWLPCSGCVGCPSTTAFSPAKSTTFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT GS AC+FN +YG
Sbjct  150  VSCSAPQCKQVPN---PTCGSRACSFNLTYG  177



>emb|CDX99015.1| BnaC09g48200D [Brassica napus]
Length=439

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL+SL A    G++ VP+AS
Sbjct  35   STLRIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLTSLVA----GRSVVPVAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A+IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S+TF +
Sbjct  90   GRQMLQSTTYIVKAKIGTPAQSLLLAMDTSSDVAWLPCSGCVGCPSTTAFSPAKSTTFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT GS AC+FN +YG
Sbjct  150  VSCSAPQCKQVPN---PTCGSRACSFNLTYG  177



>ref|XP_006399181.1| hypothetical protein EUTSA_v10013504mg [Eutrema salsugineum]
 gb|ESQ40634.1| hypothetical protein EUTSA_v10013504mg [Eutrema salsugineum]
Length=455

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 99/151 (66%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL+SL A    G++ VPIAS
Sbjct  51   STLRIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLTSLVA----GRSVVPIAS  105

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A+IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S+TF +
Sbjct  106  GRQMLQSTTYIVKAQIGTPAQSLLLAMDTSSDVAWLPCSGCVGCPSTTAFSPVKSTTFKN  165

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT GS AC+FN +YG
Sbjct  166  VSCSAPQCKQVPN---PTCGSRACSFNLTYG  193



>ref|XP_004498691.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=429

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V+H++  CSPF  P+   SW  +V+ M  KD  RL +L SL A     K
Sbjct  22   CNLQDHGSTLQVIHVFSPCSPFR-PSKPLSWEESVLQMQAKDKTRLQFLDSLVA----RK  76

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GCS T+F P  
Sbjct  77   SVVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAMDTSNDAAWIPCTACDGCSSTLFGPER  136

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C+ PEC  V    C   G  +CNFN +YG
Sbjct  137  STTFKNVSCASPECKQVPNPGC---GLSSCNFNLTYG  170



>ref|XP_002873291.1| hypothetical protein ARALYDRAFT_487523 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49550.1| hypothetical protein ARALYDRAFT_487523 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 98/151 (65%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF +P+P S W   V+    +D ARL YLSSL A    G++ VPIAS
Sbjct  35   STLRIFHIDSPCSPFKSPSPLS-WEARVLQTLAQDQARLQYLSSLVA----GRSVVPIAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++  IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S++F +
Sbjct  90   GRQMLQSTTYIVKVLIGTPAQPLLLAMDTSSDVAWIPCSGCVGCPSNTAFSPAKSTSFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V   +C   G+ AC+FN +YG
Sbjct  150  VSCSAPQCKQVPNPAC---GARACSFNLTYG  177



>ref|XP_009130976.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=439

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 99/151 (66%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL+SL A    G++ VP+AS
Sbjct  35   STLKIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLTSLVA----GRSVVPVAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A+IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S+T+ +
Sbjct  90   GRQMLQSATYIVKAKIGTPAQTLLLAMDTSSDVAWLPCSGCVGCPSTTAFSPAKSTTYKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V C+ P+C  V     PT GS AC+FN +YG
Sbjct  150  VSCNAPQCKQVPN---PTCGSSACSFNLTYG  177



>emb|CDY58878.1| BnaA03g55560D [Brassica napus]
Length=440

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 99/151 (66%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL+SL A    G++ VP+AS
Sbjct  36   STLKIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLTSLVA----GRSVVPVAS  90

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A+IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S+T+ +
Sbjct  91   GRQMLQSATYIVKAKIGTPAQTLLLAMDTSSDVAWLPCSGCVGCPSTTAFSPAKSTTYKN  150

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V C+ P+C  V     PT GS AC+FN +YG
Sbjct  151  VSCNAPQCKQVPN---PTCGSSACSFNLTYG  178



>ref|XP_004307094.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=440

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 94/156 (60%), Gaps = 7/156 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            A N   S+L V H+Y  CSPF  P  T SW   V+    KD ARL +L+SL   K   K+
Sbjct  33   ATNDHGSDLQVFHVYSPCSPFR-PAQTLSWEEDVLQTLAKDQARLQFLASLAGAK---KS  88

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTS  558
             VPIASG+ ++ +  Y++RA+IGTP Q + M +DTSSD AWVPC+GCVGCS  VF    S
Sbjct  89   IVPIASGRQIIQSPTYIVRAKIGTPPQTLLMAVDTSSDAAWVPCNGCVGCSSNVFNSLKS  148

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +TF SV C  P+C      SC       C+FN +YG
Sbjct  149  TTFKSVGCGAPQCKQAPNPSC---LGSTCSFNMTYG  181



>gb|KHG09833.1| Asparticase nepenthesin-1 [Gossypium arboreum]
Length=429

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 94/157 (60%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V HIY +CSP   P+   SW   +++M  KD ARL YLSSL A    GK
Sbjct  23   CDIQDHGSTLQVFHIYSQCSPLK-PSKPLSWEEDMLSMLAKDQARLQYLSSLVA----GK  77

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VP+ASG+ ++ +  Y++R +IGTP Q M M +DTS+D AW+PC GC+GCS  VF    
Sbjct  78   SVVPVASGRQIVQSPTYIVRVKIGTPPQTMLMAMDTSNDAAWIPCKGCIGCSSKVFNTAK  137

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF ++ C   +C  V     PT G  AC FN +YG
Sbjct  138  STTFNTLGCHAAQCKQVPN---PTCGRSACIFNMTYG  171



>dbj|BAB11161.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
 gb|AAM62745.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
 gb|ABG25087.1| At5g07030 [Arabidopsis thaliana]
Length=439

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 98/151 (65%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YLSSL A    G++ VPIAS
Sbjct  35   STLRIFHIDSPCSPFKSSSPLS-WEARVLQTLAQDQARLQYLSSLVA----GRSVVPIAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S++F +
Sbjct  90   GRQMLQSTTYIVKALIGTPAQPLLLAMDTSSDVAWIPCSGCVGCPSNTAFSPAKSTSFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT G+ AC+FN +YG
Sbjct  150  VSCSAPQCKQVPN---PTCGARACSFNLTYG  177



>ref|NP_563851.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAB60729.1| F21M12.13 gene product [Arabidopsis thaliana]
 gb|AAM65914.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
 gb|AAN86165.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28488.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=449

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP+ ++ +LS++ I  KCSPF   + ++S + TV++MA  D  RL+YLSSL A KPK  T
Sbjct  32   APDGSD-DLSIIPINAKCSPFAPTHVSASVIDTVLHMASSDSHRLTYLSSLVAGKPK-PT  89

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE--TVFAPN  552
            +VP+ASG N L+ GNYV+RA++GTP Q+M+MVLDTS+D  W+PCSGC GCS   T F  N
Sbjct  90   SVPVASG-NQLHIGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSNASTSFNTN  148

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGG--SGACNFNQSYG  666
            +SST+ +V CS  +C+   G++CP+       C+FNQSYG
Sbjct  149  SSSTYSTVSCSTAQCTQARGLTCPSSSPQPSVCSFNQSYG  188



>ref|XP_010490295.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Camelina sativa]
Length=448

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP+ ++ +LS++ I  KCSPF   + ++S + TV++MA  D  RL+YLSSL A KPK   
Sbjct  32   APDGSD-DLSIIPINAKCSPFAPTHASASVIDTVLHMASSDSHRLTYLSSLVAGKPK-PI  89

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE--TVFAPN  552
            +VPIASG N L+TGNYV+RA++GTP Q+M+MVLDTS+D  W+PCSGC GC+     F PN
Sbjct  90   SVPIASG-NQLHTGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCSGCSGCAADSPSFNPN  148

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGG--SGACNFNQSYG  666
            +SST+ +V CS  +C+  +G +CP+       C+FNQSYG
Sbjct  149  SSSTYSTVSCSTAQCTQAHGPTCPSSSPQPSICSFNQSYG  188



>ref|NP_196320.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AED91100.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=455

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 98/151 (65%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YLSSL A    G++ VPIAS
Sbjct  51   STLRIFHIDSPCSPFKSSSPLS-WEARVLQTLAQDQARLQYLSSLVA----GRSVVPIAS  105

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S++F +
Sbjct  106  GRQMLQSTTYIVKALIGTPAQPLLLAMDTSSDVAWIPCSGCVGCPSNTAFSPAKSTSFKN  165

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT G+ AC+FN +YG
Sbjct  166  VSCSAPQCKQVPN---PTCGARACSFNLTYG  193



>ref|XP_008782021.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=444

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 99/160 (62%), Gaps = 11/160 (7%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP    S L V+H +G CSPF+   P++SW  TV+++  +D +RL YL+SL   +   ++
Sbjct  34   APADGGSTLRVLHAFGPCSPFH---PSTSWEDTVLDLLSRDDSRLIYLASLATAR---RS  87

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAP---  549
             VPIA G+ VL T  YV+RAR+GTP Q + + LDTSSD AW+PCSGC GC  +  AP   
Sbjct  88   FVPIAPGRQVLQTPTYVVRARLGTPPQPLLLALDTSSDVAWLPCSGCTGCPYSAVAPLFD  147

Query  550  -NTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             + S+T   V C  P C  V   SCP  GS AC FN +YG
Sbjct  148  TSRSTTHRPVPCGAPPCWQVPNPSCPF-GSAACGFNLTYG  186



>ref|XP_010547361.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=439

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 96/151 (64%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF  P  +  W   V+ M   D ARL YLSSL A    GK+N+P+AS
Sbjct  35   STLKIFHIDSPCSPFK-PKTSLPWEARVLQMLADDEARLRYLSSLIA----GKSNIPVAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L T  Y+++AR+GTP Q + + +DTSSD  W PC+GCVGC S+T F+P  S+TF +
Sbjct  90   GRQILGTPTYIVKARVGTPAQSLLVAVDTSSDFTWFPCTGCVGCPSKTGFSPEKSTTFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V C+  +C  V     PT G+GAC FN +YG
Sbjct  150  VSCNSLQCRQVPN---PTCGTGACAFNLTYG  177



>gb|AFK39308.1| unknown [Medicago truncatula]
Length=425

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 95/157 (61%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V+H++  CSPF    P S W  +V+ M  KD  RL +L SL A     K
Sbjct  22   CDVQDNGSTLQVIHVFSPCSPFRPSKPLS-WEESVLQMQAKDTTRLQFLDSLVA----RK  76

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  77   SIVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAMDTSNDAAWIPCTACDGCASTLFAPEK  136

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C+ PEC  V    C   G  + NFN +YG
Sbjct  137  STTFKNVSCAAPECKQVPNPGC---GVSSRNFNLTYG  170



>ref|XP_009593615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=438

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 95/150 (63%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L V+H+   CSP  N N   SW+ TV+ M  KD ARL   +SL A    G++ VPIAS
Sbjct  37   STLQVLHVNSPCSPLRN-NAPQSWVDTVLQMQSKDQARLDLFASLVA----GRSFVPIAS  91

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ V+ +  Y++RA+IGTP Q + + +D S+D AW PCSGCVGCS TVFA + S+TF +V
Sbjct  92   GRQVIQSPTYIVRAKIGTPPQTLLVAVDNSNDVAWFPCSGCVGCSSTVFASDKSTTFKNV  151

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C   +CS V     PT G  +C FN +YG
Sbjct  152  SCGAAQCSQVPN---PTCGGSSCGFNLTYG  178



>ref|XP_009778175.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
sylvestris]
Length=442

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 95/150 (63%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L V+H+   CSP  +  P  SW+ TV+ M  KD ARL   +SL A    G++ VPIAS
Sbjct  41   STLQVLHVNSPCSPLRHNAP-QSWVDTVLQMQSKDQARLDLFASLVA----GRSFVPIAS  95

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ V+ T  Y++RA+IGTP Q + + +D S+D AW PCSGCVGCS TVFA + S+TF +V
Sbjct  96   GRQVIQTPTYIVRAKIGTPPQTLLVAVDNSNDVAWFPCSGCVGCSSTVFATDKSTTFKNV  155

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C   +CS V     PT G  +C FN +YG
Sbjct  156  SCGAAQCSQVPN---PTCGGSSCGFNLTYG  182



>ref|XP_002889768.1| hypothetical protein ARALYDRAFT_471076 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66027.1| hypothetical protein ARALYDRAFT_471076 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 113/160 (71%), Gaps = 7/160 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP+ ++ +LS++ I  KCSPF + + ++S + TV++MA  D  R +YLSSL A K K  T
Sbjct  33   APDGSH-DLSIIPINAKCSPFAHTHVSASVIDTVLHMASSDSHRFTYLSSLVAGKSK-PT  90

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE--TVFAPN  552
            +VP+ASG N L+ GNYV+RAR+GTP Q+M+MVLDTS+D  W+PCSGC GCS   T F  N
Sbjct  91   SVPVASG-NQLHIGNYVVRARLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSNASTSFNTN  149

Query  553  TSSTFGSVECSVPECSMVNGMSCP--TGGSGACNFNQSYG  666
            +SST+ +V CS  +C+   G++CP  T     C+FNQSYG
Sbjct  150  SSSTYSTVSCSTTQCTQARGLTCPSSTPQPSICSFNQSYG  189



>ref|XP_003627883.1| Aspartic proteinase nepenthesin-1 [Medicago truncatula]
 gb|AET02359.1| aspartic proteinase nepenthesin-like protein [Medicago truncatula]
Length=434

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 96/158 (61%), Gaps = 9/158 (6%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V HI+ +CSPF  P+   SW  +V+N+  KD AR+ Y SSL A     K
Sbjct  26   CDIQDDGSTLKVFHIFSQCSPFK-PSKPMSWEESVLNLQAKDQARMQYFSSLVA----RK  80

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            + VPIAS + ++ +  Y+++A+ GTP Q + + LDTSSD AW+PCSGCVGCS +  FAP 
Sbjct  81   SVVPIASARQIIQSPTYIVKAKFGTPPQTLLLALDTSSDAAWIPCSGCVGCSTSKPFAPI  140

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             S++F +V C  P C  V     PT G  AC FN +YG
Sbjct  141  KSTSFRNVSCGSPHCKQVPN---PTCGGSACAFNFTYG  175



>gb|AFK35790.1| unknown [Medicago truncatula]
Length=434

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 96/158 (61%), Gaps = 9/158 (6%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V HI+ +CSPF  P+   SW  +V+N+  KD AR+ Y SSL A     K
Sbjct  26   CDIQDDGSTLKVFHIFSQCSPFK-PSKPMSWEESVLNLQAKDQARMQYFSSLVA----RK  80

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            + VPIAS + ++ +  Y+++A+ GTP Q + + LDTSSD AW+PCSGCVGCS +  FAP 
Sbjct  81   SVVPIASARQIIQSPTYIVKAKFGTPPQTLLLALDTSSDAAWIPCSGCVGCSTSKPFAPI  140

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             S++F +V C  P C  V     PT G  AC FN +YG
Sbjct  141  KSTSFRNVSCGSPHCKQVPN---PTCGGSACAFNFTYG  175



>gb|KJB73116.1| hypothetical protein B456_011G215800 [Gossypium raimondii]
Length=317

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 91/157 (58%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H+Y  CSPF    P S W   V+    KD AR+ +LSSL A     K
Sbjct  24   CDIQDHGSNLQVFHVYSPCSPFKPSKPLS-WEEDVLQTLAKDQARVQFLSSLVA----KK  78

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y+++A IGTP Q M M +DTSSD AWVPC+GC+GCS T F    
Sbjct  79   SVVPIASGRQIVQSPTYIVKANIGTPPQPMLMAMDTSSDAAWVPCTGCIGCSSTAFDFAK  138

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF ++ C   +C  V     PT G  AC FN +YG
Sbjct  139  STTFKTLGCQAAQCKQVPN---PTCGGSACEFNMTYG  172



>ref|XP_007010960.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY19770.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=429

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 92/157 (59%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V HIY  CSPF    P S W   ++    KD ARL YLSSL A     K
Sbjct  23   CDTQDHGSNLQVFHIYSPCSPFKPSKPLS-WEEDLLQTQAKDQARLQYLSSLVA----KK  77

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q M M +DTS+D AW+PCSGC+GCS +VF    
Sbjct  78   SVVPIASGRQIVQSPTYIVRAKIGTPPQTMLMAMDTSNDAAWLPCSGCLGCSSSVFDNAK  137

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF ++ C   +C  V     PT    AC FN +YG
Sbjct  138  STTFKALGCQAGQCKQVPN---PTCDGSACIFNMTYG  171



>ref|XP_008446966.1| PREDICTED: aspartic proteinase nepenthesin-1 [Cucumis melo]
Length=444

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 96/155 (62%), Gaps = 9/155 (6%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +  +S L V HI+  CSPF    P S W   V+ M  KD ARL +LSSL A     ++ V
Sbjct  38   DDRSSTLKVFHIFSPCSPFRPSKPLS-WADNVLQMQAKDQARLQFLSSLVA----RRSVV  92

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSS  561
            PIAS + ++ +  +V+RA+IGTP Q + + LDTS+D AW+PCSGCVGC S TVF+ + SS
Sbjct  93   PIASARQLIQSPTFVVRAKIGTPAQTLLLALDTSNDAAWIPCSGCVGCPSTTVFSSDKSS  152

Query  562  TFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +F  + C  P+C+ V   SC      AC FN +YG
Sbjct  153  SFRPLPCQSPQCNQVPNPSC---SGTACGFNLTYG  184



>gb|KFK25095.1| hypothetical protein AALP_AA8G065800 [Arabis alpina]
Length=441

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  214  NSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIA  393
             S L + HI   CSPF + + + SW   V+    +D ARL YL+SL A    G++ VPIA
Sbjct  36   ESTLRIFHIDSPCSPFKSSS-SLSWEERVLKTLAQDQARLQYLTSLVA----GRSVVPIA  90

Query  394  SGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFG  570
            SG+ +L +  Y+++A+IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S++F 
Sbjct  91   SGRKMLQSTTYIVKAQIGTPAQTLLLAMDTSSDVAWLPCSGCVGCPSTTAFSPAKSTSFK  150

Query  571  SVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +V CS P+C  V     PT G+ AC+FN +YG
Sbjct  151  NVSCSAPQCKQVPN---PTCGARACSFNTTYG  179



>ref|XP_004142420.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus]
 gb|KGN52324.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=441

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 95/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  214  NSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIA  393
            +S L V HI+  CSPF    P S W   V+ M  KD ARL +LSSL A     ++ VPIA
Sbjct  38   SSTLQVFHIFSPCSPFRPSKPLS-WADNVLQMQAKDQARLQFLSSLVA----RRSFVPIA  92

Query  394  SGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFG  570
            S + ++ +  +V+RA+IGTP Q + + LDTS+D AW+PCSGC+GC S TVF+ + SS+F 
Sbjct  93   SARQLIQSPTFVVRAKIGTPAQTLLLALDTSNDAAWIPCSGCIGCPSTTVFSSDKSSSFR  152

Query  571  SVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             + C  P+C+ V   SC      AC FN +YG
Sbjct  153  PLPCQSPQCNQVPNPSC---SGSACGFNLTYG  181



>ref|XP_010557871.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Tarenaya hassleriana]
Length=439

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 94/151 (62%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF    P S W   V+ M  +D ARL YLSSL A    GK+NVP+AS
Sbjct  35   STLKIFHIDSPCSPFKPKTPLS-WEARVLQMLAEDQARLRYLSSLIA----GKSNVPVAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L T  Y+++A IGTP Q + + +DTSSD AW PC+GC+GC S T F+P  S+TF +
Sbjct  90   GRQILQTPTYIVQAMIGTPAQPLLVAMDTSSDFAWFPCTGCIGCPSSTAFSPAKSTTFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V C+  +C  V     PT G  AC +N +YG
Sbjct  150  VSCNSAQCKQVPN---PTCGGSACAYNLTYG  177



>ref|XP_011091849.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=432

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 94/157 (60%), Gaps = 7/157 (4%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C  +   S L V+H+   CSPF    P S W  +++ M   D ARL YLSSL   +  G+
Sbjct  24   CDVHDQGSTLQVIHVNSPCSPFRPKTPLS-WEASLLQMQSSDKARLQYLSSL---QVAGR  79

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ +     Y++RA+IGTP Q + M +DTS+D AWVPC+GCVGCS T F  + 
Sbjct  80   SIVPIASGRAITQNPTYIVRAKIGTPAQTLLMAVDTSNDAAWVPCTGCVGCSATTFNASN  139

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF  V C  P+C+ V   SC   G   C FN +YG
Sbjct  140  SATFMPVACGAPQCNQVPNPSC---GGTTCGFNLTYG  173



>ref|XP_010926983.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=445

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 106/168 (63%), Gaps = 10/168 (6%)
 Frame = +1

Query  175  TASATQFCAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLT  354
            TA+     AP  + S L V+H +G CSPF++P  ++SW  T++++  +D +R  YL+SL 
Sbjct  24   TATPDGCAAPADSGSTLRVLHAFGPCSPFHSP--SASWEDTILDLLSRDDSRFLYLASLA  81

Query  355  ALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE  534
              +   ++ VPIASG+ +L T  Y++RAR+G+P Q + + +DTSSD AW+PCSGC GCS 
Sbjct  82   TAR---RSFVPIASGRQLLQTPTYIVRARLGSPPQSLLLAVDTSSDVAWLPCSGCAGCSP  138

Query  535  TVFAP----NTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +  AP    + S+T+  V C    CS V   +CP  G+ AC FN +YG
Sbjct  139  SSDAPPFDTSRSTTYRPVPCGSQPCSQVPNPTCP-AGAKACGFNLTYG  185



>gb|KHG22262.1| Asparticase nepenthesin-1 [Gossypium arboreum]
Length=425

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 91/157 (58%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H+Y  CSPF    P S W   V+    KD AR+ +LSSL A     K
Sbjct  24   CDIQDHGSNLQVFHVYSPCSPFKPSKPLS-WEEDVLQTLAKDQARVQFLSSLVA----KK  78

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y+++A IGTP Q M M +DTSSD AWVPC+GC+GCS T F    
Sbjct  79   SVVPIASGRQIVQSPTYIVKANIGTPPQTMLMAMDTSSDAAWVPCTGCIGCSSTAFDFAK  138

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF ++ C   +C  V     PT G  AC FN +YG
Sbjct  139  STTFKTLGCQAAQCKQVPN---PTCGGSACAFNMTYG  172



>ref|XP_010553675.1| PREDICTED: aspartic proteinase nepenthesin-1 [Tarenaya hassleriana]
Length=457

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 106/157 (68%), Gaps = 10/157 (6%)
 Frame = +1

Query  220  ELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASG  399
            +LSV+ IY KCSPF   +   S L TV+ M+  DP RL+YL+SL A KP    +VPI SG
Sbjct  40   DLSVIPIYAKCSPFAADH-GGSLLDTVVKMSSNDPHRLNYLTSLVAGKPN-PNSVPIGSG  97

Query  400  QNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFA---PNTSSTFG  570
              +L+TGNYV+RA++GTP Q+M+MVLDTSSD AW PC+GC GC     A   PN+SSTF 
Sbjct  98   NQLLHTGNYVVRAKLGTPPQLMFMVLDTSSDAAWAPCTGCSGCPSAATAEVNPNSSSTFS  157

Query  571  SVECSVPECSMVNGMSCPTGGS-----GACNFNQSYG  666
            S+ CS  +C+   G++CP+  +      AC+FN +YG
Sbjct  158  SLSCSTAQCAQARGLTCPSSTTASPSPAACSFNHTYG  194



>gb|KJB73114.1| hypothetical protein B456_011G215800 [Gossypium raimondii]
Length=425

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 91/157 (58%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H+Y  CSPF    P S W   V+    KD AR+ +LSSL A     K
Sbjct  24   CDIQDHGSNLQVFHVYSPCSPFKPSKPLS-WEEDVLQTLAKDQARVQFLSSLVA----KK  78

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y+++A IGTP Q M M +DTSSD AWVPC+GC+GCS T F    
Sbjct  79   SVVPIASGRQIVQSPTYIVKANIGTPPQPMLMAMDTSSDAAWVPCTGCIGCSSTAFDFAK  138

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF ++ C   +C  V     PT G  AC FN +YG
Sbjct  139  STTFKTLGCQAAQCKQVPN---PTCGGSACEFNMTYG  172



>ref|XP_008348078.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=436

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 8/154 (5%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
             +  S L + H+Y  CSPF  P+   SW  +V+ M  KD ARL +LSSL A KP     V
Sbjct  32   KEQGSTLQIFHVYSPCSPFR-PSKPMSWEESVLQMQAKDQARLQFLSSLVATKPV----V  86

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
            PIASG+ ++ +  Y+++A+IGTP Q + M +DTSSD AW+PC+GCVGCS  VF    S+T
Sbjct  87   PIASGRQIIQSPTYIVKAKIGTPPQTLLMAVDTSSDAAWIPCNGCVGCSSNVFNSVKSTT  146

Query  565  FGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            + ++ C   +C  V     PT    +C+FN +YG
Sbjct  147  YKNLGCQAAQCKQVPN---PTCLGSSCSFNMTYG  177



>ref|XP_009372766.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=436

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 8/154 (5%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
             +  S L + H+Y  CSPF  P+   SW  +V+ M  KD ARL +LSSL A KP     V
Sbjct  32   KEQGSTLQIFHVYSPCSPFR-PSKPMSWEESVLQMQAKDQARLEFLSSLVAAKPV----V  86

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
            PIASG+ ++ +  Y+++A+IGTP Q + M +DTSSD AW+PC+GCVGCS  VF    S+T
Sbjct  87   PIASGRQIIQSPTYIVKAKIGTPPQTLLMAVDTSSDAAWIPCNGCVGCSSNVFNSVKSTT  146

Query  565  FGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            + ++ C   +C  V     PT    +C+FN +YG
Sbjct  147  YKNLGCQAAQCKQVPN---PTCLGSSCSFNMTYG  177



>ref|XP_009380234.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 102/168 (61%), Gaps = 7/168 (4%)
 Frame = +1

Query  181  SATQFCA-PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSL-T  354
            +A   CA P    S +++      CSPF     +SSW  T+MN    D +RL+YL+SL T
Sbjct  24   AAPSHCATPPDQRSTINIFRASDPCSPFRPSVRSSSWEDTMMNFMTYDESRLTYLASLAT  83

Query  355  ALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE  534
            + +P G++ VPIA G+ +L   NYV+RA +GTP Q M + LDTSSD AW PC+ C GC+ 
Sbjct  84   SHRPSGRSFVPIAPGRQLLQIPNYVVRASLGTPAQPMLVALDTSSDAAWFPCTACTGCAS  143

Query  535  T----VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            T     F P++S+T+  + C  P+C+ V   SCP  G+ +C FN +YG
Sbjct  144  TSTSASFDPSSSTTYRPLPCGSPQCAQVPNPSCPE-GAASCAFNLTYG  190



>ref|XP_010495094.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=439

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL +L A     ++ VPIAS
Sbjct  35   STLRIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLGNLVA----KRSVVPIAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S++F +
Sbjct  90   GRQMLQSTTYIVKALIGTPAQSLLLAMDTSSDVAWIPCSGCVGCPSNTAFSPAKSTSFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT G  AC+FN +YG
Sbjct  150  VSCSAPQCKQVPN---PTCGGRACSFNLTYG  177



>emb|CDP17284.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 93/157 (59%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V H+Y +CSPF    P S W  +V+ M  KD ARL +LSSL A    G+
Sbjct  32   CTTPDQGSTLQVYHVYSQCSPFKPKTPLS-WEESVLQMQSKDEARLLFLSSLVA----GR  86

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VP+ASG+ +  +  Y++R ++GTP Q + + +DTS+D  WVPC+GCVGC  TVF    
Sbjct  87   SVVPVASGRQITQSPTYIVRVKVGTPAQTLLVAMDTSNDAGWVPCNGCVGCGSTVFESTK  146

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C   +C  V G SC       C+FN +YG
Sbjct  147  STTFKNVGCGSAQCQQVPGPSCL---GSICSFNLTYG  180



>ref|XP_006403579.1| hypothetical protein EUTSA_v10010398mg [Eutrema salsugineum]
 gb|ESQ45032.1| hypothetical protein EUTSA_v10010398mg [Eutrema salsugineum]
Length=328

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 99/156 (63%), Gaps = 13/156 (8%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P    S+L V H+   CSPF  PN T SW +T++    KD ARL YLSSL A KP    +
Sbjct  27   PQGHPSDLRVFHVNSPCSPFKQPN-TVSWESTLL----KDKARLQYLSSL-AKKP----S  76

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTS  558
            VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AWVPCSGCVGC+ +V F P+ S
Sbjct  77   VPIASGRAIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWVPCSGCVGCASSVLFDPSKS  136

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+  +++C  P+C      +C  G S  C FN +YG
Sbjct  137  SSSRNLQCDAPQCKQAPNPTCTAGKS--CGFNMTYG  170



>ref|XP_009411751.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 95/157 (61%), Gaps = 6/157 (4%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P      + ++H +G CSP        SW  TVM++  +D +RL+YL+SL      G++ 
Sbjct  34   PPDEGPTIRILHAFGPCSPLRQSARFDSWEDTVMDLMTRDESRLAYLASLAT---AGRSF  90

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC--SETVFAPNT  555
            VP+ASG+ +L   NYV+RA +GTP Q M + LDTS+D AWVPC+ C GC  +   F P+ 
Sbjct  91   VPVASGRQLLQIPNYVVRASVGTPAQPMLIALDTSNDAAWVPCTACAGCPSASPSFDPSR  150

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+T+  + C  P+C  V   SCP G + +C+FN +YG
Sbjct  151  STTYRPLPCGSPQCGQVPNPSCPAGAT-SCSFNLTYG  186



>ref|XP_004511040.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=434

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 97/158 (61%), Gaps = 9/158 (6%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L ++H +  CSPF  P+   SW  +V+ +  KD AR+ YLSSL A     +
Sbjct  26   CNIQDHGSTLQIIHTFSPCSPFK-PSKEMSWEESVLQLQSKDQARMQYLSSLVA----RR  80

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET-VFAPN  552
            + VPIAS + ++ +  Y+++A+IG P Q + M +DTS+D AW+PC+GCVGCS T VFAP+
Sbjct  81   SVVPIASARQIIQSPTYILKAKIGNPPQTLLMAMDTSNDVAWIPCTGCVGCSTTKVFAPS  140

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             S+TF +V C  P C  V     PT G  AC FN +YG
Sbjct  141  KSTTFRNVGCGSPLCKQVPN---PTCGGSACAFNLTYG  175



>ref|XP_010452650.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=439

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 94/151 (62%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL +L A     ++ VPIAS
Sbjct  35   STLRIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLEYLGNLVA----KRSVVPIAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++  IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S++F +
Sbjct  90   GRQMLQSTTYIVKVLIGTPAQTLLLAMDTSSDVAWIPCSGCVGCPSNTAFSPAKSTSFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT G  AC+FN +YG
Sbjct  150  VSCSAPQCKQVPN---PTCGGRACSFNLTYG  177



>ref|XP_008375374.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=434

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 96/154 (62%), Gaps = 8/154 (5%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
             +  S L + H+Y  CSPF  P+   SW  +V+ M  KD ARL +LSSL A     K+ V
Sbjct  30   KEQGSTLQIFHVYSPCSPFR-PSKPMSWEESVLQMQAKDQARLQFLSSLVA----KKSVV  84

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSST  564
            PIASG+ ++ +  Y+++A+IGTP Q + M +DTSSD AWVPC+GCVGCS +VF    S+T
Sbjct  85   PIASGRQIIQSPTYIVKAKIGTPPQTLLMAVDTSSDAAWVPCNGCVGCSSSVFNSAISTT  144

Query  565  FGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            + ++ C   +C+ V     PT    +C FN +YG
Sbjct  145  YKNLGCRAAQCNQVPN---PTCLGSSCGFNLTYG  175



>ref|XP_007218027.1| hypothetical protein PRUPE_ppa005966mg [Prunus persica]
 gb|EMJ19226.1| hypothetical protein PRUPE_ppa005966mg [Prunus persica]
Length=435

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 91/150 (61%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L V H+Y  CSPF  P    SW  +V+ M  KD ARL +LSSL A     K+ VPIAS
Sbjct  36   SNLQVFHVYSPCSPFR-PTKPMSWEESVLQMQAKDQARLQFLSSLVA----RKSVVPIAS  90

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ ++ +  Y++RA+IGTP Q + M +DTS+D AWVPC+GCVGC   VF    S+T+ ++
Sbjct  91   GRQIIQSPTYIVRAKIGTPPQTLLMAVDTSNDAAWVPCNGCVGCGSNVFNSAKSTTYKTL  150

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C   +C  V     PT     C+FN SYG
Sbjct  151  GCQTAQCKQVPN---PTCLGSTCSFNTSYG  177



>ref|XP_010938557.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=447

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 100/160 (63%), Gaps = 11/160 (7%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP  + S L V+H +G CSPF++   ++SW  TV+++  +D +RL YL+SL   +   ++
Sbjct  35   APADSGSTLRVLHAFGPCSPFHS---SASWEDTVLDLLSRDDSRLLYLASLATAR---RS  88

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC----SETVFA  546
             VPIA G+ +L T  YV+RAR+G P Q + + +DTSSD AW+PCSGC GC    + + F 
Sbjct  89   FVPIAPGRQLLQTPTYVVRARLGNPPQPLLLAVDTSSDVAWLPCSGCTGCPYSAAASPFD  148

Query  547  PNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             + S T+  V C  P CS V   SCP  GS AC FN +YG
Sbjct  149  TSRSITYRPVPCGAPPCSQVPNPSCP-AGSTACGFNITYG  187



>ref|XP_010504244.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=425

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 99/158 (63%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C  N   S+L V HI  +CSPF     ++SW  T++    +D AR  YLSSL A K   K
Sbjct  22   CDENSHTSDLRVFHINSQCSPFKT---SASWEDTLL----QDKARFLYLSSLAAAK---K  71

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            ++VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AW+PCSGCVGCS +V F P+
Sbjct  72   SSVPIASGRAIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWIPCSGCVGCSSSVLFNPS  131

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SS+  +++C  P+C  V   SC    S  C FN +YG
Sbjct  132  KSSSSRTLQCQAPQCKQVPNPSCTVKKS--CGFNMTYG  167



>ref|XP_010515967.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=425

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 100/158 (63%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C  N  +S+L V HI  +CSPF     ++SW  T++    +D AR  YLSSL A K   K
Sbjct  22   CNENSHSSDLRVFHINSQCSPFKT---SASWEDTLL----QDKARFLYLSSLAAAK---K  71

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            ++VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AW+PCSGCVGCS +V F P+
Sbjct  72   SSVPIASGRGIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWIPCSGCVGCSSSVLFNPS  131

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SS+  +++C  P+C  V   SC    S  C FN +YG
Sbjct  132  KSSSSRTLQCQAPQCKQVPNPSCTVNKS--CGFNMTYG  167



>gb|EYU38286.1| hypothetical protein MIMGU_mgv1a006610mg [Erythranthe guttata]
Length=437

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 93/159 (58%), Gaps = 9/159 (6%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTS--SWLTTVMNMAVKDPARLSYLSSLTALKPK  369
            C      S L V+H+   CSPF      +  SW  +V+ M   D +RL YLSSL A    
Sbjct  26   CDVTDHGSNLQVLHVNSPCSPFKTAAAAAALSWEDSVLQMQSNDKSRLQYLSSLVA----  81

Query  370  GKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAP  549
            G++ VPIASG+ V     YV+RA+IGTP Q +++ +DTS+D AW+PCSGCVGCS   F  
Sbjct  82   GRSVVPIASGRAVTQNPTYVVRAKIGTPAQTLFVAVDTSNDAAWIPCSGCVGCSSATFNY  141

Query  550  NTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
              SS+F  + C  P+C+ V   SC   G  AC FN +YG
Sbjct  142  AKSSSFKPLPCGAPQCNQVPNPSC---GGAACGFNVTYG  177



>ref|XP_010475821.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=445

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 109/155 (70%), Gaps = 6/155 (4%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP+ ++ +LS++ I  KCSPF   + ++S + TV++MA  D  RL+YLSSL A KPK   
Sbjct  32   APDGSD-DLSIIPINAKCSPFAPTHASASVIDTVLHMASSDSHRLTYLSSLVAGKPK-PI  89

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTS  558
            +VPIASG N L+TGNYV+RA++GTP Q+M+MVLDTS+D  WVPCSGC       F PN+S
Sbjct  90   SVPIASG-NQLHTGNYVVRAKLGTPPQLMFMVLDTSNDAVWVPCSGC-SADSPSFNPNSS  147

Query  559  STFGSVECSVPECSMVNGMSCPTGG--SGACNFNQ  657
            ST+ +V CS  +C+  +G++CP+       C+FNQ
Sbjct  148  STYSTVSCSTAQCTQAHGLTCPSSSPQPSICSFNQ  182



>ref|XP_006403580.1| hypothetical protein EUTSA_v10010398mg [Eutrema salsugineum]
 dbj|BAJ34532.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45033.1| hypothetical protein EUTSA_v10010398mg [Eutrema salsugineum]
Length=428

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 99/156 (63%), Gaps = 13/156 (8%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P    S+L V H+   CSPF  PN T SW +T++    KD ARL YLSSL A KP    +
Sbjct  27   PQGHPSDLRVFHVNSPCSPFKQPN-TVSWESTLL----KDKARLQYLSSL-AKKP----S  76

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTS  558
            VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AWVPCSGCVGC+ +V F P+ S
Sbjct  77   VPIASGRAIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWVPCSGCVGCASSVLFDPSKS  136

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+  +++C  P+C      +C  G S  C FN +YG
Sbjct  137  SSSRNLQCDAPQCKQAPNPTCTAGKS--CGFNMTYG  170



>ref|XP_010427138.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=425

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 99/158 (63%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C  N   S+L V HI  +CSPF     ++SW  T++    +D AR  YLSSL A K   K
Sbjct  22   CDENSHTSDLRVFHINSQCSPFKT---SASWEDTLL----QDKARFLYLSSLAAAK---K  71

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            ++VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AW+PCSGCVGCS +V F P+
Sbjct  72   SSVPIASGRVIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWIPCSGCVGCSSSVLFNPS  131

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SS+  +++C  P+C  V   SC    S  C FN +YG
Sbjct  132  KSSSSRTLQCQAPQCKQVPNPSCTVNKS--CGFNMTYG  167



>emb|CDX81031.1| BnaC03g02850D [Brassica napus]
Length=454

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 100/162 (62%), Gaps = 17/162 (10%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + + + SW   V+    +D ARL YL+SL A    G++ +P+AS
Sbjct  36   STLKIFHIDSPCSPFKSSS-SLSWEARVLKTLAQDQARLQYLTSLVA----GRSVIPVAS  90

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A+IGTP Q + + +DTSSD AW+PCSGCVGC S T F+P  S+T+ +
Sbjct  91   GRQMLQSATYIVKAKIGTPAQTLLLAMDTSSDVAWLPCSGCVGCPSTTAFSPAKSTTYKN  150

Query  574  VECSVPECSM-----------VNGMSCPTGGSGACNFNQSYG  666
            V CS P+C             +  +  PT GS AC+FN +YG
Sbjct  151  VSCSAPQCKQNTLHNSVRHTSLTHVPNPTCGSSACSFNLTYG  192



>ref|XP_010423263.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010423264.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Camelina sativa]
 ref|XP_010423265.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X3 [Camelina sativa]
Length=439

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 94/151 (62%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL +L A     ++ VPIAS
Sbjct  35   STLRIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLGNLVA----KRSVVPIAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A IGTP Q + + +DTSSD AW+PCSGC GC S T F+P  S++F +
Sbjct  90   GRQMLQSTTYIVKALIGTPAQSLLLAMDTSSDVAWIPCSGCAGCPSNTAFSPAKSTSFKN  149

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT G  AC+FN +YG
Sbjct  150  VSCSAPQCKQVPN---PTCGGRACSFNLTYG  177



>ref|XP_008231689.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Prunus 
mume]
Length=435

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L V H+Y  CSPF +  P S W  +V+ M  KD ARL +LS L A     K+ VPIAS
Sbjct  36   SNLQVFHVYSPCSPFRSTKPMS-WEESVLQMQAKDQARLQFLSGLVA----RKSVVPIAS  90

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ ++ +  Y++RA+IGTP Q + + +DTS+D AWVPC+GCVGC  +VF    S+T+ ++
Sbjct  91   GRQIIQSPTYIVRAKIGTPPQTLLLAVDTSNDAAWVPCNGCVGCGSSVFNSAKSTTYKTL  150

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C   +C  V     PT     C+FN SYG
Sbjct  151  GCQTAQCKQVPN---PTCLGSTCSFNTSYG  177



>ref|NP_001241567.1| uncharacterized protein LOC100819698 precursor [Glycine max]
 gb|ACU19388.1| unknown [Glycine max]
Length=437

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 93/155 (60%), Gaps = 9/155 (6%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +   S L V H++  CSPF  P+   SW  +V+ +  KD AR+ YLSSL A     ++ V
Sbjct  30   DHDGSTLQVFHVFSPCSPFR-PSKPMSWEESVLKLQAKDQARMQYLSSLVA----RRSIV  84

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTSS  561
            PIASG+ +  +  Y+++A+IGTP Q + + +DTS+D +WVPC+ CVGCS T  FAP  S+
Sbjct  85   PIASGRQITQSPTYIVKAKIGTPAQTLLLAMDTSNDASWVPCTACVGCSTTTPFAPAKST  144

Query  562  TFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            TF  V C   +C  V     PT    AC FN +YG
Sbjct  145  TFKKVGCGASQCKQVRN---PTCDGSACAFNFTYG  176



>gb|KHN37680.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=437

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 93/155 (60%), Gaps = 9/155 (6%)
 Frame = +1

Query  205  NKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +   S L V H++  CSPF  P+   SW  +V+ +  KD AR+ YLSSL A     ++ V
Sbjct  30   DHDGSTLQVFHVFSPCSPFR-PSKPMSWEESVLKLQAKDQARMQYLSSLVA----RRSIV  84

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTSS  561
            PIASG+ +  +  Y+++A+IGTP Q + + +DTS+D +WVPC+ CVGCS T  FAP  S+
Sbjct  85   PIASGRQITQSPTYIVKAKIGTPAQTLLLAMDTSNDASWVPCTACVGCSTTTPFAPAKST  144

Query  562  TFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            TF  V C   +C  V     PT    AC FN +YG
Sbjct  145  TFKKVGCGASQCKQVRN---PTCDGSACAFNFTYG  176



>ref|XP_007133749.1| hypothetical protein PHAVU_011G206100g [Phaseolus vulgaris]
 gb|ESW05743.1| hypothetical protein PHAVU_011G206100g [Phaseolus vulgaris]
Length=438

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 96/158 (61%), Gaps = 9/158 (6%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C  +   S L V H++  CSPF  P+   SW  +V+ +  KD  R+ YLS+L A     +
Sbjct  28   CDVHDHGSTLKVFHVFSPCSPFR-PSQGMSWEESVLQLQAKDQDRMQYLSNLVA----RR  82

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            + VPIASG+ +  +  Y+++A+IGTP Q + + +DTS+D AW+PC+ C+GCS    FAP 
Sbjct  83   SIVPIASGREITQSPTYIVKAKIGTPAQTLLLAMDTSNDAAWLPCTSCLGCSTLKPFAPA  142

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             S+TF ++ CS P+C  V     PT G  AC FN +YG
Sbjct  143  KSTTFKTLPCSAPQCKQVPN---PTCGGSACAFNFTYG  177



>ref|XP_010032289.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Eucalyptus grandis]
Length=439

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 94/156 (60%), Gaps = 6/156 (4%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            PN+  S L V H+   CSP   P    SW  TV+ +  KD ARL +LSS    K   K+ 
Sbjct  29   PNQG-STLQVFHVNSPCSPLRPPE-AMSWEDTVLQLQEKDEARLQFLSSSLVAK---KSV  83

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTS  558
            VPIASG+ +L +  Y+++ +IGTP Q M+M +DTS+D AWVPCSGCVGCS +V F    S
Sbjct  84   VPIASGRQILQSATYIVKVQIGTPSQSMFMAVDTSNDAAWVPCSGCVGCSSSVLFDSAKS  143

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            ++F S+ C   +C+    +S P  G   C FN +YG
Sbjct  144  TSFKSLGCQASQCTQKFQVSNPKCGGNTCTFNMTYG  179



>ref|XP_010523939.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=441

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 92/151 (61%), Gaps = 6/151 (4%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + H++  CSP+    P  SW   ++ +  +D ARL YLSSL      GK+ VPIAS
Sbjct  38   SNLKIFHVFSPCSPYRPSRPPLSWENALLRIQDEDKARLLYLSSLAV---AGKSVVPIAS  94

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTSSTFGS  573
            G+ ++ T  Y++RA +G P Q M + LD  +D +W+PC+GCVGCS +V F  + S++F S
Sbjct  95   GRQIIQTPTYIVRANVGPPPQPMLVALDIGNDVSWLPCAGCVGCSSSVTFDSSMSTSFRS  154

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V+C  P+C      SC   G GAC FN +YG
Sbjct  155  VDCQAPQCRQAPNPSC--NGGGACEFNMTYG  183



>ref|XP_006291188.1| hypothetical protein CARUB_v10017317mg [Capsella rubella]
 gb|EOA24086.1| hypothetical protein CARUB_v10017317mg [Capsella rubella]
Length=425

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 99/158 (63%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C  N  +S+L V HI  +CSPF     +SSW  T++    +D AR  YLSSL   +   K
Sbjct  22   CNENSHSSDLRVFHINSQCSPFKT---SSSWEDTLL----QDKARFLYLSSLAGAR---K  71

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            ++VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AW+PCSGCVGCS +V F P+
Sbjct  72   SSVPIASGRGIVQSPTYIVRANIGTPAQSMLVALDTSNDAAWIPCSGCVGCSSSVLFDPS  131

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SS+  +++C  P+C      +C    S +C FN +YG
Sbjct  132  KSSSSRTLQCQAPQCKQAPNPTCTV--SKSCGFNMTYG  167



>ref|XP_011020416.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=441

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 90/150 (60%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            + + V H+Y   SPF    P S W  +V+ M  KD ARL +LSSL A     K+ VPIAS
Sbjct  42   TTVKVFHVYSSQSPFRPSKPIS-WEESVLQMMAKDQARLQFLSSLVA----RKSVVPIAS  96

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ V+ + +Y+++A++GTP Q + M LD S D AW+PC GCVGCS TVF    S+TF ++
Sbjct  97   GRGVIQSPSYIVKAKVGTPPQTLLMALDNSYDAAWIPCKGCVGCSSTVFNTLKSTTFKTL  156

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C  P+C  V    C   G   C +N +YG
Sbjct  157  GCRAPQCKQVTNPIC---GGSTCTWNTTYG  183



>ref|XP_010530469.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=433

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 8/151 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI+G CSP+  P+   SW  T++    +D ARL YLSSL      GK+ VPIAS
Sbjct  32   SNLKIFHIFGACSPYK-PSKQLSWENTLLQFQNRDKARLLYLSSLAV---AGKSVVPIAS  87

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTSSTFGS  573
            G+ ++ +  Y++R  IGTP Q M + LD  +D AWVPC+GCVGCS +V F  + S++F S
Sbjct  88   GRQIVQSPTYIVRVNIGTPPQPMLVALDIGNDAAWVPCTGCVGCSSSVTFDSSKSTSFRS  147

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            ++C   +C  V     PT   GAC FN +YG
Sbjct  148  LDCQASQCKQVPN---PTCNDGACAFNMTYG  175



>ref|XP_006347658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=442

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 96/160 (60%), Gaps = 8/160 (5%)
 Frame = +1

Query  190  QFCAPNKANSELSVMHIYGKCSPFNNPNPTS-SWLTTVMNMAVKDPARLSYLSSLTALKP  366
            +F   NK +S L V+++   CSP    N  S SW+ +V+ M  KD  RL +L+SL A   
Sbjct  30   KFHQDNKDSSTLQVIYVDSPCSPLKQQNAHSLSWVDSVLQMQNKDTNRLQFLASLVA---  86

Query  367  KGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFA  546
             G++ VPIASG+ +L T  Y+++A+IGTP Q + + LD S+D +W PC GCVGCS  V +
Sbjct  87   -GRSFVPIASGRQILQTPTYIVKAKIGTPPQTLLVALDNSNDFSWFPCGGCVGCSSNVLS  145

Query  547  PNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             + S+TF +V C    CS+V    C    +  C FN +YG
Sbjct  146  YDKSTTFSNVSCERASCSLVPRRDC---DAATCTFNLTYG  182



>ref|XP_010032290.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW51704.1| hypothetical protein EUGRSUZ_J01176 [Eucalyptus grandis]
Length=436

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 94/156 (60%), Gaps = 9/156 (6%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            PN+  S L V H+   CSP   P    SW  TV+ +  KD ARL +LSS    K   K+ 
Sbjct  29   PNQG-STLQVFHVNSPCSPLRPPE-AMSWEDTVLQLQEKDEARLQFLSSSLVAK---KSV  83

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTS  558
            VPIASG+ +L +  Y+++ +IGTP Q M+M +DTS+D AWVPCSGCVGCS +V F    S
Sbjct  84   VPIASGRQILQSATYIVKVQIGTPSQSMFMAVDTSNDAAWVPCSGCVGCSSSVLFDSAKS  143

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            ++F S+ C   +C+ V+   C   G   C FN +YG
Sbjct  144  TSFKSLGCQASQCTQVSNPKC---GGNTCTFNMTYG  176



>ref|XP_006368623.1| hypothetical protein POPTR_0001s06560g [Populus trichocarpa]
 gb|ERP65192.1| hypothetical protein POPTR_0001s06560g [Populus trichocarpa]
Length=418

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 91/150 (61%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            + + V H+Y   SPF    P S W  +V+ M  +D ARL +LSSL       K+ VPIAS
Sbjct  26   TTVKVFHVYSPQSPFRPSKPVS-WEDSVLQMLAEDQARLQFLSSLVG----RKSWVPIAS  80

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ ++ +  Y+++A +GTP Q   M LDTS+D AW+PC+GCVGCS TVF   TS+TF ++
Sbjct  81   GRQIVQSPTYIVKANVGTPAQTFLMALDTSNDAAWIPCNGCVGCSSTVFNSVTSTTFKTL  140

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C  P+C  V     PT G   C +N +YG
Sbjct  141  GCDAPQCKQVPN---PTCGGSTCTWNTTYG  167



>gb|ABK92955.1| unknown [Populus trichocarpa]
Length=425

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 91/150 (61%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            + + V H+Y   SPF    P S W  +V+ M  +D ARL +LSSL       K+ VPIAS
Sbjct  26   TTVKVFHVYSPQSPFRPSKPVS-WEDSVLQMLAEDQARLQFLSSLVG----RKSWVPIAS  80

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ ++ +  Y+++A +GTP Q   M LDTS+D AW+PC+GCVGCS TVF   TS+TF ++
Sbjct  81   GRQIVQSPTYIVKANVGTPAQTFLMALDTSNDAAWIPCNGCVGCSSTVFNSVTSTTFKTL  140

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C  P+C  V     PT G   C +N +YG
Sbjct  141  GCDAPQCKQVPN---PTCGGSTCTWNTTYG  167



>ref|XP_006287717.1| hypothetical protein CARUB_v10000927mg [Capsella rubella]
 gb|EOA20615.1| hypothetical protein CARUB_v10000927mg [Capsella rubella]
Length=457

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 94/151 (62%), Gaps = 9/151 (6%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S L + HI   CSPF + +P S W   V+    +D ARL YL +L A     ++ VPIAS
Sbjct  53   STLRIFHIDSPCSPFKSSSPLS-WEARVLKTLAQDQARLQYLGNLVA----KRSVVPIAS  107

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            G+ +L +  Y+++A IGTP Q + + +DTSSD AW PCSGCVGC S T F+P  S++F +
Sbjct  108  GRQMLQSTTYIVKALIGTPAQSLLLAMDTSSDVAWFPCSGCVGCPSNTAFSPAKSTSFKN  167

Query  574  VECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            V CS P+C  V     PT  + +C+FN +YG
Sbjct  168  VSCSAPQCKQVPN---PTCSARSCSFNLTYG  195



>ref|XP_002299201.1| aspartyl protease family protein [Populus trichocarpa]
 gb|ABK93780.1| unknown [Populus trichocarpa]
 gb|EEE84006.1| aspartyl protease family protein [Populus trichocarpa]
Length=425

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 91/150 (61%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            + + V H+Y   SPF    P S W  +V+ M  +D ARL +LSSL       K+ VPIAS
Sbjct  26   TTVKVFHVYSPQSPFRPSKPVS-WEDSVLQMLAEDQARLQFLSSLVG----RKSWVPIAS  80

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ ++ +  Y+++A +GTP Q   M LDTS+D AW+PC+GCVGCS TVF   TS+TF ++
Sbjct  81   GRQIVQSPTYIVKANVGTPAQTFLMALDTSNDAAWIPCNGCVGCSSTVFNSVTSTTFKTL  140

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C  P+C  V     PT G   C +N +YG
Sbjct  141  GCDAPQCKQVPN---PTCGGSTCTWNTTYG  167



>ref|XP_002303933.2| hypothetical protein POPTR_0003s19490g [Populus trichocarpa]
 gb|EEE78912.2| hypothetical protein POPTR_0003s19490g [Populus trichocarpa]
Length=441

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 90/150 (60%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            + + V H+Y   SPF    P S W  +V+ M  KD ARL +LSSL A     K+ VPIAS
Sbjct  42   TTVKVFHVYSSQSPFRPSKPIS-WEESVLQMMAKDQARLQFLSSLVA----KKSVVPIAS  96

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ V+ + +Y+++A++GTP Q + M LD S D AW+PC GCVGCS TVF    S+TF ++
Sbjct  97   GRGVIQSPSYIVKAKVGTPPQTLLMALDNSYDAAWIPCKGCVGCSSTVFNTVKSTTFKTL  156

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C  P+C  V    C   G   C +N +YG
Sbjct  157  GCGAPQCKQVPNPIC---GGSTCTWNTTYG  183



>ref|XP_004230031.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=443

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = +1

Query  190  QFCAPNKANSELSVMHIYGKCSPFNNPN--PTSSWLTTVMNMAVKDPARLSYLSSLTALK  363
            +F   NK +S L V+H+   CSP        + SW+ +V+ M  KD  RL +L+SL A  
Sbjct  30   KFYHDNKDSSTLQVIHVDSPCSPLKQQQNAHSLSWVDSVLQMQNKDTNRLQFLASLVA--  87

Query  364  PKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVF  543
              GK+ VPIASG+ +L T  Y+++A+IGTP Q + + LD S+D +W PC GCVGCS  VF
Sbjct  88   --GKSFVPIASGRQILQTPTYIVKAKIGTPPQPLLVALDNSNDFSWFPCGGCVGCSSNVF  145

Query  544  APNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            + + S+TF +V C    C++V    C    +  C+FN +YG
Sbjct  146  SYDKSTTFSNVSCERASCNLVPRRDC---DAATCSFNLTYG  183



>gb|AAM66983.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
Length=425

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 98/158 (62%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C     +S+L V HI  +CSPF     + SW  T++    +D AR  YLSSL  ++   K
Sbjct  22   CNEKSHSSDLRVFHINSQCSPFKT---SVSWADTLL----QDKARFLYLSSLAGVR---K  71

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            ++VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AW+PCSGCVGCS +V F P+
Sbjct  72   SSVPIASGRAIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWIPCSGCVGCSSSVLFDPS  131

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SS+  +++C  P+C      SC    S +C FN +YG
Sbjct  132  KSSSSRTLQCEAPQCKQAPNPSCTV--SKSCGFNMTYG  167



>ref|XP_002877976.1| hypothetical protein ARALYDRAFT_906847 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54235.1| hypothetical protein ARALYDRAFT_906847 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 97/158 (61%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C     +S+L V HI  +CSPF     + SW  T++    +D AR  YLSSL  +    K
Sbjct  22   CNEKSHSSDLRVFHINSQCSPFKT---SVSWADTLL----QDKARFLYLSSLAGVT---K  71

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            ++VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AW+PCSGCVGCS +V F P+
Sbjct  72   SSVPIASGRGIVQSPTYIVRANIGTPAQAMLVALDTSNDAAWIPCSGCVGCSSSVLFDPS  131

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SS+  +++C  P+C      SC    S +C FN +YG
Sbjct  132  KSSSSRTLQCEAPQCKQAPNPSCTV--SKSCGFNMTYG  167



>gb|AES68738.2| aspartic proteinase nepenthesin-like protein [Medicago truncatula]
Length=417

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 7/128 (5%)
 Frame = +1

Query  283  SWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQV  462
            SW  +V+ M  KD  RL +L SL A     K+ VPIASG+ ++ +  Y++RA+IGTP Q 
Sbjct  38   SWEESVLQMQAKDTTRLQFLDSLVA----RKSVVPIASGRQIIQSPTYIVRAKIGTPPQT  93

Query  463  MYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGA  642
            + + +DTS+D AW+PC+ C GC+ T+FAP  S+TF +V C+ PEC  V    C   G  +
Sbjct  94   LLLAMDTSNDAAWIPCTACDGCASTLFAPEKSTTFKNVSCAAPECKQVPNPGC---GVSS  150

Query  643  CNFNQSYG  666
            CNFN +YG
Sbjct  151  CNFNLTYG  158



>ref|XP_009116125.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=430

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 97/157 (62%), Gaps = 11/157 (7%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            +P    S+L V HI   CSP+  PN T SW +T+    +KD ARL YLSSL   K   K 
Sbjct  26   SPQGHPSDLRVFHIDSPCSPYKQPN-TVSWESTL----IKDNARLQYLSSLAVGK---KP  77

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNT  555
             VPIASG++++ +  Y++RA IGTP Q M + LDTS+D  WVPCSGCVGC+ +V F P+ 
Sbjct  78   WVPIASGRSIVQSPTYIVRANIGTPAQPMLVALDTSNDVTWVPCSGCVGCASSVLFDPSK  137

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SS+  + +C  P+C      +C    S +C FN +YG
Sbjct  138  SSSSRTFQCEAPQCKQAPNPTCTV--SKSCGFNMTYG  172



>emb|CDX78233.1| BnaA09g34280D [Brassica napus]
Length=430

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 97/157 (62%), Gaps = 11/157 (7%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            +P    S+L V HI   CSP+  PN T SW +T+    +KD ARL YLSSL   K   K 
Sbjct  26   SPQGHPSDLRVFHIDSPCSPYKQPN-TVSWESTL----IKDNARLQYLSSLAVGK---KP  77

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNT  555
             VPIASG++++ +  Y++RA IGTP Q M + LDTS+D  WVPCSGCVGC+ +V F P+ 
Sbjct  78   WVPIASGRSIVQSPTYIVRANIGTPAQPMLVALDTSNDVTWVPCSGCVGCASSVLFDPSK  137

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SS+  + +C  P+C      +C    S +C FN +YG
Sbjct  138  SSSSRTFQCEAPQCKQAPNPTCTV--SKSCGFNMTYG  172



>emb|CDY13202.1| BnaC04g26330D [Brassica napus]
Length=429

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 95/156 (61%), Gaps = 12/156 (8%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P    S+L V HI   CSPF     T SW +T++    +D ARL YLSSL       K++
Sbjct  27   PRGHPSDLRVFHISSPCSPFKKKTNTVSWESTLL----QDKARLQYLSSLAV-----KSS  77

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTS  558
            VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AWVPCSGCVGC+ +V F P+ S
Sbjct  78   VPIASGRAIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWVPCSGCVGCASSVLFDPSKS  137

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            ++  ++ C  P+C      +C    S +C FN +YG
Sbjct  138  NSSRTLPCEAPQCKQALNPTCTV--SKSCGFNMTYG  171



>ref|NP_191008.1| aspartyl protease family protein [Arabidopsis thaliana]
 emb|CAB81805.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
 gb|AAL49945.1| AT3g54400/T12E18_90 [Arabidopsis thaliana]
 gb|AAM70549.1| AT3g54400/T12E18_90 [Arabidopsis thaliana]
 gb|AEE79226.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=425

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 97/158 (61%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C     +S+L V HI   CSPF     + SW  T++    +D AR  YLSSL  ++   K
Sbjct  22   CNEKSHSSDLRVFHINSLCSPFKT---SVSWADTLL----QDKARFLYLSSLAGVR---K  71

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPN  552
            ++VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AW+PCSGCVGCS +V F P+
Sbjct  72   SSVPIASGRAIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWIPCSGCVGCSSSVLFDPS  131

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SS+  +++C  P+C      SC    S +C FN +YG
Sbjct  132  KSSSSRTLQCEAPQCKQAPNPSCTV--SKSCGFNMTYG  167



>ref|XP_011000582.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=425

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 90/150 (60%), Gaps = 8/150 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            + + V H++   SPF    P S W  +V+ M  +D ARL +LS+L       K+ VPIAS
Sbjct  26   TTVKVFHVFSPQSPFRPSKPVS-WEDSVLQMLAEDQARLQFLSNLAG----RKSWVPIAS  80

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSV  576
            G+ ++ +  Y+++A +GTP Q   M LDTS+D AW+PC+GCVGCS TVF   TS+TF S+
Sbjct  81   GRQIVQSPTYIVKANVGTPAQTFLMALDTSNDAAWIPCNGCVGCSSTVFNSVTSTTFKSL  140

Query  577  ECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C  P+C  V    C   G   C +N +YG
Sbjct  141  GCDAPQCKQVPNPIC---GGSTCTWNTTYG  167



>ref|XP_009139245.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=429

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 95/156 (61%), Gaps = 12/156 (8%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P    S+L V HI   CSPF     T SW +T++    +D ARL YLSSL       K++
Sbjct  27   PRGRPSDLRVFHISSPCSPFKKKPNTVSWESTLL----QDKARLQYLSSLAV-----KSS  77

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTS  558
            VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AWVPCSGCVGC+ +V F P+ S
Sbjct  78   VPIASGRAIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWVPCSGCVGCASSVLFDPSKS  137

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            ++  ++ C  P+C      +C    S +C FN +YG
Sbjct  138  NSSRTLPCEAPQCKQAPNPTCTV--SKSCGFNMTYG  171



>emb|CDX76150.1| BnaA04g04140D [Brassica napus]
Length=429

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 95/156 (61%), Gaps = 12/156 (8%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P    S+L V HI   CSPF     T SW +T++    +D ARL YLSSL       K++
Sbjct  27   PRGHPSDLRVFHISSPCSPFKKKPNTVSWESTLL----QDKARLQYLSSLAV-----KSS  77

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTS  558
            VPIASG+ ++ +  Y++RA IGTP Q M + LDTS+D AWVPCSGCVGC+ +V F P+ S
Sbjct  78   VPIASGRAIVQSPTYIVRANIGTPAQPMLVALDTSNDAAWVPCSGCVGCASSVLFDPSKS  137

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            ++  ++ C  P+C      +C    S +C FN +YG
Sbjct  138  NSSRTLPCEAPQCKQAPNPTCTV--SKSCGFNMTYG  171



>gb|KFK34672.1| hypothetical protein AALP_AA5G176500 [Arabis alpina]
Length=430

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 95/156 (61%), Gaps = 11/156 (7%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P    S+L V HI   CSPF N   + SW + ++    +D AR  YLSSL   +   K++
Sbjct  27   PQGHPSDLRVFHINSPCSPFKN-QASVSWESELL----QDKARFQYLSSLAVAR---KSS  78

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTS  558
            VPIASG+ ++ +  YV+RA IGTP Q M + LDTS+D AW+PCSGCVGC S  +F P+ S
Sbjct  79   VPIASGRGIVQSPTYVVRANIGTPAQPMLVALDTSNDAAWIPCSGCVGCASPVLFDPSKS  138

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            ++  +++C  PEC      +C  G +  C FN +YG
Sbjct  139  NSSRTLQCQAPECKQAPNPTCTVGNT--CGFNMTYG  172



>ref|XP_002461152.1| hypothetical protein SORBIDRAFT_02g041760 [Sorghum bicolor]
 gb|EER97673.1| hypothetical protein SORBIDRAFT_02g041760 [Sorghum bicolor]
Length=452

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 90/155 (58%), Gaps = 5/155 (3%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
             A + L V H +G CSP        SW   + + A +D +RL YL SL A + K +   P
Sbjct  39   DAGNTLQVSHAFGPCSPLGPGTTAPSWAGFLADQASRDASRLLYLDSLAA-RGKARAYAP  97

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTS  558
            IASG+ +L T  YV+RAR+GTP Q + + +DTS+D AW+PC+GC GC   S   F P  S
Sbjct  98   IASGRQLLQTPTYVVRARLGTPPQQLLLAVDTSNDAAWIPCAGCAGCPTSSAPPFDPAAS  157

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
            +++ SV C  P C+     +CP GG  AC F+ +Y
Sbjct  158  TSYRSVPCGSPLCAQAPNAACPPGGK-ACGFSLTY  191



>ref|XP_010670495.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Beta vulgaris 
subsp. vulgaris]
Length=434

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 85/155 (55%), Gaps = 9/155 (6%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P K +S L V H+   CSPF       SW  +VM M  +D ARL YL+SL A     K+ 
Sbjct  31   PEKDSSTLRVFHVSSPCSPFKPKK--MSWEESVMQMLTEDQARLQYLTSLVA----RKSI  84

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSS  561
             P+A  + ++ +  Y++R  +GTP Q   M LDTS+D +W+PC GCVGC   +F    S+
Sbjct  85   APVAWARQLIQSPTYIVRVNVGTPPQSFLMALDTSNDVSWLPCKGCVGCGSALFGSERST  144

Query  562  TFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +F  + C  P+C  V   SC       C FNQ+YG
Sbjct  145  SFKGIACGTPQCQQVTSPSC---FQNVCTFNQTYG  176



>ref|NP_001060521.1| Os07g0658600 [Oryza sativa Japonica Group]
 dbj|BAC15479.1| nucleoid DNA-binding-like protein [Oryza sativa Japonica Group]
 dbj|BAD31106.1| nucleoid DNA-binding-like protein [Oryza sativa Japonica Group]
 dbj|BAF22435.1| Os07g0658600 [Oryza sativa Japonica Group]
Length=449

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 91/156 (58%), Gaps = 5/156 (3%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P  A + L V H +G CSP    +   SW   + + A +D +RL YL SL     KG+  
Sbjct  36   PPDAGATLQVSHAFGPCSPLGAESAAPSWAGFLADQAARDASRLLYLDSLAV---KGRAY  92

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTS  558
             PIASG+ +L T  YV+RAR+GTP Q + + +DTS+D AW+PCSGC GC + + F P  S
Sbjct  93   APIASGRQLLQTPTYVVRARLGTPAQQLLLAVDTSNDAAWIPCSGCAGCPTSSPFNPAAS  152

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +++  V C  P+C +    SC +  + +C F+ SY 
Sbjct  153  ASYRPVPCGSPQCVLAPNPSC-SPNAKSCGFSLSYA  187



>ref|XP_003598487.1| Peptidase A1, putative [Medicago truncatula]
Length=414

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 89/157 (57%), Gaps = 23/157 (15%)
 Frame = +1

Query  196  CAPNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGK  375
            C      S L V+H++                 +V+ M  KD  RL +L SL A     K
Sbjct  22   CDVQDNGSTLQVIHVFK----------------SVLQMQAKDTTRLQFLDSLVA----RK  61

Query  376  TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNT  555
            + VPIASG+ ++ +  Y++RA+IGTP Q + + +DTS+D AW+PC+ C GC+ T+FAP  
Sbjct  62   SVVPIASGRQIIQSPTYIVRAKIGTPPQTLLLAMDTSNDAAWIPCTACDGCASTLFAPEK  121

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            S+TF +V C+ PEC  V    C   G  +CNFN +YG
Sbjct  122  STTFKNVSCAAPECKQVPNPGC---GVSSCNFNLTYG  155



>gb|EYU42928.1| hypothetical protein MIMGU_mgv1a0098261mg, partial [Erythranthe 
guttata]
Length=166

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = +1

Query  202  PNKAN-SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            PN+   S L ++H     SPF    P  SW  +V+ M   D ARL +LSSL  +    +T
Sbjct  32   PNRDEGSNLQLIHANSPISPFRRNTPPLSWEDSVLQMQSADQARLQFLSSLV-VGAAART  90

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSE-TVFAPNT  555
             VPIASG+ V     Y++RA+IGTP Q + M +DTS+D AWVPC+GCVGCS    F P+ 
Sbjct  91   IVPIASGRAVTQNPTYIVRAKIGTPAQTLLMAVDTSNDAAWVPCAGCVGCSSAAAFDPSK  150

Query  556  SSTFGSVECSVPECSM  603
            S+TF  V C   +CS 
Sbjct  151  SATFKPVACGASQCSQ  166



>ref|NP_001130306.1| uncharacterized protein LOC100191400 precursor [Zea mays]
 gb|ACF78483.1| unknown [Zea mays]
 gb|ACF85799.1| unknown [Zea mays]
 gb|ACF87680.1| unknown [Zea mays]
 gb|ACN26383.1| unknown [Zea mays]
 gb|ACN28417.1| unknown [Zea mays]
 tpg|DAA63976.1| TPA: aspartic proteinase nepenthesin-1 [Zea mays]
Length=450

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P  A + L V H +G CSP        SW   + + A +D +RL YL SL A++ + +  
Sbjct  39   PPDAGNTLQVSHAFGPCSPLGPGTAAPSWAGFLADQASRDASRLLYLDSL-AVRGRARAY  97

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPN  552
             PIASG+ +L T  YV+RA +GTP Q + + +DTS+D +W+PC+GC GC   S   F P 
Sbjct  98   APIASGRQLLQTPTYVVRASLGTPPQQLLLAVDTSNDASWIPCAGCAGCPTSSAAPFDPA  157

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
            +S+++ +V C  P C+     +CP GG  AC F+ +Y
Sbjct  158  SSASYRTVPCGSPLCAQAPNAACPPGGK-ACGFSLTY  193



>ref|NP_001266528.1| aspartic proteinase nepenthesin-1 precursor [Zea mays]
 gb|ACG35309.1| aspartic proteinase nepenthesin-1 precursor [Zea mays]
Length=450

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 91/157 (58%), Gaps = 5/157 (3%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P  A + L V H +G CSP        SW   + + A +D +RL YL SL A++ + +  
Sbjct  39   PPDAGNTLQVSHAFGPCSPLGPGTAAPSWAGFLADQASRDASRLLYLDSL-AVRGRARAY  97

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPN  552
             PIASG+ +L T  YV+RA +GTP Q + + +DTS+D +W+PC+GC GC   S   F P 
Sbjct  98   APIASGRQLLQTLTYVVRASLGTPPQQLLLAVDTSNDASWIPCAGCAGCPTSSAAPFDPA  157

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
             S+++ +V C  P C+     +CP GG  AC F+ +Y
Sbjct  158  ASASYRTVPCGSPLCAQAPNAACPPGGK-ACGFSLTY  193



>dbj|BAJ92880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 88/156 (56%), Gaps = 5/156 (3%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P  A + L V H +G CSP  N     SW   + + + +D +RL YL SL      G+  
Sbjct  37   PPDAGATLQVSHAFGPCSPLGNAAAAPSWAGFLADQSSRDASRLLYLDSLAV---AGRAY  93

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTS  558
             PIASG+ +L T  YV+RAR+GTP Q + + +DTS+D AW+PCSGC GC  T  F P  S
Sbjct  94   APIASGRQLLQTPTYVVRARLGTPPQQLLLAVDTSNDAAWIPCSGCAGCPTTTPFNPAAS  153

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             ++ +V C  P CS     SC +  + +C F+ +Y 
Sbjct  154  KSYRAVPCGSPACSRAPNPSC-SLNTKSCGFSLTYA  188



>ref|XP_004958568.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=446

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 87/155 (56%), Gaps = 5/155 (3%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTN  381
            P  A   L V H +G CSP        SW   + + A +D +RL YL SL     +G+  
Sbjct  35   PPDAGGTLQVSHAFGPCSPLGPSAAAPSWAGFLADQAARDASRLLYLDSLAV---RGRAY  91

Query  382  VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTS  558
             PIASG+ +L T  YV+RAR+GTP Q + + +DTS+D AW+PC+GC GC + T F P  S
Sbjct  92   APIASGRQLLQTPTYVVRARLGTPPQPLLLAVDTSNDAAWIPCAGCAGCPTSTPFNPAAS  151

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
            +++  V C    C+     +CP   S AC F+ +Y
Sbjct  152  ASYRPVPCGSALCAQAPNAACPL-DSKACGFSLTY  185



>ref|XP_006854820.1| hypothetical protein AMTR_s00063p00187740 [Amborella trichopoda]
 gb|ERN16287.1| hypothetical protein AMTR_s00063p00187740 [Amborella trichopoda]
Length=417

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 6/135 (4%)
 Frame = +1

Query  259  FNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRA  438
            F+N   + SW  T+  MA  D +R++ L  L A     KT VPI SG+  +NT +YV R 
Sbjct  31   FHNQVQSRSWDDTLFEMAELDASRVANLLGLKA----NKTVVPIGSGRQAINTPSYVARV  86

Query  439  RIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNGMS  618
             +GTP QVM M+LDTS+D  WVPC+ C GC+ TVF P  S+T+   EC  P+CS+++  +
Sbjct  87   GVGTPPQVMTMLLDTSNDVPWVPCTACPGCAATVFQPTLSTTYKPSECGSPKCSLLHSQT  146

Query  619  CPTGGSGACNFNQSY  663
            C T  SG+C+FN +Y
Sbjct  147  CTT--SGSCSFNMTY  159



>ref|XP_011088726.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Sesamum indicum]
Length=444

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 83/138 (60%), Gaps = 8/138 (6%)
 Frame = +1

Query  253  SPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVI  432
            SPF+ P    SW  TV+ M   D ARL YLSSL + +P     VPIA+G  + +  +Y++
Sbjct  40   SPFS-PTTQLSWEHTVLQMQSNDNARLHYLSSLASARPI----VPIAAGMTITHNPSYIV  94

Query  433  RARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNG  612
            RARIGTP Q + M +DT +D +W+PC+GCVGCS   F    SSTF +V C   +CS V  
Sbjct  95   RARIGTPPQTLLMAVDTGNDASWIPCTGCVGCSAASFDSAKSSTFRTVPCHATQCSQVPS  154

Query  613  MSCPTGGSGACNFNQSYG  666
             SC   G   C FN +YG
Sbjct  155  PSC---GGATCGFNWAYG  169



>emb|CAN69536.1| hypothetical protein VITISV_043237 [Vitis vinifera]
Length=372

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 7/120 (6%)
 Frame = +1

Query  307  MAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTS  486
            M  KD ARL +LSSL A K    + VPIASG+ ++    Y++RA+IGTP Q M M +DTS
Sbjct  1    MQAKDKARLQFLSSLVARK----SVVPIASGRQIVQNPTYIVRAKIGTPAQTMLMAMDTS  56

Query  487  SDNAWVPCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SD AW+PC+GC+GCS T+F    S+T+ S+ C   +C  V     PT G G C+FN +YG
Sbjct  57   SDVAWIPCNGCLGCSSTLFNSPASTTYKSLGCQAAQCKQVPK---PTCGGGVCSFNLTYG  113



>ref|XP_008803347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=445

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 102/160 (64%), Gaps = 10/160 (6%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT  378
            AP  ++S L V+H +G CSPF++   ++SW  TV+++   D +RL YL+SL   K   ++
Sbjct  32   APADSSSTLRVLHAFGPCSPFHST--SASWEDTVLDLLSSDDSRLLYLASL---KTARRS  86

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAP---  549
             VPIA G+ +L T  YV+RAR+G+P Q + + LDTSSD AW+PCSGC GC  +  AP   
Sbjct  87   FVPIAPGRQLLQTPTYVVRARLGSPPQPLLLALDTSSDVAWLPCSGCSGCPSSSAAPPFD  146

Query  550  -NTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             + S+T+  V C  P CS V   SCP G + AC FN +YG
Sbjct  147  TSRSTTYRPVRCGAPPCSQVPNPSCPAGAT-ACGFNLTYG  185



>gb|KHN13065.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=384

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 79/129 (61%), Gaps = 8/129 (6%)
 Frame = +1

Query  283  SWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQV  462
            SW  +V+ +  KD AR+ YLS+L A     ++ VPIASG+ +  +  Y++RA+ GTP Q 
Sbjct  2    SWEESVLQLQAKDQARMQYLSNLVA----RRSIVPIASGRQITQSPTYIVRAKFGTPAQT  57

Query  463  MYMVLDTSSDNAWVPCSGCVGCSETV-FAPNTSSTFGSVECSVPECSMVNGMSCPTGGSG  639
            + + +DTS+D AWVPC+ CVGCS T  FAP  S+TF  V C   +C  V     PT    
Sbjct  58   LLLAMDTSNDAAWVPCTACVGCSTTTPFAPPKSTTFKKVGCGASQCKQVRN---PTCDGS  114

Query  640  ACNFNQSYG  666
            AC FN +YG
Sbjct  115  ACAFNFTYG  123



>gb|AAK44106.2|AF370291_1 unknown protein [Arabidopsis thaliana]
Length=375

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 84/116 (72%), Gaps = 6/116 (5%)
 Frame = +1

Query  331  LSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPC  510
            L+YLSSL A KPK  T+VP+ASG N L+ GNYV+RA++GTP Q+M+MVLDTS+D  W+PC
Sbjct  1    LTYLSSLVAGKPK-PTSVPVASG-NQLHIGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPC  58

Query  511  SGCVGCSET--VFAPNTSSTFGSVECSVPECSMVNGMSCPTGG--SGACNFNQSYG  666
            SGC GCS     F  N+SST+ +V CS  +C+   G++CP+       C+FNQSYG
Sbjct  59   SGCSGCSNASTSFNTNSSSTYSTVSCSTAQCTQARGLTCPSSSPQPSVCSFNQSYG  114



>gb|EPS64285.1| hypothetical protein M569_10492 [Genlisea aurea]
Length=423

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 79/138 (57%), Gaps = 12/138 (9%)
 Frame = +1

Query  253  SPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVI  432
            SPF     + SW      M  +D +R+ +LSSL      G + V +ASG+ V     YV+
Sbjct  38   SPFRRKE-SPSW----NQMLTEDKSRMEFLSSLAV----GSSVVRVASGRGVTQNPTYVV  88

Query  433  RARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNG  612
            RA IGTP Q + + +DT +D AW+PCSGC GCS   FAP+ SSTF    C  P+C+++  
Sbjct  89   RAGIGTPPQTLLVAVDTGNDAAWIPCSGCDGCSSATFAPSVSSTFKPTRCGSPQCALLPK  148

Query  613  MSCPTGGSGACNFNQSYG  666
             SC   G  AC FN +YG
Sbjct  149  ASC---GGDACRFNVTYG  163



>ref|XP_008806589.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=449

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 97/167 (58%), Gaps = 9/167 (5%)
 Frame = +1

Query  193  FCAPNKANSELSVMHIYGKCSPFNNPNP--TSSWLTTVMNMAVKDPARLSYLSSLT---A  357
            F  P     +L ++H +   S  ++P+P   SS+  T++++   D +RL  L++ T   A
Sbjct  23   FSLPAAIAIDLRILHAFNPFSSLHHPDPFSPSSFEATLLSLTSHDESRLLALAATTTSHA  82

Query  358  LKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC--S  531
             + K     PIASG+ +L T  YV+RA +GTP Q + + +DTS+D AW+PC+ C GC  S
Sbjct  83   RRKKAAPGAPIASGRLLLQTPTYVVRAGVGTPPQPLLLTVDTSNDAAWIPCTACAGCPSS  142

Query  532  ETVFAPNTSSTFGSVECSVPECSMVNGMSCP--TGGSGACNFNQSYG  666
               F+P  SSTF  + C  P CS V   SCP  T G+ AC+F+ +YG
Sbjct  143  SPSFSPANSSTFQPLPCGTPLCSQVPNPSCPSATDGAAACSFSLTYG  189



>ref|XP_003559856.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brachypodium 
distachyon]
Length=460

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 82/139 (59%), Gaps = 8/139 (6%)
 Frame = +1

Query  262  NNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRAR  441
            N+  P+SSW + +     +D +R+ YLSSL +    G    P+ASG+ +L+T  Y++RA 
Sbjct  44   NDAAPSSSWTSFIAAQTSRDTSRVLYLSSLAS----GFGGAPLASGRQLLHTPTYLVRAS  99

Query  442  IGTPGQVMYMVLDTSSDNAWVPCSGCVGCSETV--FAPNTSSTFGSVECSVPECSMVNGM  615
            +GTP Q + + +DTS+D AWVPC+GC GC  T   F P +S+TF  V C  P CS     
Sbjct  100  LGTPPQRLLLAVDTSNDAAWVPCAGCHGCPTTAPSFNPASSATFRPVPCGAPPCSQAPNP  159

Query  616  SCPT--GGSGACNFNQSYG  666
            SC +      +C F+ SYG
Sbjct  160  SCTSLAKSKNSCGFSLSYG  178



>emb|CAN74010.1| hypothetical protein VITISV_003547 [Vitis vinifera]
Length=429

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 3/81 (4%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            S+LSV+H+YG+CSPFN  +   SW+ TV+NMA KDPAR++YLSSL A  PK  T+VPIAS
Sbjct  33   SDLSVIHVYGQCSPFNQ-HKAGSWVNTVINMASKDPARVTYLSSLVA-SPKA-TSVPIAS  89

Query  397  GQNVLNTGNYVIRARIGTPGQ  459
            GQ VLN GNYV+R ++GTP +
Sbjct  90   GQQVLNIGNYVVRVKLGTPAE  110



>dbj|BAJ04354.1| pollen allergen CPA63 [Cryptomeria japonica]
Length=472

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 88/158 (56%), Gaps = 12/158 (8%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYL------SSLTALKPKGKT  378
            S LSVMHI GKCSPF   N  SSW T V      D AR   +      +  T + P+   
Sbjct  52   SSLSVMHIQGKCSPFRLLN--SSWWTAVSESIKGDTARYRAMVKGGWSAGKTMVNPQEDA  109

Query  379  NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS--ETVFAPN  552
            ++P+ASGQ  +++ NY+I+   GTP Q  Y VLDT S+ AW+PC+ C GCS  +  F P+
Sbjct  110  DIPLASGQ-AISSSNYIIKLGFGTPPQSFYTVLDTGSNIAWIPCNPCSGCSSKQQPFEPS  168

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SST+  + C+  +C ++  +   +  S  C+  Q YG
Sbjct  169  KSSTYNYLTCASQQCQLLR-VCTKSDNSVNCSLTQRYG  205



>ref|XP_004170756.1| PREDICTED: aspartic proteinase nepenthesin-1-like, partial [Cucumis 
sativus]
Length=364

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 73/111 (66%), Gaps = 8/111 (7%)
 Frame = +1

Query  337  YLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSG  516
            +LSSL A     ++ VPIAS + ++ +  +V+RA+IGTP Q + + LDTS+D AW+PCSG
Sbjct  1    FLSSLVA----RRSFVPIASARQLIQSPTFVVRAKIGTPAQTLLLALDTSNDAAWIPCSG  56

Query  517  CVGC-SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            C+GC S TVF+ + SS+F  + C  P+C+ V   SC      AC FN +YG
Sbjct  57   CIGCPSTTVFSSDKSSSFRPLPCQSPQCNQVPNPSC---SGSACGFNLTYG  104



>ref|XP_004971304.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=443

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = +1

Query  361  KPKGKTN-VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET  537
            K KG+ + VPIA G+ +L+  NYV RAR+GTP Q + + +D S+D AWVPCSGC GC+  
Sbjct  75   KNKGRRSFVPIAPGRQILSIPNYVARARLGTPAQTLLVAIDPSNDAAWVPCSGCTGCAAA  134

Query  538  V-----FAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
                  F P  SST+  V C  PEC+ V   SCP G   +C FN +Y
Sbjct  135  AASAPPFDPTQSSTYRPVRCGSPECAQVPSPSCPGGAGSSCAFNLTY  181



>gb|ABR18297.1| unknown [Picea sitchensis]
Length=452

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 79/149 (53%), Gaps = 13/149 (9%)
 Frame = +1

Query  229  VMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLT-ALKPKGKTNVPIASGQN  405
            ++HIY +CSPF  PN T  W + +      D  RL +L   + + K     NVP+ SG  
Sbjct  56   LIHIYSECSPFRPPNRT--WESLMSEKIRGDANRLRFLKRTSRSSKQDANANVPVRSG--  111

Query  406  VLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET--VFAPNTSSTFGSVE  579
               +G Y+I+   GTP Q MY ++DT SD AW+PC  C GC  T  +F P  SS++    
Sbjct  112  ---SGEYIIQVDFGTPKQSMYTLIDTGSDVAWIPCKQCQGCHSTAPIFDPAKSSSYKPFA  168

Query  580  CSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            C    C  ++G +C  GG+  C F  SYG
Sbjct  169  CDSQPCQEISG-NC--GGNSKCQFEVSYG  194



>gb|EEE56022.1| hypothetical protein OsJ_04800 [Oryza sativa Japonica Group]
Length=423

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = +1

Query  340  LSSLTALKPKGKTN--VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCS  513
            L++    KPK + N  VPIA G+ +L+  NY+ RA +GTP Q + + +D S+D AWVPCS
Sbjct  72   LTTRAKPKPKNRANPPVPIAPGRQILSIPNYIARAGLGTPAQTLLVAIDPSNDAAWVPCS  131

Query  514  GCVGC--SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
             C GC  S   F+P  SST+ +V C  P+C+ V   SCP G   +C FN +Y
Sbjct  132  ACAGCAASSPSFSPTQSSTYRTVPCGSPQCAQVPSPSCPAGVGSSCGFNLTY  183



>ref|XP_006645377.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=448

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 65/102 (64%), Gaps = 1/102 (1%)
 Frame = +1

Query  361  KPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SET  537
            K KG + VPIA G+ +L+  NYV RA +GTP Q + + +D S+D AWVPCS C GC S  
Sbjct  85   KNKGNSPVPIAPGRKILSIPNYVARAGLGTPAQTLLVAIDPSNDAAWVPCSACAGCVSSP  144

Query  538  VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
             F+P  SST+ +V C  P+C+ V   SCP G   +C FN +Y
Sbjct  145  SFSPTQSSTYRTVPCGSPQCAQVPSPSCPAGVGSSCGFNLTY  186



>gb|EAY77272.1| hypothetical protein OsI_05246 [Oryza sativa Indica Group]
Length=426

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = +1

Query  340  LSSLTALKPKGKTN--VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCS  513
            L++    KPK + N  VPIA G+ +L+  NY+ RA +GTP Q + + +D S+D AWVPCS
Sbjct  53   LTTRAKPKPKNRANPPVPIAPGRQILSIPNYIARAGLGTPAQTLLVAIDPSNDAAWVPCS  112

Query  514  GCVGC--SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
             C GC  S   F+P  SST+ +V C  P+C+ V   SCP G   +C FN +Y
Sbjct  113  ACAGCAASSPSFSPTQSSTYRTVPCGSPQCAQVPSPSCPAGVGSSCGFNLTY  164



>ref|XP_003567490.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brachypodium 
distachyon]
Length=458

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = +1

Query  361  KPKGK---TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-  528
            KPKG    T VPIA+G+ +L T +YV RAR+GTP Q + + +D S+D AWVPCS C+GC 
Sbjct  76   KPKGHSRHTFVPIAAGRQILRTPSYVARARLGTPPQTLLVAIDPSNDAAWVPCSACLGCA  135

Query  529  ---SETVFAPNTSSTFGSVECSVPECSMVNGM--SCPTGGSGACNFNQSY  663
               S   F P  SST+  V C  P+C+ V     SCP G   +C FN SY
Sbjct  136  PGASSPSFDPTQSSTYRPVRCGAPQCAQVPPATPSCPAGPGASCAFNLSY  185



>ref|NP_001045434.1| Os01g0954900 [Oryza sativa Japonica Group]
 dbj|BAB90778.1| nucleoid DNA-binding-like protein [Oryza sativa Japonica Group]
 dbj|BAF07348.1| Os01g0954900 [Oryza sativa Japonica Group]
 dbj|BAG99095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=445

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = +1

Query  340  LSSLTALKPKGKTN--VPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCS  513
            L++    KPK + N  VPIA G+ +L+  NY+ RA +GTP Q + + +D S+D AWVPCS
Sbjct  72   LTTRAKPKPKNRANPPVPIAPGRQILSIPNYIARAGLGTPAQTLLVAIDPSNDAAWVPCS  131

Query  514  GCVGC--SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
             C GC  S   F+P  SST+ +V C  P+C+ V   SCP G   +C FN +Y
Sbjct  132  ACAGCAASSPSFSPTQSSTYRTVPCGSPQCAQVPSPSCPAGVGSSCGFNLTY  183



>gb|ACN40790.1| unknown [Picea sitchensis]
Length=452

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 78/149 (52%), Gaps = 13/149 (9%)
 Frame = +1

Query  229  VMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLT-ALKPKGKTNVPIASGQN  405
            ++HIY +CSPF  PN T  W + +      D  RL +L   + + K     NVP+ SG  
Sbjct  56   LIHIYSECSPFRPPNRT--WESLMSEKIRGDANRLRFLKRTSRSSKEDANANVPVRSG--  111

Query  406  VLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET--VFAPNTSSTFGSVE  579
               +G Y+I+   GTP Q MY ++DT SD AW+PC  C GC  T  +F P  SS++    
Sbjct  112  ---SGEYIIQVDFGTPKQSMYTLIDTGSDVAWIPCKQCQGCHSTAPIFDPAKSSSYKPFA  168

Query  580  CSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            C    C  ++G +C  GG+  C F   YG
Sbjct  169  CDSQPCQEISG-NC--GGNSKCQFEVLYG  194



>ref|XP_010916666.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Elaeis 
guineensis]
Length=430

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (62%), Gaps = 12/138 (9%)
 Frame = +1

Query  268  PNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIG  447
            P  +SS   +V+  A  DPARL++LS       +  T VPIASGQ +L + +YV+RAR+G
Sbjct  36   PPASSSLFDSVLAAAHTDPARLAFLS-------QKATAVPIASGQQLLQSNSYVLRARLG  88

Query  448  TPGQVMYMVLDTSSDNAWVPCSGCVGCSET-VFAPNTSSTFGSVECSVPECSMVNGMSC-  621
            +PGQ++ +VLDT SD AWVPCS C  C  + +F  + S+T+ S+ CS   C M  G  C 
Sbjct  89   SPGQLLLLVLDTGSDAAWVPCSPCSSCPSSNLFLASNSTTYSSLPCSSSWCPMFQGQPCG  148

Query  622  --PTGGSGA-CNFNQSYG  666
              PTG + + C +N  YG
Sbjct  149  ASPTGPTPSPCTYNSGYG  166



>gb|EPS70765.1| hypothetical protein M569_03988, partial [Genlisea aurea]
Length=395

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 76/132 (58%), Gaps = 20/132 (15%)
 Frame = +1

Query  283  SWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQV  462
            SW  +++N    D +R++YL+         ++ VPIASG+ V     Y++RA IGTP Q 
Sbjct  20   SWKESLLN----DASRIAYLA---------RSIVPIASGRAVTLNPTYIVRATIGTPPQT  66

Query  463  MYMVLDTSSDNAWVPCSGCVGCS----ETVFAPNTSSTFGSVECSVPECSMVNGMSCPTG  630
            + + LDTS+D AWVP +GC GCS       + P+ S+TF  V C  P+C+ V   SC   
Sbjct  67   LLLALDTSNDVAWVPTTGCSGCSAASDAVAYNPSKSTTFKPVNCGSPQCNQVPNPSC---  123

Query  631  GSGACNFNQSYG  666
            G  +C FN +YG
Sbjct  124  GGASCGFNLTYG  135



>gb|EEE67743.1| hypothetical protein OsJ_25435 [Oryza sativa Japonica Group]
Length=396

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 65/100 (65%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  KGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVF  543
            +G+   PIASG+ +L T  YV+RAR+GTP Q + + +DTS+D AW+PCSGC GC + + F
Sbjct  35   QGRAYAPIASGRQLLQTPTYVVRARLGTPAQQLLLAVDTSNDAAWIPCSGCAGCPTSSPF  94

Query  544  APNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSY  663
             P  S+++  V C  P+C +    SC +  + +C F+ SY
Sbjct  95   NPAASASYRPVPCGSPQCVLAPNPSC-SPNAKSCGFSLSY  133



>ref|XP_010922206.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=459

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 90/168 (54%), Gaps = 10/168 (6%)
 Frame = +1

Query  193  FCAPNKANSELSVMHIYGKCSPFNNPNP--TSSWLTTVMNMAVKDPARLSYLS-----SL  351
            F  P     +L ++H +   S  + P+P   SS+  T+ ++  +D +RL  L+     S+
Sbjct  32   FSLPAAVAVDLRILHAFNHFSHLHYPDPFSPSSFEATLHSLTSRDDSRLLALADTTTPSM  91

Query  352  TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-  528
             A K    +   +A G+ +L T  Y++RA +GTP Q + + +DTS+D AW+PC+ C GC 
Sbjct  92   RAAKTDRTSAPQLAYGRLLLQTPTYLVRAGVGTPPQTLLLAVDTSNDAAWIPCTACAGCP  151

Query  529  SETVFAPNTSSTFGSVECSVPECSMVNGMSCP--TGGSGACNFNQSYG  666
            S +  +P       ++ C  P CS V   SCP  T G+  C+FN +YG
Sbjct  152  SSSPPSPLHLLHLPTLPCDYPLCSQVPNPSCPSATDGAATCSFNLTYG  199



>ref|XP_008656859.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Zea 
mays]
 gb|AFW83929.1| hypothetical protein ZEAMMB73_279135 [Zea mays]
Length=451

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 79/144 (55%), Gaps = 14/144 (10%)
 Frame = +1

Query  271  NPTSSWLTTVMNMAVKDPARLSYL----------SSLTALKPKG--KTNVPIASGQNVLN  414
             P ++W  T+      D AR + L          S++ A K KG  ++ VPIA G+ +L+
Sbjct  45   TPVTAWAATLAAQTASDAARAATLATGPRDPPPASAVDAAK-KGPRRSFVPIAPGRQLLS  103

Query  415  TGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET-VFAPNTSSTFGSVECSVP  591
              +YV RAR+GTP Q + + +D S+D AWVPC+ C GC+    F P  SST+  V C  P
Sbjct  104  IPSYVARARLGTPAQALLVAIDPSNDAAWVPCAACAGCARAPSFDPTRSSTYRPVRCGAP  163

Query  592  ECSMVNGMSCPTGGSGACNFNQSY  663
            +CS     SCP G   +C FN SY
Sbjct  164  QCSQAPAPSCPGGLGSSCAFNLSY  187



>gb|EAY88829.1| hypothetical protein OsI_10302 [Oryza sativa Indica Group]
Length=440

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 82/146 (56%), Gaps = 19/146 (13%)
 Frame = +1

Query  220  ELSVMHIYGKCSPFNNPNPTS-SWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            ELSV H         N +P+S S L +++ +A  D ARL +LSS  A    G ++ P+AS
Sbjct  26   ELSVYH---------NVHPSSPSPLESIIALARDDDARLLFLSSKAATA--GVSSAPVAS  74

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            GQ      +YV+RA +G+P Q + + LDTS+D  W  CS C  C S ++FAP  SS++ S
Sbjct  75   GQA---PPSYVVRAGLGSPSQQLLLALDTSADATWAHCSPCGTCPSSSLFAPANSSSYAS  131

Query  574  VECSVPECSMVNGMSCPT---GGSGA  642
            + CS   C +  G +CP    GG  A
Sbjct  132  LPCSSSWCPLFQGQACPAPQGGGDAA  157



>gb|AFG60356.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60358.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60361.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
Length=154

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 72/136 (53%), Gaps = 5/136 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K    + + HI+G CSP   P  +S W+  V     +D  RL  + S  +      +N+P
Sbjct  1    KPGVNIRLDHIHGACSPLR-PANSSKWIDLVSQSLERDNDRLKTIRSRNSGSYTTMSNLP  59

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTS  558
            + SG N + TGNY++ A  GTP +   +++DT SD  W+ C  C+GC    + +F P+ S
Sbjct  60   LQSG-NKVGTGNYIVTAGFGTPTKKFLLIIDTGSDLTWIQCKPCLGCYSQVDPIFEPSQS  118

Query  559  STFGSVECSVPECSMV  606
            S++ S+ C    C+ +
Sbjct  119  SSYKSLPCLSATCTEL  134



>gb|AFB33415.1| hypothetical protein 2_5996_01, partial [Pinus mugo]
 gb|AFB33416.1| hypothetical protein 2_5996_01, partial [Pinus mugo]
Length=154

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 5/136 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K    + + HI+G CSP   P  +S W+  V     +D  RL  + S  +      +N+P
Sbjct  1    KPGVNIRLDHIHGACSPLR-PTNSSKWIDLVSQSLERDNDRLKTIRSRNSGPYTTMSNLP  59

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTS  558
            + SG  V  TGNY++ A  GTP +   +V+DT SD  W+ C  C+GC    + +F P+ S
Sbjct  60   LQSGSEV-GTGNYILTAGFGTPTKKFLLVIDTGSDLTWIQCKPCLGCYSQVDPIFEPSQS  118

Query  559  STFGSVECSVPECSMV  606
            S++ S+ C    C+ +
Sbjct  119  SSYKSLPCLSATCTEL  134



>ref|NP_001049205.1| Os03g0186900 [Oryza sativa Japonica Group]
 dbj|BAD26705.1| Radc1 [Oryza sativa Japonica Group]
 gb|ABF94364.1| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11119.1| Os03g0186900 [Oryza sativa Japonica Group]
 dbj|BAG88249.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99854.1| unnamed protein product [Oryza sativa Japonica Group]
Length=438

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 79/133 (59%), Gaps = 10/133 (8%)
 Frame = +1

Query  259  FNNPNPTS-SWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIR  435
            ++N +P+S S L +++ +A  D ARL +LSS  A    G ++ P+ASGQ      +YV+R
Sbjct  28   YHNVHPSSPSPLESIIALARDDDARLLFLSSKAATA--GVSSAPVASGQA---PPSYVVR  82

Query  436  ARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGSVECSVPECSMVNG  612
            A +G+P Q + + LDTS+D  W  CS C  C S ++FAP  SS++ S+ CS   C +  G
Sbjct  83   AGLGSPSQQLLLALDTSADATWAHCSPCGTCPSSSLFAPANSSSYASLPCSSSWCPLFQG  142

Query  613  MSCPT---GGSGA  642
             +CP    GG  A
Sbjct  143  QACPAPQGGGDAA  155



>gb|AEW08302.1| hypothetical protein 2_5996_01, partial [Pinus radiata]
 gb|AFG60348.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60350.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60351.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60352.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60353.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60354.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60355.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60357.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60359.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60360.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60362.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60363.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
Length=154

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 72/136 (53%), Gaps = 5/136 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K    + + HI+G CSP   P  +S W+  V     +D  RL  + S  +      +N+P
Sbjct  1    KPGVNIRLDHIHGACSPLR-PANSSKWIDLVSQSLERDNDRLKTIRSRNSGPYTTMSNLP  59

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS---ETVFAPNTS  558
            + SG N + TGNY++ A  GTP +   +++DT SD  W+ C  C+GC    + +F P+ S
Sbjct  60   LQSG-NKVGTGNYIVTAGFGTPTKKFLLIIDTGSDLTWIQCKPCLGCYSQVDPIFEPSQS  118

Query  559  STFGSVECSVPECSMV  606
            S++ S+ C    C+ +
Sbjct  119  SSYKSLPCLSATCTEL  134



>gb|AFB33417.1| hypothetical protein 2_5996_01, partial [Pinus mugo]
 gb|AFB33418.1| hypothetical protein 2_5996_01, partial [Pinus mugo]
 gb|AFB33419.1| hypothetical protein 2_5996_01, partial [Pinus mugo]
 gb|AFB33420.1| hypothetical protein 2_5996_01, partial [Pinus mugo]
 gb|AFB33421.1| hypothetical protein 2_5996_01, partial [Pinus mugo]
 gb|AFB33422.1| hypothetical protein 2_5996_01, partial [Pinus mugo]
Length=154

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 5/136 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K    + + HI+G CSP   P  +S W+  V     +D  RL  + S  +      +N+P
Sbjct  1    KPGVNIRLDHIHGACSPLR-PTNSSKWIDLVSQSLERDNDRLKTIRSRNSGPYTTMSNLP  59

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTS  558
            + SG  V  TGNY++ A  GTP +   +V+DT SD  W+ C  C+GC    + +F P+ S
Sbjct  60   LQSGSEV-GTGNYILTAGFGTPTKKFLLVIDTGSDLTWIQCKPCLGCYSQVDPIFDPSQS  118

Query  559  STFGSVECSVPECSMV  606
            S++ S+ C    C+ +
Sbjct  119  SSYKSLPCLSATCTEL  134



>gb|AFG60347.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
 gb|AFG60349.1| hypothetical protein 2_5996_01, partial [Pinus taeda]
Length=154

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 72/136 (53%), Gaps = 5/136 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K    + + HI+G CSP   P  +S W+  +     +D  RL  + S  +      +N+P
Sbjct  1    KPGVNIRLDHIHGACSPLR-PANSSKWIDLISQSLERDNDRLKTIRSRNSGPYTTMSNLP  59

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTS  558
            + SG N + TGNY++ A  GTP +   +++DT SD  W+ C  C+GC    + +F P+ S
Sbjct  60   LQSG-NKVGTGNYIVTAGFGTPTKKFLLIIDTGSDLTWIQCKPCLGCYSQVDPIFEPSQS  118

Query  559  STFGSVECSVPECSMV  606
            S++ S+ C    C+ +
Sbjct  119  SSYKSLPCLSATCTEL  134



>gb|AEW08303.1| hypothetical protein 2_5996_01, partial [Pinus lambertiana]
Length=154

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 72/136 (53%), Gaps = 5/136 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K    + + HI+G CSP   P  +SSW+  V     +D  RL  + S  +      +N+P
Sbjct  1    KPGVNIRLDHIHGACSPLR-PINSSSWIDLVSQSLERDDDRLKTIRSRNSSPYTTMSNLP  59

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTS  558
            + SG N + TGNY++ A +GTP +   +++DT SD  W+ C  C+ C    + +F P  S
Sbjct  60   LQSG-NKVGTGNYIVTAGLGTPTKNFLLIIDTGSDLTWIQCKPCLDCYSQVDPIFEPRQS  118

Query  559  STFGSVECSVPECSMV  606
            S++ S+ C    C+ +
Sbjct  119  SSYKSLPCLSATCTEL  134



>ref|XP_009387158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Musa acuminata 
subsp. malaccensis]
Length=443

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 82/153 (54%), Gaps = 19/153 (12%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            ++L + H     +  ++P P    L +V+++A  D  RL++LS       +  T+VP+AS
Sbjct  43   ADLRIFH-----AERHSPTP----LDSVLSLARNDLTRLAFLS-------RKVTSVPVAS  86

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAW--VPCSGCVGCSETVFAPNTSSTFG  570
            GQ VL + +YV+RA++G+PGQ++ + LDTS+D AW           S  +F P  SST+ 
Sbjct  87   GQQVLQSSSYVLRAKLGSPGQLLLLALDTSADAAWTSCSPCSTCPSSSALFLPANSSTYS  146

Query  571  SVECSVPECSMVNGMSCPTGGSGA-CNFNQSYG  666
             + C    C    G SC    + + C + Q YG
Sbjct  147  PLPCYSSWCPQFKGQSCAADSAPSPCTYYQPYG  179



>ref|XP_003558637.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brachypodium 
distachyon]
Length=432

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 74/119 (62%), Gaps = 7/119 (6%)
 Frame = +1

Query  274  PTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTP  453
            P+SS L +++ +A +D ARL +LSS  A    G ++ P+ASGQ+     +YV+RA +G+P
Sbjct  32   PSSSPLESIIALAREDDARLLFLSSKAA--STGVSSAPVASGQS---PPSYVVRAGLGSP  86

Query  454  GQVMYMVLDTSSDNAWVPCSGCVGC--SETVFAPNTSSTFGSVECSVPECSMVNGMSCP  624
             Q + + LDTS+D  W  CS C  C  S ++FAP  S+++  + CS   C+++ G  CP
Sbjct  87   AQPILLALDTSADATWAHCSPCGTCPSSGSLFAPANSTSYAPLPCSSTMCTVLQGQPCP  145



>ref|XP_006649524.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=429

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 76/136 (56%), Gaps = 14/136 (10%)
 Frame = +1

Query  220  ELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASG  399
            +LSV H     SP        S L +++ +A +D ARL +LSS  A    G ++ P+ASG
Sbjct  19   DLSVYHNVHPASP--------SPLESIIALAREDDARLLFLSSKAA--STGVSSAPVASG  68

Query  400  QNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGSV  576
            Q      +YV+RA +G+P Q + + LDTS+D  W  CS C  C + ++F P  SS++ S+
Sbjct  69   QT---PPSYVVRAGLGSPSQQVLLALDTSADATWAHCSPCSTCPTSSLFVPANSSSYASL  125

Query  577  ECSVPECSMVNGMSCP  624
             CS   C +  G +CP
Sbjct  126  PCSSSWCPLFQGQACP  141



>dbj|BAJ99659.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 78/158 (49%), Gaps = 9/158 (6%)
 Frame = +1

Query  214  NSELSVMHIYGKCSPFNN---PNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNV  384
            +S L+V+H  G CSP      P P +  L            +++  +S    + +GK  V
Sbjct  72   SSALNVVHRQGPCSPLQARGAPPPHAELLNDDQARVDSIHRKIAAAASPVLDQARGKKGV  131

Query  385  PIASGQNV-LNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET---VFAPN  552
             + + + + L TGNYV+   +GTP + M +V DT SD +WV C+ C  C E    +F P 
Sbjct  132  TLPAQRGISLGTGNYVVSMGLGTPARDMTVVFDTGSDLSWVQCTPCSDCYEQKDPLFDPA  191

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             SST+ +V C+ PEC  ++  SC       C +   YG
Sbjct  192  RSSTYSAVPCASPECQGLDSRSCSR--DKKCRYEVVYG  227



>ref|XP_008795166.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=423

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 9/134 (7%)
 Frame = +1

Query  268  PNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIG  447
            P  +SS   +V+  A  DPARL++LS  T       T+VPIASGQ +L + +YV+RA++G
Sbjct  34   PPASSSLFDSVLAAAHTDPARLAFLSQKT-------TSVPIASGQQLLQSNSYVLRAQLG  86

Query  448  TPGQVMYMVLDTSSDNAWVPCSGCVGCSET-VFAPNTSSTFGSVECSVPECSMVNGMSCP  624
            +PGQ++ +VLDT SD AWVPCS C  C  + +F  + S+T+ S+ CS   C M  G SC 
Sbjct  87   SPGQLLLLVLDTGSDAAWVPCSPCSSCPSSDLFLSSNSTTYSSLSCSSSWCPMFQGQSCA  146

Query  625  TGGSGACNFNQSYG  666
               S  C +N  YG
Sbjct  147  ASPS-PCTYNSGYG  159



>gb|EYU29201.1| hypothetical protein MIMGU_mgv1a005225mg [Erythranthe guttata]
Length=492

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 87/166 (52%), Gaps = 16/166 (10%)
 Frame = +1

Query  184  ATQFCAPNKANSELSVMHIYGKCSPF-NNPNPTSSWLTTVMNMAVKDPARLSYL------  342
            +T F   NK  S L V+H +G CS   NNP+  +S    +  +   D  R+  +      
Sbjct  62   STNFKGSNKRQSTLEVLHQHGPCSRGPNNPSAATSPPPLLSEILSHDQIRVDKINARIKQ  121

Query  343  SSLTALKPKGK-TNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGC  519
            +S T  + KGK  N+P+ SG++ L +GNY++   +GTP + + ++ DT SD  W  C  C
Sbjct  122  TSYTKNQIKGKKVNLPVQSGRS-LGSGNYIVTLGLGTPQKTLSLIFDTGSDLTWTQCQPC  180

Query  520  VGC----SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGAC  645
            V       + +F P+ S+++ +V C+ P+CS    +S  TG S  C
Sbjct  181  VKSCYQQQDPIFNPSDSTSYSNVSCNSPQCSQ---LSAATGNSPGC  223



>ref|XP_010913225.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=463

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 81/161 (50%), Gaps = 25/161 (16%)
 Frame = +1

Query  223  LSVMHIYGKCSPF---NNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT-----  378
            L V+H +G CSP      P+ T         +  +D AR+++L    +     K+     
Sbjct  60   LKVVHRHGPCSPLTPGQKPDYT--------ELLSQDQARVNWLHHWISTSSNQKSTRASL  111

Query  379  --NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVF  543
              N+P +SG ++  TGNYV+    GTP +   +V DT SD  W+ CS C  C    + +F
Sbjct  112  AANIPASSGGSI-GTGNYVVNVGFGTPTKEFTVVFDTGSDLTWIQCSPCRSCYPQQQQLF  170

Query  544  APNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             P+ SST+ ++ C+ P+CS ++  SC    +G C +   YG
Sbjct  171  DPSRSSTYSNISCNSPKCSQLDSSSCL---AGRCRYEVDYG  208



>gb|ABR16115.1| unknown [Picea sitchensis]
Length=482

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 82/158 (52%), Gaps = 7/158 (4%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K   ++ + HI+G CSP   P  +SSW+  V     +D ARL+ + S  +      +N+P
Sbjct  67   KPGVKIRLDHIHGACSPLR-PINSSSWIDLVSQSFERDNARLNTIRSKNSGPYTTMSNLP  125

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTS  558
            + SG  V  TGNY++ A  GTP +   +++DT SD  W+ C  C  C    + +F P  S
Sbjct  126  LQSGTTV-GTGNYIVTAGFGTPAKNSLLIIDTGSDLTWIQCKPCADCYSQVDAIFEPKQS  184

Query  559  STFGSVECSVPECS-MVNGMSCPTG-GSGACNFNQSYG  666
            S++ ++ C    C+ ++   S PT    G C +  +YG
Sbjct  185  SSYKTLPCLSATCTELITSESNPTPCLLGGCVYEINYG  222



>emb|CAJ26370.1| chloroplast nucleoid binding protein [Brachypodium sylvaticum]
Length=443

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 76/154 (49%), Gaps = 13/154 (8%)
 Frame = +1

Query  229  VMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPK---GKTNVPIASG  399
            VMH +G CSP   P+   S      ++   D AR+  +  + A +        ++P   G
Sbjct  22   VMHRHGPCSPLQTPDDAPSD----ADLLEHDQARVDSIHRMIANETAVVGQDVSLPAERG  77

Query  400  QNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCS--GCVGCSETVFAPNTSST  564
             +V  TGNYV+   +GTP + + +V DT SD +WV   PCS  GC    + +FAP++SST
Sbjct  78   ISV-GTGNYVVSVGLGTPARDLTVVFDTGSDLSWVQCGPCSSGGCYHQQDPLFAPSSSST  136

Query  565  FGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            F +V C  PEC         + G   C +   YG
Sbjct  137  FSAVRCGEPECPRARQSCSSSPGDDRCPYEVVYG  170



>ref|NP_001266543.1| aspartic proteinase nepenthesin-1 precursor [Zea mays]
 gb|ACG35399.1| aspartic proteinase nepenthesin-1 precursor [Zea mays]
Length=431

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 82/155 (53%), Gaps = 18/155 (12%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            ++LSV H        N   P+ S L +++ +A  D ARL +LSS  A    G T+ P+AS
Sbjct  22   ADLSVYH--------NVHPPSPSPLESIIALARADDARLLFLSS-KAASSGGVTSAPVAS  72

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            GQ      +YV+RA +GTP Q + + LDTS+D  W  C+ C  C + + F P +SS++ S
Sbjct  73   GQT---PPSYVVRAGLGTPVQQLLLALDTSADATWSHCAPCDTCPAGSRFIPASSSSYAS  129

Query  574  VECSVPECSMVNGMSCPTGGSG-----ACNFNQSY  663
            + C+   C +  G  CP          AC F++ +
Sbjct  130  LPCASDWCPLFEGQPCPANQDASAPLPACAFSKPF  164



>gb|ACF83459.1| unknown [Zea mays]
 gb|ACF86066.1| unknown [Zea mays]
 gb|ACL53485.1| unknown [Zea mays]
 gb|ACL53554.1| unknown [Zea mays]
 gb|ACN29126.1| unknown [Zea mays]
 tpg|DAA43775.1| TPA: aspartic proteinase nepenthesin-1 [Zea mays]
Length=431

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 82/155 (53%), Gaps = 18/155 (12%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            ++LSV H        N   P+ S L +++ +A  D ARL +LSS  A    G T+ P+AS
Sbjct  22   ADLSVYH--------NVHPPSPSPLESIIALARADDARLLFLSS-KAASSGGVTSAPVAS  72

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            GQ      +YV+RA +GTP Q + + LDTS+D  W  C+ C  C + + F P +SS++ S
Sbjct  73   GQT---PPSYVVRAGLGTPVQQLLLALDTSADATWSHCAPCDTCPAGSRFIPASSSSYAS  129

Query  574  VECSVPECSMVNGMSCPTGGSG-----ACNFNQSY  663
            + C+   C +  G  CP          AC F++ +
Sbjct  130  LPCASDWCPLFEGQPCPANQDASAPLPACAFSKPF  164



>ref|NP_001131154.1| uncharacterized protein LOC100192462 precursor [Zea mays]
 gb|ACF79448.1| unknown [Zea mays]
Length=431

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 82/155 (53%), Gaps = 18/155 (12%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIAS  396
            ++LSV H        N   P+ S L +++ +A  D ARL +LSS  A    G T+ P+AS
Sbjct  22   ADLSVYH--------NVHPPSPSPLESIIALARADDARLLFLSS-KAASSGGITSAPVAS  72

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGS  573
            GQ      +YV+RA +GTP Q + + LDTS+D  W  C+ C  C + + F P +SS++ S
Sbjct  73   GQT---PPSYVVRAGLGTPVQQLLLALDTSADATWSHCAPCDTCPAGSRFIPASSSSYAS  129

Query  574  VECSVPECSMVNGMSCPTGGSG-----ACNFNQSY  663
            + C+   C +  G  CP          AC F++ +
Sbjct  130  LPCASDWCPLFEGQPCPANQDASAPLPACAFSKPF  164



>ref|XP_009390623.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=465

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 73/155 (47%), Gaps = 8/155 (5%)
 Frame = +1

Query  217  SELSVMHIYGKCSPFNNPN--PTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPI  390
            S+L V+H +G CSPF+     P +  L            R S  + +  L+      +P 
Sbjct  59   SKLKVVHRHGPCSPFDEGRKLPHARLLDADQARVDSLHVRASAAAQVDKLRSSSAARIPA  118

Query  391  ASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNTSS  561
             +G + L TGNYV+    GTP     +V DT SD  W+   PC+ C    E VF P  SS
Sbjct  119  RTGGS-LGTGNYVVTVGFGTPLMDFSVVFDTGSDVTWIQCKPCNDCYAQQEPVFDPAQSS  177

Query  562  TFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            T+ ++ C+  +C  ++  SC    +  C ++  YG
Sbjct  178  TYATLACNSADCGRLDSHSCSNAST--CRYDVQYG  210



>ref|XP_004985428.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=452

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 5/118 (4%)
 Frame = +1

Query  274  PTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTP  453
            P+ S L +++ +A  D ARL +LSS  A  P G T+ P+ASGQ      +YV+RA +GTP
Sbjct  54   PSPSPLESIIALARADDARLLFLSSKAAASP-GVTSAPVASGQA---PPSYVVRAGLGTP  109

Query  454  GQVMYMVLDTSSDNAWVPCSGCVGC-SETVFAPNTSSTFGSVECSVPECSMVNGMSCP  624
             Q   + LDTS+D  W  C+ C  C + + F P +SS++ ++ C+   C +  G  CP
Sbjct  110  VQQTLLALDTSADATWAHCAPCDTCPAGSRFIPASSSSYAALPCASDWCPLFQGQPCP  167



>ref|XP_002460431.1| hypothetical protein SORBIDRAFT_02g028000 [Sorghum bicolor]
 gb|EER96952.1| hypothetical protein SORBIDRAFT_02g028000 [Sorghum bicolor]
Length=481

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 74/158 (47%), Gaps = 19/158 (12%)
 Frame = +1

Query  229  VMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNV  408
            V+H +G CSP        S       +  +D  R+  +  L A +P    + P ++ + V
Sbjct  68   VVHRHGPCSPLQARGGEPSH----AEILDRDQDRVDSIHRLAAARPSSTADDPSSASKGV  123

Query  409  ---------LNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET---VFAPN  552
                     L T NY++   +GTP + + +V DT SD +WV C  C GC +    +F P+
Sbjct  124  SLPARRGVPLGTANYIVSVGLGTPKRDLLVVFDTGSDLSWVQCKPCDGCYQQHDPLFDPS  183

Query  553  TSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             S+T+ +V C   EC  ++  SC    SG C +   YG
Sbjct  184  QSTTYSAVPCGAQECRRLDSGSC---SSGKCRYEVVYG  218



>ref|XP_010108295.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18775.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=433

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 88/172 (51%), Gaps = 24/172 (14%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSL-----TALKP--  366
            K  + L V+H YG CS  +  N          ++ ++D AR+++++S      TA  P  
Sbjct  9    KDKASLEVIHKYGPCSQLHQENNVDH----AQDIHLQDQARVNWINSHRPKKSTATAPAN  64

Query  367  -----KGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSG-C  519
                 +  T +P  +G  V+ +G+Y+++  +GTP + + ++ DT SD  W    PC G C
Sbjct  65   DTIYEQDATTLPAKTGA-VIGSGDYIVKVGLGTPKEDLSLIFDTGSDLTWTQCQPCDGHC  123

Query  520  VGCSETVFAPNTSSTFGSVECSVPECSMVN---GMSCPTGGSGACNFNQSYG  666
               SE +F P+ S+++ +V C+  ECS +    G +  +  +  C +++ YG
Sbjct  124  YKQSEAIFDPSKSTSYATVSCTSTECSQLKSSTGTAACSRTASTCTYDEGYG  175



>ref|XP_006287637.1| hypothetical protein CARUB_v10000848mg [Capsella rubella]
 gb|EOA20535.1| hypothetical protein CARUB_v10000848mg [Capsella rubella]
Length=481

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 78/158 (49%), Gaps = 18/158 (11%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALK-------P  366
            K  S L V H +G CSP NN   T      ++ +   D AR++ + S  + K        
Sbjct  64   KTKSSLHVTHRHGTCSPLNNGKATRPDHVEILKL---DQARVNSIHSKLSKKLTTNHVGQ  120

Query  367  KGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC----SE  534
               T++P   G + L +GNY++   +GTP   + ++ DT SD  W  C  CV       E
Sbjct  121  SQSTDLPAKDG-STLGSGNYIVTVGLGTPKHDLSLIFDTGSDLTWTQCEPCVRTCYSQKE  179

Query  535  TVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACN  648
             +F P+ SS++ +V CS P C+    +S  TG +G+C+
Sbjct  180  PIFNPSKSSSYYNVSCSSPACT---SLSSATGNAGSCS  214



>gb|ABK24493.1| unknown [Picea sitchensis]
Length=479

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 78/157 (50%), Gaps = 9/157 (6%)
 Frame = +1

Query  208  KANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP  387
            K   ++ + HI+G CSP   P  +SSW+  V     +D  RL+ + S         +N+P
Sbjct  68   KPGVKIRLDHIHGACSPLR-PINSSSWIDMVSQSFDRDNDRLNTIWSKNNGTYSTMSNLP  126

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNTS  558
            +  G  V  TGNY++ A  GTP +   +++DT SD  W+   PCS C    + +F P  S
Sbjct  127  LQPGSKV-GTGNYIVTAGFGTPAKNSLLIIDTGSDVTWIQCKPCSDCYSQVDPIFEPQQS  185

Query  559  STFGSVECSVPECSMVNGM-SCPTGGSGACNFNQSYG  666
            S++  + C    C+ +  M  C  GG   C +  +YG
Sbjct  186  SSYKHLSCLSSACTELTTMNHCRLGG---CVYEINYG  219



>ref|XP_008811141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=464

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 79/163 (48%), Gaps = 11/163 (7%)
 Frame = +1

Query  202  PNKAN-SELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDP--ARLSYLSSLTALKPKG  372
            P   N S L V+H +G CSP       S       + A  D    R+S  SS  + +   
Sbjct  52   PKDLNTSRLKVVHPHGPCSPIGTGREPSHAKLLNRDQARVDSLHHRISTASSRESTRSSL  111

Query  373  KTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCS-----ET  537
               +P ++G + L TGNY++    GTP   + +V DT SD  W+ C  C   S     + 
Sbjct  112  AATIPASTGGS-LGTGNYIVTVGFGTPKSDLTVVFDTGSDLTWIQCKPCSSGSCYPQQQP  170

Query  538  VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +F P+ SST+ ++ CS PECS+++  +C    S  C ++  YG
Sbjct  171  LFDPSQSSTYSNISCSSPECSLLDSSTC--SASSPCRYDIEYG  211



>gb|EAZ09523.1| hypothetical protein OsI_31798 [Oryza sativa Indica Group]
Length=485

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 71/166 (43%), Gaps = 24/166 (14%)
 Frame = +1

Query  223  LSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP-----  387
            L V+H +G CSP            T   +  +D AR+  +      K  G    P     
Sbjct  71   LGVVHRHGPCSPVQARRRGGGGAVTHAEILERDQARVDSIHR----KVAGAGGAPSVVDP  126

Query  388  -IASGQNV---------LNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET  537
              AS Q V         L TGNYV+   +GTP +   ++ DT SD +WV C  C  C E 
Sbjct  127  ARASEQGVSLPAQRGISLGTGNYVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPCADCYEQ  186

Query  538  ---VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
               +F P+ SST+ +V C  PEC  ++   C +     C +   YG
Sbjct  187  QDPLFDPSLSSTYAAVACGAPECQELDASGCSS--DSRCRYEVQYG  230



>ref|XP_002460430.1| hypothetical protein SORBIDRAFT_02g027990 [Sorghum bicolor]
 gb|EER96951.1| hypothetical protein SORBIDRAFT_02g027990 [Sorghum bicolor]
Length=488

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 73/141 (52%), Gaps = 10/141 (7%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLS---SLTALKPKG  372
            P  A S L+V+H +G CSP  +    +   T ++    +D  R+  +    + ++ KPKG
Sbjct  66   PAAAPSSLTVVHRHGPCSPLRSRGSGAPSHTEILR---RDQDRVDAIRRKVTASSNKPKG  122

Query  373  KTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET---VF  543
              ++ +A+    L+T NYV   R+GTP   + + LDT SD +WV C  C  C E    VF
Sbjct  123  GVSL-LANWGKSLSTTNYVASLRLGTPATELVVELDTGSDQSWVQCKPCADCYEQRDPVF  181

Query  544  APNTSSTFGSVECSVPECSMV  606
             P  SST+ +V C   EC  +
Sbjct  182  DPTASSTYSAVPCGARECQEL  202



>ref|XP_008452815.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=475

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 72/144 (50%), Gaps = 19/144 (13%)
 Frame = +1

Query  214  NSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSY--------LSSLTALKPK  369
             S L V+H +G C    +  PT++       M V+D AR+ +        L S+  L+P 
Sbjct  62   QSSLEVIHRHGPCGDDVSNAPTAA------EMFVQDQARVDFIHSKFAGELESVDRLRPS  115

Query  370  GKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCV----GCSET  537
              T +P  SG  +  +GNY++   +GTP + + ++ DT SD  W  C  C        + 
Sbjct  116  KATKIPAKSGATI-GSGNYIVNVGLGTPKKYLSLIFDTGSDLTWTQCQPCARYCYNQKDP  174

Query  538  VFAPNTSSTFGSVECSVPECSMVN  609
            VFAP+ S+T+ ++ CS  +CS + 
Sbjct  175  VFAPSQSTTYSNISCSSSDCSQLE  198



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 8/108 (7%)
 Frame = +1

Query  352  TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCV  522
            T  +P+  T  P+ SG +   +G Y  R  +GTP + MY+VLDT SD  W+   PCS C 
Sbjct  141  TRYQPEDLTT-PVVSGASQ-GSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCY  198

Query  523  GCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
              S+ VF+P +SST+ S+ C+ P+CS++   +C    S  C +  SYG
Sbjct  199  QQSDPVFSPTSSSTYKSLTCAAPQCSLLETSACR---SNKCLYQVSYG  243



>ref|XP_003563922.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=450

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 86/173 (50%), Gaps = 24/173 (14%)
 Frame = +1

Query  190  QFCAPNKANSELSVMHIYGKCSP--FNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALK  363
             F   N      ++ H    CSP   ++  P S+++T        D AR++ L+S  A K
Sbjct  33   DFQHLNSTGLHQTLHHPQSPCSPAPLSSDLPFSAFIT-------HDAARIAGLASRLATK  85

Query  364  PK---GKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGC-VGCS  531
             K     ++VP+ASG +V   GNY+ R  +GTP     MV+D+ S   W+ C+ C V C 
Sbjct  86   DKDWVAASSVPLASGASV-GVGNYITRLGLGTPTTTYVMVVDSGSSLTWLQCAPCAVSCH  144

Query  532  ET---VFAPNTSSTFGSVECSVPEC-----SMVNGMSCPTGGSGACNFNQSYG  666
                 ++ P  SST+ +V CS P+C     + +N  SC   GSG C +  SYG
Sbjct  145  PQAGPLYDPRASSTYAAVPCSAPQCAELQAATLNPSSC--SGSGVCQYQASYG  195



>ref|XP_010258628.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=493

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 82/167 (49%), Gaps = 14/167 (8%)
 Frame = +1

Query  202  PNKANSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKG---  372
            PN + + L ++H  G CS       T       + +  +D +R+ +L S  +   +G   
Sbjct  68   PNNSKNRLKILHRNGPCSHLGG-GKTKPLPLAAIEILSEDQSRVDFLQSRLSNNSRGSAV  126

Query  373  ---KTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCV----GCS  531
               +  VP  SG+  L +GNYV+R  +G+P   + ++ DT SD  W+ C  C        
Sbjct  127  RNSEARVPARSGR-YLGSGNYVVRVGLGSPRTDLSLIFDTGSDLTWIQCKPCTRYCHKQQ  185

Query  532  ETVFAPNTSSTFGSVECSVPECSMV-NGMSCPTGGSGA-CNFNQSYG  666
            + +F P  SS++ +V CS  ECS + +  S PTG S + C ++  YG
Sbjct  186  DPIFDPTKSSSYSNVTCSADECSQLSSATSSPTGCSASTCIYSIQYG  232



>ref|XP_009798772.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
sylvestris]
Length=472

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 77/146 (53%), Gaps = 11/146 (8%)
 Frame = +1

Query  238  IYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNT  417
            IY + S     +   ++LT  ++   +D  R+S L+++  L+   +   P+ SG +   +
Sbjct  77   IYPRSSLTKTQHKNYTYLT--LSRLARDSVRVSSLTTMLQLE---EIQTPVTSGVSE-GS  130

Query  418  GNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNTSSTFGSVECSV  588
            G Y  R   G P +  YM +DT SD  W+   PCS C   ++++F P+ SST+ S+ C  
Sbjct  131  GEYFARVGFGQPVKEFYMAIDTGSDITWLQCEPCSECYQQTDSIFNPSDSSTYTSLSCDS  190

Query  589  PECSMVNGMSCPTGGSGACNFNQSYG  666
            PECS ++   C +  +G C +  SYG
Sbjct  191  PECSALHVSECSS--TGTCLYQVSYG  214



>ref|NP_001063501.1| Os09g0482200 [Oryza sativa Japonica Group]
 dbj|BAD33407.1| putative nucleoid DNA-binding protein cnd41 [Oryza sativa Japonica 
Group]
 dbj|BAD33410.1| putative nucleoid DNA-binding protein cnd41 [Oryza sativa Japonica 
Group]
 dbj|BAF25415.1| Os09g0482200 [Oryza sativa Japonica Group]
 gb|EAZ45148.1| hypothetical protein OsJ_29786 [Oryza sativa Japonica Group]
Length=485

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 71/166 (43%), Gaps = 24/166 (14%)
 Frame = +1

Query  223  LSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP-----  387
            L V+H +G CSP            T   +  +D AR+  +      K  G    P     
Sbjct  71   LGVVHRHGPCSPVQARPRGGGGAVTHAEILERDQARVDSIHR----KVAGAGGAPSVVDP  126

Query  388  -IASGQNV---------LNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGCSET  537
              AS Q V         L TGNYV+   +GTP +   ++ DT SD +WV C  C  C E 
Sbjct  127  ARASEQGVSLPAQRGISLGTGNYVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPCADCYEQ  186

Query  538  ---VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
               +F P+ SST+ +V C  PEC  ++   C +     C +   YG
Sbjct  187  QDPLFDPSLSSTYAAVACGAPECQELDASGCSS--DSRCRYEVQYG  230



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = +1

Query  352  TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCV  522
            T  +P+  T  P+ SG +   +G Y  R  +GTP + MY+VLDT SD  W+   PCS C 
Sbjct  140  TRYQPEALT-TPVVSGVSQ-GSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCY  197

Query  523  GCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
              S+ VF P +SST+ S+ CS P+CS++   +C    S  C +  SYG
Sbjct  198  QQSDPVFNPTSSSTYKSLTCSAPQCSLLETSACR---SNKCLYQVSYG  242



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 7/97 (7%)
 Frame = +1

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNT  555
            P+ SG +   +G Y  R  +GTP + MY+VLDT SD  W+   PCS C   S+ VF P +
Sbjct  151  PVVSGASQ-GSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTS  209

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SST+ S+ CS P+CS++   +C    S  C +  SYG
Sbjct  210  SSTYKSLTCSAPQCSLLETSACR---SNKCLYQVSYG  243



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 7/97 (7%)
 Frame = +1

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNT  555
            P+ SG +   +G Y  R  +GTP + MY+VLDT SD  W+   PCS C   S+ VF P +
Sbjct  151  PVVSGASQ-GSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTS  209

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SST+ S+ CS P+CS++   +C    S  C +  SYG
Sbjct  210  SSTYKSLTCSAPQCSLLETSACR---SNKCLYQVSYG  243



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 7/97 (7%)
 Frame = +1

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNT  555
            P+ SG +   +G Y  R  +GTP + MY+VLDT SD  W+   PCS C   S+ VF P +
Sbjct  152  PVVSGASQ-GSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFNPTS  210

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SST+ S+ CS P+CS++   +C    S  C +  SYG
Sbjct  211  SSTYKSLTCSAPQCSLLETSACR---SNKCLYQVSYG  244



>gb|ACN85295.1| aspartic proteinase nepenthesin-1 precursor [Oryza coarctata]
Length=500

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 78/162 (48%), Gaps = 14/162 (9%)
 Frame = +1

Query  211  ANSELSVMHIYGKCSPFNNPNP-----TSSWLTTVMNMAVKDPARLSYLSSLTALKPK-G  372
            + + + ++H +G CSP  + +          L    N A     R+S  ++++  KPK  
Sbjct  85   SRTRMPIVHRHGPCSPLADAHDGKLPSHEEILAADQNRAKSIQRRVSTTTTVSRGKPKRN  144

Query  373  KTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCV----GCSETV  540
            + ++P +SG + L TGNYV+   +GTP     +V DT SD  WV C  CV       E +
Sbjct  145  RPSLPASSG-SALGTGNYVVTIGLGTPAGRYTVVFDTGSDTTWVQCEPCVVVCYKQQEKL  203

Query  541  FAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            F P  SST+ ++ C+ P CS +    C     G C +   YG
Sbjct  204  FDPARSSTYANISCAAPACSDLYIKGCS---GGHCLYGVQYG  242



>ref|XP_004150866.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004157102.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=473

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 71/144 (49%), Gaps = 19/144 (13%)
 Frame = +1

Query  214  NSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSY--------LSSLTALKPK  369
             S L V+H +G C    +  PT++       M VKD +R+ +        L S+  L+  
Sbjct  60   QSSLEVIHRHGPCGDEVSNAPTAA------EMLVKDQSRVDFIHSKIAGELESVDRLRGS  113

Query  370  GKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCV----GCSET  537
              T +P  SG  +  +GNY++   +GTP + + ++ DT SD  W  C  C        + 
Sbjct  114  KATKIPAKSGATI-GSGNYIVSVGLGTPKKYLSLIFDTGSDLTWTQCQPCARYCYNQKDP  172

Query  538  VFAPNTSSTFGSVECSVPECSMVN  609
            VF P+ S+T+ ++ CS P+CS + 
Sbjct  173  VFVPSQSTTYSNISCSSPDCSQLE  196



>ref|XP_008802841.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=470

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 70/134 (52%), Gaps = 14/134 (10%)
 Frame = +1

Query  292  TTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLN-----TGNYVIRARIGTPG  456
            +T+ +  ++D  R+S+L     L+  G    P   G +V++     +G Y +R  +G+P 
Sbjct  82   STLHDRLIRDSHRVSFL-----LRRLGAGYHPDDFGSDVVSGLDEGSGEYFVRIGVGSPP  136

Query  457  QVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVN-GMSCP  624
            +  +MV+D+ SD  WV   PC+ C   S+ VF P  S++F  + C  P C +   G S  
Sbjct  137  KEQFMVIDSGSDIVWVQCRPCTQCYAQSDPVFDPADSTSFAGISCKSPICDIARAGASAS  196

Query  625  TGGSGACNFNQSYG  666
             GG+G C +  SYG
Sbjct  197  CGGAGLCLYEVSYG  210



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 73/140 (52%), Gaps = 17/140 (12%)
 Frame = +1

Query  286  WLTTVMNMAVKDPARLSYLSSLTALKPKG----------KTNVPIASGQNVLNTGNYVIR  435
            + + V++   +D +R++ + +   L  +G          +   P+ SG +   +G Y  R
Sbjct  98   YKSLVLSRLERDSSRVASIIAKVKLAVEGADSETHYQPEELTTPVISGAS-QGSGEYFSR  156

Query  436  ARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNTSSTFGSVECSVPECSMV  606
              +GTP + MYMVLDT SD  W+   PCS C   S+ +F P++SST+ S+ CS P+C+ +
Sbjct  157  LGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYKSLTCSAPQCASL  216

Query  607  NGMSCPTGGSGACNFNQSYG  666
               +C    S  C +   YG
Sbjct  217  RASACR---SDKCLYQVRYG  233



>ref|XP_006660750.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Oryza 
brachyantha]
Length=483

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 85/171 (50%), Gaps = 20/171 (12%)
 Frame = +1

Query  196  CAPNKA---NSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTA---  357
            C  +KA   +S LSV+H +G CSP +     +     ++    +D AR++ +    A   
Sbjct  63   CTASKATSNSSALSVVHQHGPCSPLHARRGGAPSHVEILE---RDQARVNSIHRKVAAAG  119

Query  358  ---LKP-KGKTNVPIASGQNV-LNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCS  513
               + P +    V + + + + L TGNY++   +GTP +   +V DT SD +WV   PCS
Sbjct  120  ASVVDPARASKGVSLPAQRGISLGTGNYIVSVGLGTPAKQYSVVFDTGSDLSWVQCTPCS  179

Query  514  GCVGCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
             C   ++ +F P  SST+ +V C   EC  ++  +C    S  C +  +YG
Sbjct  180  DCYQQNDPLFDPAQSSTYAAVPCGAQECQELDSGTC---SSNKCRYEVAYG  227



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 7/97 (7%)
 Frame = +1

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNT  555
            P+ SG +   +G Y  R  +GTP + MY+VLDT SD  W+ C  C  C   S+ VF P +
Sbjct  150  PVVSGASQ-GSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCADCYQQSDPVFNPTS  208

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SST+ S+ CS P+CS++   +C    S  C +  SYG
Sbjct  209  SSTYKSLTCSAPQCSLLETSACR---SNKCLYQVSYG  242



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 7/97 (7%)
 Frame = +1

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNT  555
            P+ SG +   +G Y  R  +GTP + MY+VLDT SD  W+ C  C  C   S+ VF P +
Sbjct  150  PVVSGASQ-GSGEYFSRIGVGTPAKDMYLVLDTGSDVNWIQCEPCADCYQQSDPVFNPTS  208

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SST+ S+ CS P+CS++   +C    S  C +  SYG
Sbjct  209  SSTYKSLTCSAPQCSLLETSACR---SNKCLYQVSYG  242



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 61/108 (56%), Gaps = 8/108 (7%)
 Frame = +1

Query  352  TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCV  522
            T+ +P+  T  P+ SG +   +G Y  R  +GTP + M+MVLDT SD  W+   PCS C 
Sbjct  139  TSYQPEDLTT-PVVSGASQ-GSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCY  196

Query  523  GCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
              S+ VF P +SSTF S+ CS P+C  +   +C    S  C +  SYG
Sbjct  197  QQSDPVFDPASSSTFKSLSCSAPQCGSLEVSACR---SDKCLYQVSYG  241



>ref|XP_008668690.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Zea mays]
 tpg|DAA35354.1| TPA: hypothetical protein ZEAMMB73_186928 [Zea mays]
Length=464

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 69/131 (53%), Gaps = 11/131 (8%)
 Frame = +1

Query  298  VMNMAVKDPARLSYLSSL---TALKPKG--KTNVPIASGQNVLNTGNYVIRARIGTPGQV  462
            V+++  +D AR  YL+S     A +P G   +   + SG +   +G Y +R  IG+P   
Sbjct  81   VLDLVARDNARAEYLASRLSPAAYQPTGFSGSESKVVSGLDE-GSGEYFVRVGIGSPPTE  139

Query  463  MYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGG  633
             Y+V+D+ SD  WV C  C+ C   ++ +F P TS+TF +V C    C  +    C  G 
Sbjct  140  QYLVVDSGSDVIWVQCKPCLECYAQADPLFDPATSATFSAVPCGSAVCRTLRTSGC--GD  197

Query  634  SGACNFNQSYG  666
            SG C++  SYG
Sbjct  198  SGGCDYEVSYG  208



>ref|XP_010256102.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 77/160 (48%), Gaps = 13/160 (8%)
 Frame = +1

Query  196  CAPNKANSE----LSVMHIYGKCSPFNNPNPTSSW-LTTVMNMAVKDPARLSYLSSLTAL  360
            C+P+   S     L V+H  G CSP +    T S+ L+ ++    +    +    S   L
Sbjct  60   CSPSLKGSSRSRTLQVVHKNGPCSPLDLQKKTRSYNLSQILGQDEQRVRSIQSTISQQQL  119

Query  361  KPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGC-VGC---  528
                K  +P  SG++   TGNYV+    GTP + + +V DT SD  W+ C  C V C   
Sbjct  120  VEDSKAKIPAKSGRS-FGTGNYVVTVGFGTPKRDLSVVFDTGSDLTWIQCQPCVVSCYQQ  178

Query  529  SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACN  648
            +E +F P TSST+ ++ C   EC+    +   TG S +C 
Sbjct  179  TEPIFNPPTSSTYSNISCGSAECAQ---LKSATGNSPSCR  215



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 7/97 (7%)
 Frame = +1

Query  385  PIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNT  555
            P+ SG     +G Y  R  +GTP + M+MVLDT SD  W+   PCS C   S+ +F P +
Sbjct  149  PVVSGAGQ-GSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCYQQSDPIFDPTS  207

Query  556  SSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            SSTF S+ CS P+CS +   +C    S  C +  SYG
Sbjct  208  SSTFKSLTCSAPQCSSLEVSACR---SDKCLYQVSYG  241



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 74/141 (52%), Gaps = 19/141 (13%)
 Frame = +1

Query  286  WLTTVMNMAVKDPARLSYL-----------SSLTALKPKGKTNVPIASGQNVLNTGNYVI  432
            + + V++   +D +R++ +            S T  +P+  T  P+ SG +   +G Y  
Sbjct  98   YKSLVLSRLERDSSRVAAIIAKVNLAVEGADSETRYQPEELTT-PVISGAS-QGSGEYFS  155

Query  433  RARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNTSSTFGSVECSVPECSM  603
            R  +GTP + MYMVLDT SD  W+   PCS C   S+ +F P++SST+ S+ CS P+C+ 
Sbjct  156  RLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYKSLTCSAPQCAS  215

Query  604  VNGMSCPTGGSGACNFNQSYG  666
            +   +C    S  C +   YG
Sbjct  216  LRASACR---SDKCLYQVRYG  233



>ref|XP_010928895.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=464

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 75/156 (48%), Gaps = 18/156 (12%)
 Frame = +1

Query  223  LSVMHIYGKCSPFN-NPNPTSSWLTTVMNMAVKDPARLSYLSSLTA----LKPKGKTNVP  387
            L V+H +G CSP     NP          M  +D +R++ + + T     L+     ++P
Sbjct  64   LKVVHRHGPCSPLRLKQNPDHK------QMLDRDQSRVNAIHTRTTTNADLQANAANSIP  117

Query  388  IASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SETVFAPNTS  558
              +G + L TGNYV+    GTP +   ++ DT SD  W+ C  C  C    E VF P+ S
Sbjct  118  AHTGDS-LGTGNYVVTVGFGTPRRDQSVIFDTGSDVTWIQCRPCPSCYQQREPVFDPSHS  176

Query  559  STFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            ST+ ++ CS   CS ++  SC    S  C +   YG
Sbjct  177  STYANISCSSSYCSELDLSSCT---SSTCVYGVQYG  209



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 73/140 (52%), Gaps = 17/140 (12%)
 Frame = +1

Query  286  WLTTVMNMAVKDPARLSYLSSLTALKPKG----------KTNVPIASGQNVLNTGNYVIR  435
            + + V++   +D +R++ + +   L  +G          +   P+ SG +   +G Y  R
Sbjct  98   YKSLVLSRLERDSSRVASIIAKVNLAVEGADSETRYNPEELTTPVISGAS-QGSGEYFSR  156

Query  436  ARIGTPGQVMYMVLDTSSDNAWV---PCSGCVGCSETVFAPNTSSTFGSVECSVPECSMV  606
              +GTP + MYMVLDT SD  W+   PCS C   S+ +F P++SST+ S+ CS P+C+ +
Sbjct  157  LGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYKSLTCSAPQCASL  216

Query  607  NGMSCPTGGSGACNFNQSYG  666
               +C    S  C +   YG
Sbjct  217  RASACR---SDKCLYQVRYG  233



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 9/131 (7%)
 Frame = +1

Query  289  LTTVMNMAVK--DPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQV  462
            +TT +  AV+  D + L  + +   L        P+ SG +   +G Y  R  +GTP + 
Sbjct  117  ITTKIRFAVEGIDRSDLKPVYNDETLYQPEDLTTPVVSGASQ-GSGEYFSRIGVGTPAKE  175

Query  463  MYMVLDTSSDNAWV---PCSGCVGCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGG  633
            M+MVLDT SD  W+   PCS C   S+ VF P +SSTF S+ CS P+C  +   +C    
Sbjct  176  MFMVLDTGSDINWIQCQPCSDCYQQSDPVFDPASSSTFKSLSCSAPQCGSLEVSACR---  232

Query  634  SGACNFNQSYG  666
            S  C +  SYG
Sbjct  233  SDKCLYQVSYG  243



>gb|KJB55135.1| hypothetical protein B456_009G064900 [Gossypium raimondii]
Length=485

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 83/168 (49%), Gaps = 24/168 (14%)
 Frame = +1

Query  214  NSELSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKT-----  378
             S L V+H +G CS   + +  +  + T   + ++D AR+  + S  A K  G T     
Sbjct  69   KSSLQVVHKHGPCSQLYHHDKAN--IPTHAEILLQDVARVKSIHSKLA-KSLGSTKVDQT  125

Query  379  ---NVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC----SET  537
               N+P   G +V+ +GNYV+   +GTP + + ++ DT SD  W  C  CVG      + 
Sbjct  126  DAANIPAKDG-SVVGSGNYVVTVGLGTPKKDLTLIFDTGSDITWTQCQPCVGTCYKQQDP  184

Query  538  VFAPNTSSTFGSVECSVPECSMVNGMSCPTG-----GSGACNFNQSYG  666
            VFAP+ SST+ ++ CS   C   N ++  TG      S AC +   YG
Sbjct  185  VFAPSLSSTYSNISCSSTTC---NSLASATGNTPGCSSSACVYGIQYG  229



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (52%), Gaps = 8/129 (6%)
 Frame = +1

Query  289  LTTVMNMAVKDPARLSYLSSLTALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMY  468
            LT  +N+A+ +  R +   ++   + + +   P+ SG     +G Y  R  IG+P + +Y
Sbjct  104  LTARLNLAINNITRANLKHTMYTTEQE-EIEAPLISG-TTQGSGEYFTRVGIGSPAREVY  161

Query  469  MVLDTSSDNAWVPCSGCVGC---SETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSG  639
            MVLDT SD  W+ C+ C  C   +E +F P TSS++ ++ C  P+C  +    C    + 
Sbjct  162  MVLDTGSDVNWLQCAPCAECYHQTEPIFEPTTSSSYATLSCDAPQCKALEASECR---NA  218

Query  640  ACNFNQSYG  666
             C +  SYG
Sbjct  219  TCLYEVSYG  227



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = +1

Query  352  TALKPKGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWV---PCSGCV  522
            T  +P+  T  P+ SG +   +G Y  R  +GTP + MY+VLDT SD  W+   PCS C 
Sbjct  142  TRFQPEDLTT-PVVSGTSQ-GSGEYFSRIGVGTPAKEMYVVLDTGSDVNWIQCLPCSECY  199

Query  523  GCSETVFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
              S+ +F P +SSTF S+ CS P+C+ ++  +C    S  C +  SYG
Sbjct  200  QQSDPIFDPTSSSTFKSLTCSDPKCASLDVSACR---SNKCLYQVSYG  244



>ref|XP_009390625.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=450

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  223  LSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP--IAS  396
            L ++H +G CSPF++       L ++  + +KD  R++YL   +ALKP  K  V    AS
Sbjct  60   LPLVHRHGPCSPFDDKK-----LLSLEEILLKDQLRVNYLRR-SALKPSAKPQVDDSKAS  113

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSG---CVGCSETVFAPNTSSTF  567
                   G YVI    GTP Q   +++DT SD +W+ C     C    E +F P+ SS++
Sbjct  114  IPAEYGGGGYVITVGYGTPSQEQTVIMDTGSDLSWIKCKPRNVCYSQKEPIFDPSQSSSY  173

Query  568  GSVECSVPECSMVN  609
             ++ C+  +CS + 
Sbjct  174  AAIPCNSSDCSQLR  187



>ref|XP_009390626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=445

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  223  LSVMHIYGKCSPFNNPNPTSSWLTTVMNMAVKDPARLSYLSSLTALKPKGKTNVP--IAS  396
            L ++H +G CSPF++       L ++  + +KD  R++YL   +ALKP  K  V    AS
Sbjct  55   LPLVHRHGPCSPFDDKK-----LLSLEEILLKDQLRVNYLRR-SALKPSAKPQVDDSKAS  108

Query  397  GQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSG---CVGCSETVFAPNTSSTF  567
                   G YVI    GTP Q   +++DT SD +W+ C     C    E +F P+ SS++
Sbjct  109  IPAEYGGGGYVITVGYGTPSQEQTVIMDTGSDLSWIKCKPRNVCYSQKEPIFDPSQSSSY  168

Query  568  GSVECSVPECSMVN  609
             ++ C+  +CS + 
Sbjct  169  AAIPCNSSDCSQLR  182



>ref|XP_010928894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=459

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 17/163 (10%)
 Frame = +1

Query  199  APNKANSELSVMHIYGKCSPFN-NPNPTSSWLTTVMNMAVKDPARLSYLSSLTA---LKP  366
            +P  + + L V+H +G CSP +   +P    +        +D +R++ + + T    L+ 
Sbjct  52   SPRPSRASLKVVHRHGPCSPLHLKQSPDHKQILD------RDQSRVNAIHTRTTASTLQA  105

Query  367  KGKTNVPIASGQNVLNTGNYVIRARIGTPGQVMYMVLDTSSDNAWVPCSGCVGC---SET  537
                ++P  +G + L TGNYV+    GTP +   ++ DT SD  W+ C  C  C    E 
Sbjct  106  NAANSIPAHTGDS-LGTGNYVVTVGFGTPRRDQSVIFDTGSDVTWIQCRPCPSCYQQREP  164

Query  538  VFAPNTSSTFGSVECSVPECSMVNGMSCPTGGSGACNFNQSYG  666
            +F P+ SST+ ++ CS   CS ++  SC    S  C +   YG
Sbjct  165  LFDPSHSSTYANISCSSSYCSDLDLSSCT---SSTCVYGVQYG  204



Lambda      K        H        a         alpha
   0.316    0.128    0.405    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960