BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF037M24

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002271932.1|  PREDICTED: carboxyl-terminal-processing pept...    137   3e-37   Vitis vinifera
emb|CBI30818.3|  unnamed protein product                                137   3e-37   Vitis vinifera
ref|XP_011096495.1|  PREDICTED: carboxyl-terminal-processing pept...    132   4e-37   Sesamum indicum [beniseed]
ref|XP_011045311.1|  PREDICTED: carboxyl-terminal-processing pept...    136   2e-36   Populus euphratica
ref|XP_002316739.1|  peptidase S41 family protein                       136   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011045312.1|  PREDICTED: carboxyl-terminal-processing pept...    136   2e-36   Populus euphratica
gb|KDP21204.1|  hypothetical protein JCGZ_21675                         131   5e-36   Jatropha curcas
gb|AAL99045.1|AF487527_1  D1 protease-like protein precursor            133   6e-36   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|EYU28171.1|  hypothetical protein MIMGU_mgv1a008508mg                127   8e-36   Erythranthe guttata [common monkey flower]
ref|XP_009614039.1|  PREDICTED: carboxyl-terminal-processing pept...    132   1e-35   Nicotiana tomentosiformis
ref|XP_009614038.1|  PREDICTED: carboxyl-terminal-processing pept...    131   2e-35   Nicotiana tomentosiformis
ref|XP_009785931.1|  PREDICTED: carboxyl-terminal-processing pept...    131   2e-35   Nicotiana sylvestris
ref|XP_010666703.1|  PREDICTED: carboxyl-terminal-processing pept...    129   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009785926.1|  PREDICTED: carboxyl-terminal-processing pept...    130   3e-35   Nicotiana sylvestris
ref|XP_004295422.1|  PREDICTED: carboxyl-terminal-processing pept...    131   3e-35   Fragaria vesca subsp. vesca
ref|XP_006355597.1|  PREDICTED: C-terminal processing peptidase, ...    129   6e-35   Solanum tuberosum [potatoes]
ref|XP_010316905.1|  PREDICTED: carboxyl-terminal-processing pept...    129   6e-35   Solanum lycopersicum
ref|XP_010243687.1|  PREDICTED: carboxyl-terminal-processing pept...    127   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010243686.1|  PREDICTED: carboxyl-terminal-processing pept...    127   1e-34   Nelumbo nucifera [Indian lotus]
gb|KDO78061.1|  hypothetical protein CISIN_1g012084mg                   127   1e-34   Citrus sinensis [apfelsine]
ref|XP_006467532.1|  PREDICTED: C-terminal processing peptidase, ...    127   2e-34   Citrus sinensis [apfelsine]
ref|XP_006449623.1|  hypothetical protein CICLE_v10018134mg             127   2e-34   
gb|KDO78060.1|  hypothetical protein CISIN_1g012084mg                   127   2e-34   Citrus sinensis [apfelsine]
gb|KDO78062.1|  hypothetical protein CISIN_1g012084mg                   126   2e-34   Citrus sinensis [apfelsine]
gb|KCW73752.1|  hypothetical protein EUGRSUZ_E023601                    131   2e-34   Eucalyptus grandis [rose gum]
ref|XP_009406283.1|  PREDICTED: carboxyl-terminal-processing pept...    127   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002519743.1|  Carboxyl-terminal-processing protease precur...    125   3e-34   
ref|XP_010100991.1|  Carboxyl-terminal-processing protease              125   8e-34   
gb|KJB57309.1|  hypothetical protein B456_009G157600                    124   1e-33   Gossypium raimondii
gb|KHG18570.1|  Carboxyl-terminal-processing protease                   124   1e-33   Gossypium arboreum [tree cotton]
gb|KJB57306.1|  hypothetical protein B456_009G157600                    124   2e-33   Gossypium raimondii
gb|KEH20705.1|  carboxy-terminal processing peptidase-like protein      124   2e-33   Medicago truncatula
gb|AFK39374.1|  unknown                                                 124   2e-33   Medicago truncatula
ref|XP_003629901.1|  Carboxyl-terminal-processing protease              124   2e-33   Medicago truncatula
gb|KJB57308.1|  hypothetical protein B456_009G157600                    124   2e-33   Gossypium raimondii
ref|XP_003629902.1|  Carboxyl-terminal-processing protease              124   2e-33   
ref|XP_004504235.1|  PREDICTED: carboxyl-terminal-processing prot...    123   2e-33   Cicer arietinum [garbanzo]
gb|KEH20706.1|  carboxy-terminal processing peptidase-like protein      124   2e-33   Medicago truncatula
gb|AIA26575.1|  serine protease                                         123   2e-33   Cicer arietinum [garbanzo]
ref|XP_010056858.1|  PREDICTED: carboxyl-terminal-processing pept...    133   6e-33   
ref|XP_007213023.1|  hypothetical protein PRUPE_ppa023076mg             117   3e-32   Prunus persica
ref|XP_007025177.1|  Peptidase S41 family protein isoform 1             122   3e-32   
ref|XP_007025180.1|  Peptidase S41 family protein isoform 4             121   4e-32   
ref|XP_007025179.1|  Peptidase S41 family protein isoform 3             122   4e-32   
ref|XP_007025178.1|  Peptidase S41 family protein isoform 2             121   5e-32   
ref|XP_008225367.1|  PREDICTED: C-terminal processing peptidase, ...    116   6e-32   Prunus mume [ume]
ref|XP_006580200.1|  PREDICTED: C-terminal processing peptidase, ...    116   2e-31   
gb|KHN06461.1|  Carboxyl-terminal-processing protease                   116   2e-31   Glycine soja [wild soybean]
gb|EPS62840.1|  hypothetical protein M569_11946                         117   2e-31   Genlisea aurea
gb|ACU24465.1|  unknown                                                 116   2e-31   Glycine max [soybeans]
ref|XP_006580201.1|  PREDICTED: C-terminal processing peptidase, ...    116   2e-31   
gb|KJB57307.1|  hypothetical protein B456_009G157600                    123   2e-31   Gossypium raimondii
ref|XP_007159532.1|  hypothetical protein PHAVU_002G245300g             115   3e-31   Phaseolus vulgaris [French bean]
ref|XP_008443944.1|  PREDICTED: C-terminal processing peptidase, ...    112   3e-31   Cucumis melo [Oriental melon]
ref|XP_004147402.1|  PREDICTED: carboxyl-terminal-processing prot...    112   3e-31   Cucumis sativus [cucumbers]
ref|XP_008364177.1|  PREDICTED: C-terminal processing peptidase, ...    115   4e-31   
ref|XP_010538514.1|  PREDICTED: carboxyl-terminal-processing pept...    120   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010538513.1|  PREDICTED: carboxyl-terminal-processing pept...    120   2e-30   Tarenaya hassleriana [spider flower]
emb|CDP17322.1|  unnamed protein product                                110   4e-30   Coffea canephora [robusta coffee]
ref|XP_006646179.1|  PREDICTED: C-terminal processing peptidase, ...    111   9e-30   Oryza brachyantha
ref|XP_002456095.1|  hypothetical protein SORBIDRAFT_03g030380          105   9e-29   Sorghum bicolor [broomcorn]
ref|XP_006398333.1|  hypothetical protein EUTSA_v10001155mg             114   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_008656718.1|  PREDICTED: carboxyl-terminal-processing pept...    108   3e-28   
gb|ACG26821.1|  carboxyl-terminal-processing protease precursor         108   4e-28   Zea mays [maize]
ref|XP_004969441.1|  PREDICTED: C-terminal processing peptidase, ...    106   4e-28   Setaria italica
ref|XP_010926294.1|  PREDICTED: carboxyl-terminal-processing pept...    105   6e-28   Elaeis guineensis
ref|XP_010926256.1|  PREDICTED: carboxyl-terminal-processing pept...    105   6e-28   Elaeis guineensis
ref|XP_010926312.1|  PREDICTED: carboxyl-terminal-processing pept...    105   7e-28   
ref|XP_010926320.1|  PREDICTED: carboxyl-terminal-processing pept...    105   7e-28   
gb|AFW83480.1|  carboxyl-terminal-processing protease                   107   7e-28   
dbj|BAB11094.1|  carboxy-terminal proteinase D1-like protein            111   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31469.1|  hypothetical protein AALP_AA6G116300                    112   2e-27   Arabis alpina [alpine rockcress]
ref|NP_974893.1|  peptidase S41 family protein                          111   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199451.2|  peptidase S41 family protein                          111   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043789.2|  Os01g0664000                                       107   2e-27   
ref|XP_010494811.1|  PREDICTED: carboxyl-terminal-processing pept...    111   2e-27   Camelina sativa [gold-of-pleasure]
dbj|BAD72341.1|  carboxy-terminal proteinase-like                       107   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ12995.1|  hypothetical protein OsJ_02915                          107   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010494810.1|  PREDICTED: carboxyl-terminal-processing pept...    111   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010494809.1|  PREDICTED: carboxyl-terminal-processing pept...    111   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010441589.1|  PREDICTED: carboxyl-terminal-processing pept...    110   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010441586.1|  PREDICTED: carboxyl-terminal-processing pept...    110   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010441587.1|  PREDICTED: carboxyl-terminal-processing pept...    110   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006280370.1|  hypothetical protein CARUB_v10026297mg             110   4e-27   Capsella rubella
ref|XP_002865196.1|  peptidase S41 family protein                       109   6e-27   
emb|CDY35162.1|  BnaA09g17990D                                          109   9e-27   Brassica napus [oilseed rape]
ref|XP_008797514.1|  PREDICTED: carboxyl-terminal-processing pept...    104   2e-26   Phoenix dactylifera
gb|AAL99044.1|AF487526_1  D1 protease-like protein precursor            100   2e-26   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK05409.1|  predicted protein                                      101   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006837882.1|  hypothetical protein AMTR_s00100p00127450          100   4e-26   
ref|XP_009114355.1|  PREDICTED: carboxyl-terminal-processing pept...    106   4e-26   Brassica rapa
ref|XP_009114354.1|  PREDICTED: carboxyl-terminal-processing pept...    106   5e-26   Brassica rapa
ref|XP_009114356.1|  PREDICTED: carboxyl-terminal-processing pept...    106   5e-26   Brassica rapa
ref|XP_003569507.1|  PREDICTED: carboxyl-terminal-processing pept...    102   8e-26   Brachypodium distachyon [annual false brome]
emb|CDY03220.1|  BnaC09g19360D                                          105   1e-25   
ref|XP_010481459.1|  PREDICTED: carboxyl-terminal-processing pept...    105   1e-25   Camelina sativa [gold-of-pleasure]
gb|ABR16660.1|  unknown                                                 100   7e-24   Picea sitchensis
gb|ABR16649.1|  unknown                                                 100   7e-24   Picea sitchensis
gb|ACJ85416.1|  unknown                                               87.8    2e-22   Medicago truncatula
emb|CAA62434.1|  C-terminal peptidase of the D1 protein               79.7    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001775798.1|  predicted protein                                85.1    4e-16   
ref|XP_001760142.1|  predicted protein                                76.3    1e-14   
ref|XP_002994603.1|  hypothetical protein SELMODRAFT_432513           79.0    1e-13   
ref|XP_002968066.1|  hypothetical protein SELMODRAFT_33876            77.0    2e-13   
ref|WP_038544790.1|  peptidase S41                                    66.6    2e-09   Synechococcus sp. KORDI-100
ref|WP_011130154.1|  peptidase S41                                    66.2    2e-09   Prochlorococcus marinus
ref|WP_009543121.1|  MULTISPECIES: peptidase S41                      66.2    2e-09   Cyanothece
gb|ACB49432.1|  carboxyl-terminal protease                            66.2    2e-09   Cyanothece sp. ATCC 51142
ref|WP_012594914.1|  MULTISPECIES: peptidase S41                      64.3    8e-09   Cyanothece
ref|WP_011933379.1|  peptidase S41                                    64.3    8e-09   Synechococcus sp. WH 7803
ref|WP_008276666.1|  peptidase S41                                    64.3    9e-09   Cyanothece sp. CCY0110
ref|WP_018396182.1|  hypothetical protein                             63.9    1e-08   filamentous cyanobacterium ESFC-1
gb|EHJ10582.1|  carboxyl-terminal protease                            63.2    1e-08   Crocosphaera watsonii WH 0003
ref|WP_012598012.1|  peptidase S41                                    63.9    1e-08   Cyanothece sp. PCC 7424
gb|KGG30018.1|  Carboxyl-terminal protease                            63.9    1e-08   Prochlorococcus sp. MIT 0702
ref|WP_041619883.1|  peptidase S41                                    63.9    1e-08   
ref|WP_036915712.1|  MULTISPECIES: peptidase S41                      63.9    1e-08   Prochlorococcus
gb|AFZ35247.1|  carboxyl-terminal protease                            63.9    1e-08   Stanieria cyanosphaera PCC 7437
ref|WP_026079927.1|  peptidase S41                                    63.5    2e-08   
ref|WP_011826078.1|  peptidase S41                                    63.5    2e-08   
ref|WP_028952101.1|  peptidase S41                                    63.2    2e-08   Synechococcus sp. CC9616
ref|XP_009406285.1|  PREDICTED: carboxyl-terminal-processing pept...  62.8    3e-08   
ref|WP_021833211.1|  carboxyl-terminal protease                       62.8    3e-08   
ref|WP_006909374.1|  peptidase S41                                    62.8    3e-08   Cyanobium sp. PCC 7001
ref|WP_007308102.1|  peptidase S41                                    62.8    3e-08   Crocosphaera watsonii
ref|WP_021830269.1|  carboxyl-terminal protease                       62.8    3e-08   Crocosphaera watsonii
ref|WP_036486247.1|  peptidase S41                                    62.4    4e-08   Myxosarcina sp. GI1
ref|WP_019506254.1|  hypothetical protein                             62.4    4e-08   Pleurocapsa sp. PCC 7319
ref|WP_036483670.1|  peptidase S41                                    62.0    4e-08   Myxosarcina sp. GI1
ref|WP_010309391.1|  peptidase S41                                    62.0    5e-08   Synechococcus sp. CB0101
ref|XP_002506449.1|  predicted protein                                56.2    5e-08   Micromonas commoda
ref|WP_013321822.1|  peptidase S41                                    62.0    6e-08   Cyanothece sp. PCC 7822
ref|WP_015117245.1|  C-terminal processing peptidase-2                62.0    6e-08   Rivularia sp. PCC 7116
ref|XP_007511360.1|  predicted protein                                55.5    6e-08   Bathycoccus prasinos
gb|EAU73900.1|  carboxyl-terminal processing protease                 61.6    6e-08   Synechococcus sp. RS9916
ref|WP_038023249.1|  peptidase S41                                    61.6    7e-08   Synechococcus sp. RS9916
ref|WP_015194200.1|  carboxyl-terminal protease                       61.6    7e-08   Stanieria cyanosphaera
ref|WP_006041652.1|  peptidase S41                                    61.2    8e-08   Synechococcus sp. WH 7805
ref|WP_041487826.1|  peptidase S41                                    61.2    1e-07   
gb|ADB95188.1|  C-terminal processing peptidase-2                     61.2    1e-07   Candidatus Atelocyanobacterium thalassa isolate ALOHA
ref|WP_017294436.1|  hypothetical protein                             60.8    1e-07   Geminocystis herdmanii
ref|WP_006170377.1|  peptidase S41                                    60.8    1e-07   Synechococcus sp. WH 5701
ref|WP_038555034.1|  peptidase S41                                    60.8    1e-07   Synechococcus sp. KORDI-52
ref|WP_043705489.1|  peptidase S41                                    60.8    1e-07   
ref|WP_011935880.1|  peptidase S41                                    60.8    1e-07   Synechococcus sp. RCC307
emb|CCI26542.1|  Carboxyl-terminal-processing protease                60.8    1e-07   Microcystis aeruginosa PCC 9809
dbj|GAL93713.1|  carboxyl-terminal protease                           60.5    1e-07   Microcystis aeruginosa NIES-44
ref|WP_015206408.1|  C-terminal processing peptidase-2                60.5    2e-07   Cylindrospermum stagnale
ref|WP_044034600.1|  peptidase S41                                    60.5    2e-07   
ref|WP_010872128.1|  peptidase S41                                    60.5    2e-07   Synechocystis
ref|WP_017662089.1|  hypothetical protein                             60.5    2e-07   Geitlerinema sp. PCC 7105
ref|WP_015224006.1|  C-terminal processing peptidase-2                60.1    2e-07   
ref|WP_015108330.1|  C-terminal processing peptidase                  60.1    2e-07   Cyanobium gracile
ref|WP_011364272.1|  peptidase S41                                    60.1    2e-07   Synechococcus sp. CC9605
ref|WP_030006393.1|  peptidase S41                                    60.1    2e-07   Synechococcus sp. NKBG042902
ref|WP_029983998.1|  peptidase S41                                    57.4    3e-07   
emb|CCI36833.1|  Similar to Q4BW15_CROWT Peptidase S41A               59.7    3e-07   Microcystis aeruginosa PCC 9701
ref|WP_007100043.1|  peptidase S41                                    59.7    3e-07   Synechococcus sp. RS9917
ref|WP_015219152.1|  C-terminal processing peptidase-2                59.7    3e-07   Cyanobacterium aponinum
ref|WP_015956958.1|  peptidase S41                                    59.7    3e-07   Cyanothece sp. PCC 7424
ref|WP_006853028.1|  peptidase S41                                    59.7    3e-07   Synechococcus sp. WH 8016
emb|CCH97909.1|  Carboxyl-terminal-processing protease                59.7    3e-07   Microcystis aeruginosa PCC 9717
ref|WP_026086846.1|  carboxyl-terminal protease                       59.7    3e-07   Fischerella muscicola
ref|WP_038027478.1|  peptidase S41                                    59.7    3e-07   
ref|WP_043997972.1|  peptidase S41                                    59.7    3e-07   
ref|WP_011619593.1|  peptidase S41                                    59.7    3e-07   Synechococcus sp. CC9311
ref|WP_012267231.1|  peptidase S41                                    59.3    4e-07   
emb|CCI31838.1|  Carboxyl-terminal-processing protease                59.3    4e-07   Microcystis sp. T1-4
ref|WP_043999194.1|  peptidase S41                                    59.3    4e-07   
ref|WP_028948408.1|  peptidase S41                                    59.3    4e-07   Synechocystis sp. PCC 6714
emb|CCI13266.1|  Carboxyl-terminal-processing protease                59.3    4e-07   Microcystis aeruginosa PCC 9806
ref|WP_040930335.1|  peptidase S41                                    59.3    4e-07   
ref|WP_040943270.1|  peptidase S41                                    59.3    4e-07   
ref|WP_040939244.1|  peptidase S41                                    59.3    4e-07   
ref|WP_044000024.1|  peptidase S41                                    59.3    4e-07   
ref|WP_039899822.1|  peptidase S41                                    59.3    4e-07   
ref|WP_040054219.1|  peptidase S41                                    58.9    5e-07   
ref|WP_026722361.1|  carboxyl-terminal protease                       58.9    5e-07   Fischerella sp. PCC 9431
ref|WP_017310516.1|  peptidase S41                                    58.9    5e-07   Fischerella sp. PCC 9339
ref|WP_012307455.1|  peptidase S41                                    58.9    5e-07   Synechococcus
ref|WP_044449365.1|  carboxyl-terminal protease                       58.9    5e-07   Mastigocladus laminosus
ref|WP_028948323.1|  peptidase S41                                    58.9    6e-07   Synechocystis sp. PCC 6714
ref|WP_038652044.1|  peptidase S41                                    58.5    6e-07   Prochlorococcus sp. MIT 0801
emb|CCI02121.1|  Carboxyl-terminal-processing protease                58.5    7e-07   Microcystis aeruginosa PCC 9443
ref|WP_027842882.1|  carboxyl-terminal protease                       58.5    7e-07   Mastigocoleus testarum
ref|WP_015143772.1|  C-terminal processing peptidase                  58.5    7e-07   Pleurocapsa minor
ref|WP_025940222.1|  hypothetical protein                             56.6    7e-07   
emb|CCI17240.1|  Carboxyl-terminal-processing protease                58.5    7e-07   Microcystis aeruginosa PCC 9807
ref|WP_011128040.1|  peptidase S41                                    58.5    7e-07   Synechococcus sp. WH 8102
gb|KJB57305.1|  hypothetical protein B456_009G157600                  40.8    7e-07   Gossypium raimondii
ref|WP_043996280.1|  peptidase S41                                    58.5    8e-07   
gb|ABB26142.1|  C-terminal processing peptidase-2. Serine peptida...  58.5    8e-07   Synechococcus sp. CC9902
emb|CAO91281.1|  unnamed protein product                              58.5    8e-07   Microcystis aeruginosa PCC 7806
ref|WP_006511473.1|  C-terminal processing peptidase                  58.5    8e-07   Xenococcus sp. PCC 7305
ref|WP_043995750.1|  peptidase S41                                    58.5    8e-07   
ref|WP_010871361.1|  peptidase S41                                    58.5    8e-07   Synechocystis
ref|WP_015218840.1|  C-terminal processing peptidase-2                58.2    8e-07   Cyanobacterium aponinum
ref|WP_041425395.1|  peptidase S41                                    58.2    9e-07   
ref|WP_002748078.1|  C-terminal processing peptidase family protein   58.2    9e-07   
ref|WP_017295499.1|  hypothetical protein                             58.2    9e-07   Geminocystis herdmanii
gb|EAU71788.1|  Peptidase S41A                                        57.8    1e-06   Synechococcus sp. BL107
gb|AFZ44744.1|  C-terminal processing peptidase-2                     57.8    1e-06   Halothece sp. PCC 7418
ref|WP_015223281.1|  C-terminal processing peptidase-2                57.8    1e-06   
ref|WP_037988894.1|  peptidase S41                                    57.8    1e-06   
ref|WP_035829920.1|  peptidase S41                                    57.8    1e-06   
ref|WP_041596658.1|  peptidase S41                                    57.8    1e-06   
ref|WP_022604252.1|  C-terminal peptidase (prc)                       57.8    1e-06   Rubidibacter lacunae
ref|WP_029626349.1|  peptidase S41                                    57.8    1e-06   Synechococcus sp. CB0205
ref|WP_036892683.1|  peptidase S41                                    56.2    2e-06   
ref|WP_015230264.1|  C-terminal processing peptidase                  57.4    2e-06   Dactylococcopsis salina
ref|WP_029633475.1|  peptidase S41 [                                  57.4    2e-06   [Scytonema hofmanni] UTEX B 1581
ref|WP_036923215.1|  peptidase S41                                    57.4    2e-06   
ref|WP_015142506.1|  C-terminal processing peptidase                  57.4    2e-06   Pleurocapsa minor
gb|AHF63752.1|  carboxyl-terminal protease                            57.4    2e-06   Synechococcus sp. WH 8109
ref|WP_018396142.1|  peptidase S41                                    57.4    2e-06   filamentous cyanobacterium ESFC-1
ref|WP_024546109.1|  peptidase S41                                    57.4    2e-06   Synechococcus sp. NKBG15041c
ref|WP_025968593.1|  peptidase S41                                    57.0    2e-06   
ref|WP_025942289.1|  MULTISPECIES: peptidase S41                      57.0    2e-06   
ref|WP_023174000.1|  carboxyl-terminal protease                       57.0    2e-06   Gloeobacter kilaueensis
ref|WP_015957337.1|  peptidase S41                                    57.0    2e-06   Cyanothece sp. PCC 8801
ref|WP_044106509.1|  peptidase S41                                    57.0    2e-06   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_015170194.1|  C-terminal processing peptidase-2                57.0    3e-06   Geitlerinema sp. PCC 7407
ref|WP_015785232.1|  peptidase S41                                    57.0    3e-06   Cyanothece sp. PCC 8802
ref|WP_029984527.1|  peptidase S41                                    53.9    3e-06   
ref|WP_025970691.1|  hypothetical protein                             55.1    3e-06   
ref|WP_012165099.1|  peptidase S41                                    56.6    3e-06   Acaryochloris marina
ref|WP_035158073.1|  peptidase S41                                    56.6    3e-06   Calothrix sp. 336/3
ref|WP_040054262.1|  peptidase S41                                    56.6    3e-06   
ref|WP_036266255.1|  peptidase S41                                    56.6    3e-06   
ref|WP_039741239.1|  peptidase S41                                    56.6    3e-06   
ref|WP_009456991.1|  MULTISPECIES: peptidase S41                      56.6    3e-06   Fischerella thermalis
ref|WP_006528363.1|  C-terminal processing peptidase                  56.6    4e-06   Gloeocapsa sp. PCC 73106
gb|KGG11320.1|  Periplasmic protease                                  56.6    4e-06   Prochlorococcus marinus str. LG
ref|WP_022605369.1|  C-terminal peptidase (prc)                       56.2    4e-06   Rubidibacter lacunae
ref|XP_002185829.1|  predicted protein                                56.6    4e-06   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_025961023.1|  peptidase S41                                    56.2    4e-06   
ref|WP_025954042.1|  peptidase S41                                    56.2    4e-06   
ref|WP_025962894.1|  peptidase S41                                    56.2    4e-06   
emb|CCH95675.1|  Carboxyl-terminal-processing protease                56.2    4e-06   Microcystis aeruginosa PCC 9432
ref|WP_025900402.1|  MULTISPECIES: peptidase S41                      56.2    4e-06   
ref|WP_011124521.1|  peptidase S41                                    56.2    4e-06   Prochlorococcus
ref|WP_036896536.1|  MULTISPECIES: peptidase S41                      56.2    4e-06   
ref|WP_026101674.1|  carboxyl-terminal protease                       56.2    4e-06   cyanobacterium PCC 7702
ref|WP_025954528.1|  peptidase S41                                    56.2    4e-06   
ref|WP_025953685.1|  peptidase S41                                    56.2    4e-06   
ref|WP_040897737.1|  peptidase S41                                    56.2    4e-06   
ref|WP_025941535.1|  peptidase S41                                    56.2    4e-06   
ref|WP_007100535.1|  peptidase S41                                    56.2    4e-06   Synechococcus sp. RS9917
ref|WP_025964192.1|  peptidase S41                                    56.2    4e-06   
ref|WP_015186501.1|  C-terminal processing peptidase-2                56.2    4e-06   Gloeocapsa sp. PCC 7428
ref|WP_025942853.1|  MULTISPECIES: peptidase S41                      56.2    4e-06   
ref|WP_025888068.1|  MULTISPECIES: peptidase S41                      56.2    4e-06   
ref|WP_025940563.1|  peptidase S41                                    56.2    4e-06   
ref|WP_012408217.1|  peptidase S41                                    56.2    4e-06   Nostoc punctiforme
ref|WP_025960389.1|  peptidase S41                                    56.2    4e-06   
ref|WP_025934342.1|  peptidase S41                                    56.2    4e-06   
ref|WP_025890606.1|  MULTISPECIES: peptidase S41                      56.2    4e-06   
ref|WP_002735200.1|  C-terminal processing peptidase family protein   56.2    4e-06   
ref|WP_006276728.1|  peptidase S41                                    56.2    4e-06   Cylindrospermopsis raciborskii
ref|WP_043997463.1|  peptidase S41                                    56.2    5e-06   
gb|ELS02970.1|  C-terminal processing peptidase                       56.2    5e-06   Xenococcus sp. PCC 7305
ref|WP_011243130.1|  MULTISPECIES: peptidase S41                      56.2    5e-06   Synechococcus
ref|WP_025944576.1|  MULTISPECIES: peptidase S41                      56.2    5e-06   
ref|XP_005539248.1|  carboxyl-terminal processing protease            56.2    5e-06   Cyanidioschyzon merolae strain 10D
ref|WP_011140123.1|  peptidase S41                                    55.8    5e-06   Gloeobacter violaceus
ref|WP_016866280.1|  peptidase S41                                    55.8    5e-06   Fischerella muscicola
ref|WP_026723416.1|  peptidase S41                                    55.8    5e-06   Fischerella sp. PCC 9431
ref|WP_032518673.1|  peptidase S41                                    55.8    5e-06   Prochlorococcus marinus
ref|WP_030006029.1|  peptidase S41                                    55.8    5e-06   Synechococcus sp. NKBG042902
ref|WP_026098110.1|  peptidase S41                                    55.8    6e-06   Oscillatoria sp. PCC 10802
emb|CEF97765.1|  Interphotoreceptor retinol-binding                   48.5    6e-06   Ostreococcus tauri
ref|WP_012305850.1|  peptidase S41                                    55.8    6e-06   Synechococcus
gb|KIE11691.1|  peptidase S41                                         55.8    6e-06   Tolypothrix bouteillei VB521301
ref|WP_011432460.1|  peptidase S41                                    55.8    6e-06   Synechococcus sp. JA-2-3B'a(2-13)
gb|EPF21608.1|  Carboxy-terminal processing protease CtpB precursor   55.8    6e-06   Microcystis aeruginosa SPC777
ref|WP_025962337.1|  peptidase S41                                    55.8    6e-06   
ref|WP_010468839.1|  peptidase S41                                    55.8    6e-06   Acaryochloris sp. CCMEE 5410
ref|WP_010478250.1|  peptidase S41                                    55.8    6e-06   Acaryochloris sp. CCMEE 5410
ref|WP_012165213.1|  peptidase S41                                    55.8    7e-06   Acaryochloris marina
ref|WP_029952081.1|  peptidase S41                                    54.3    7e-06   
ref|WP_011143095.1|  peptidase S41                                    55.8    7e-06   
ref|WP_036396421.1|  peptidase S41                                    55.5    7e-06   
ref|WP_025926268.1|  peptidase S41                                    55.5    7e-06   
ref|WP_017309958.1|  peptidase S41                                    55.5    7e-06   
ref|WP_026097943.1|  peptidase S41                                    55.5    7e-06   
ref|WP_023174188.1|  carboxyl-terminal protease                       55.5    7e-06   
ref|WP_011823450.1|  peptidase S41                                    55.5    8e-06   
ref|XP_001417628.1|  D1 proceesing peptidase                          47.8    8e-06   
ref|WP_036907132.1|  peptidase S41                                    55.5    8e-06   
ref|WP_024545694.1|  peptidase S41                                    55.5    8e-06   
ref|WP_034416611.1|  peptidase S41                                    55.5    9e-06   
ref|WP_009458600.1|  MULTISPECIES: peptidase S41                      55.5    9e-06   
ref|WP_008206751.1|  peptidase S41                                    55.5    9e-06   
ref|WP_036004380.1|  peptidase S41                                    55.5    9e-06   
ref|WP_011431590.1|  peptidase S41                                    55.1    9e-06   
gb|AFY59517.1|  C-terminal processing peptidase                       55.1    9e-06   
ref|WP_041430975.1|  peptidase S41                                    55.1    9e-06   
ref|WP_036916814.1|  MULTISPECIES: peptidase S41                      55.1    9e-06   
ref|WP_011293644.1|  peptidase S41                                    55.1    9e-06   
ref|WP_012007493.1|  peptidase S41                                    55.1    9e-06   
ref|WP_012629870.1|  peptidase S41                                    55.1    1e-05   
gb|KGG16593.1|  Periplasmic protease                                  55.1    1e-05   
ref|WP_025952622.1|  peptidase S41                                    55.1    1e-05   
ref|WP_011818180.1|  peptidase S41                                    55.1    1e-05   
gb|KGG04602.1|  Carboxyl-terminal protease                            55.1    1e-05   
ref|WP_032516902.1|  peptidase S41                                    55.1    1e-05   
gb|ABB34258.1|  carboxyl-terminal protease                            55.1    1e-05   
gb|KHN48055.1|  hypothetical protein glysoja_015525                   41.6    1e-05   
gb|KIJ82862.1|  peptidase S41                                         55.1    1e-05   
ref|WP_041596227.1|  peptidase S41                                    55.1    1e-05   
ref|WP_011862718.1|  peptidase S41                                    55.1    1e-05   
gb|AFZ44124.1|  C-terminal processing peptidase-2                     55.1    1e-05   
ref|WP_008275307.1|  peptidase S41                                    55.1    1e-05   
ref|WP_006623120.1|  MULTISPECIES: peptidase S41                      55.1    1e-05   
ref|WP_025967491.1|  peptidase S41                                    55.1    1e-05   
ref|WP_009634373.1|  C-terminal processing peptidase                  55.1    1e-05   
ref|XP_005652247.1|  ClpP/crotonase                                   49.3    1e-05   
ref|WP_025933347.1|  peptidase S41                                    55.1    1e-05   
ref|WP_011934862.1|  peptidase S41                                    55.1    1e-05   
ref|WP_015127147.1|  C-terminal processing peptidase-2                55.1    1e-05   
ref|WP_011376233.1|  peptidase S41                                    55.1    1e-05   
ref|WP_008186509.1|  peptidase S41                                    55.1    1e-05   
ref|WP_032524234.1|  peptidase S41                                    55.1    1e-05   
ref|WP_015111444.1|  C-terminal processing peptidase-2                55.1    1e-05   
ref|WP_006633164.1|  peptidase S41                                    55.1    1e-05   
ref|WP_017651737.1|  peptidase S41                                    55.1    1e-05   
ref|WP_026731992.1|  peptidase S41                                    55.1    1e-05   
ref|WP_025965574.1|  peptidase S41                                    55.1    1e-05   
ref|WP_041434370.1|  peptidase S41                                    54.7    1e-05   
ref|WP_002801424.1|  peptidase S41                                    54.7    1e-05   
ref|WP_017747995.1|  peptidase S41                                    54.7    1e-05   
ref|WP_015180422.1|  C-terminal processing peptidase-2                54.7    1e-05   
dbj|GAL92498.1|  carboxyl-terminal protease                           54.7    1e-05   
ref|WP_002799171.1|  peptidase S41                                    54.7    1e-05   
ref|WP_015115192.1|  C-terminal processing peptidase-2                54.7    1e-05   
ref|WP_002756940.1|  peptidase S41                                    54.7    1e-05   
ref|WP_012265732.1|  peptidase S41                                    54.7    1e-05   
ref|WP_025930127.1|  peptidase S41                                    54.7    1e-05   
ref|WP_002781803.1|  Genome sequencing data, contig C327              54.7    1e-05   
ref|WP_002765211.1|  peptidase S41                                    54.7    1e-05   
ref|WP_025938164.1|  peptidase S41                                    54.3    1e-05   
ref|WP_002789308.1|  peptidase S41                                    54.7    1e-05   
ref|WP_019494195.1|  peptidase S41                                    54.7    1e-05   
ref|WP_024970531.1|  peptidase S41                                    54.7    1e-05   
ref|WP_002756223.1|  peptidase S41                                    54.7    1e-05   
ref|WP_002745181.1|  peptidase S41                                    54.7    1e-05   
ref|WP_004161873.1|  peptidase S41                                    54.7    1e-05   
ref|WP_002737617.1|  C-terminal processing peptidase family protein   54.7    1e-05   
ref|WP_025955499.1|  peptidase S41                                    54.7    2e-05   
gb|AII45330.1|  peptidase S41                                         54.7    2e-05   
ref|WP_025935776.1|  peptidase S41                                    54.3    2e-05   
ref|WP_016870380.1|  peptidase S41                                    54.7    2e-05   
ref|WP_035833451.1|  peptidase S41                                    54.3    2e-05   
ref|WP_025925190.1|  peptidase S41                                    54.3    2e-05   
ref|WP_015158221.1|  C-terminal processing peptidase                  54.3    2e-05   
ref|WP_023064801.1|  C-terminal processing peptidase family protein   54.3    2e-05   
ref|WP_015128065.1|  C-terminal processing peptidase-2                54.3    2e-05   
ref|WP_032522235.1|  peptidase S41                                    54.3    2e-05   
ref|WP_041244914.1|  peptidase S41                                    54.3    2e-05   
ref|WP_043691210.1|  peptidase S41                                    54.3    2e-05   
ref|WP_015174610.1|  carboxyl-terminal protease                       54.3    2e-05   
ref|WP_009544188.1|  MULTISPECIES: peptidase S41                      54.3    2e-05   
ref|WP_017653214.1|  peptidase S41                                    54.3    2e-05   
gb|AGY59622.1|  carboxyl-terminal protease                            54.3    2e-05   
ref|WP_019488905.1|  peptidase S41                                    54.3    2e-05   
gb|KEF40981.1|  peptidase S41                                         54.3    2e-05   
ref|WP_041040590.1|  peptidase S41                                    54.3    2e-05   
ref|WP_012953908.1|  peptidase S41                                    54.3    2e-05   
gb|EDX76615.1|  C-terminal processing peptidase subfamily             54.3    2e-05   
ref|WP_044206137.1|  peptidase S41                                    54.3    2e-05   
ref|WP_017322405.1|  peptidase S41                                    54.3    2e-05   
gb|ABX08291.1|  carboxyl-terminal protease                            54.3    2e-05   
ref|WP_041391383.1|  peptidase S41                                    54.3    2e-05   
ref|WP_013191802.1|  peptidase S41                                    53.9    2e-05   
ref|WP_016876627.1|  peptidase S41                                    53.9    2e-05   
ref|WP_042850153.1|  peptidase S41                                    53.9    2e-05   
ref|WP_034416368.1|  peptidase S41                                    53.9    2e-05   
ref|WP_025971988.1|  peptidase S41                                    53.9    2e-05   
ref|WP_025934984.1|  peptidase S41                                    53.9    2e-05   
ref|WP_025939016.1|  peptidase S41                                    53.9    2e-05   
ref|WP_025922288.1|  peptidase S41                                    53.9    2e-05   
ref|WP_025943320.1|  peptidase S41                                    53.9    2e-05   
ref|WP_025894308.1|  MULTISPECIES: peptidase S41                      53.9    2e-05   
ref|WP_025931670.1|  peptidase S41                                    53.9    3e-05   
ref|WP_039737517.1|  carboxyl-terminal protease                       53.9    3e-05   
ref|WP_006529164.1|  C-terminal processing peptidase                  53.9    3e-05   
gb|AHB89061.1|  carboxyl-terminal processing protease                 53.9    3e-05   
ref|WP_006173473.1|  peptidase S41                                    53.9    3e-05   
emb|CAE19136.1|  carboxyl-terminal processing protease                53.9    3e-05   
ref|WP_016864342.1|  peptidase S41                                    53.9    3e-05   
ref|WP_036930841.1|  peptidase S41                                    53.9    3e-05   
ref|WP_015155107.1|  C-terminal processing peptidase-2                53.9    3e-05   
ref|WP_017717799.1|  hypothetical protein                             53.9    3e-05   
gb|KGF85963.1|  Carboxyl-terminal protease                            53.9    3e-05   
ref|WP_041429204.1|  peptidase S41                                    53.5    3e-05   
ref|WP_015180992.1|  C-terminal processing peptidase-2                53.5    3e-05   
ref|WP_025975780.1|  MULTISPECIES: peptidase S41                      53.5    3e-05   
ref|WP_009459427.1|  MULTISPECIES: peptidase S41                      53.5    3e-05   
ref|WP_041660978.1|  peptidase S41                                    53.5    3e-05   
ref|WP_011613824.1|  peptidase S41                                    53.5    3e-05   
ref|WP_041425534.1|  peptidase S41                                    53.5    3e-05   
ref|WP_037988742.1|  peptidase S41                                    53.5    3e-05   
ref|WP_026082444.1|  carboxyl-terminal protease                       53.5    4e-05   
ref|WP_002805196.1|  peptidase S41                                    53.5    4e-05   
gb|EAW43605.1|  Peptidase S41A                                        53.5    4e-05   
gb|KGF98365.1|  Carboxyl-terminal protease                            53.5    4e-05   
ref|WP_016867033.1|  peptidase S41                                    53.5    4e-05   
gb|EAU70318.1|  Peptidase S41A                                        53.5    4e-05   
ref|WP_017804367.1|  peptidase S41                                    53.5    4e-05   
ref|XP_005847877.1|  hypothetical protein CHLNCDRAFT_145217           48.1    4e-05   
gb|ABB26807.1|  C-terminal processing peptidase-2. Serine peptida...  53.5    4e-05   
ref|WP_032525951.1|  peptidase S41                                    53.5    4e-05   
gb|ABW29436.1|  carboxyl--terminal protease                           53.1    4e-05   
ref|WP_015079592.1|  carboxyl-terminal protease                       53.1    4e-05   
ref|WP_026719977.1|  peptidase S41                                    53.1    4e-05   
ref|WP_039713340.1|  peptidase S41                                    53.1    4e-05   
ref|WP_016951152.1|  peptidase S41                                    53.1    4e-05   
ref|WP_016859803.1|  peptidase S41                                    53.1    5e-05   
ref|WP_010475616.1|  peptidase S41                                    53.1    5e-05   
ref|WP_015111350.1|  C-terminal processing peptidase-2                53.1    5e-05   
ref|WP_009342576.1|  peptidase S41                                    53.1    5e-05   
ref|WP_015152692.1|  C-terminal processing peptidase-2                53.1    5e-05   
ref|WP_039202802.1|  peptidase S41                                    53.1    5e-05   
ref|WP_039716144.1|  peptidase S41                                    53.1    5e-05   
ref|XP_005777290.1|  carboxyl-terminal processing protease            53.1    5e-05   
emb|CBN56657.1|  C-terminal processing peptidase-2 [ [                53.1    5e-05   
ref|WP_016951818.1|  peptidase S41                                    52.8    5e-05   
gb|KIJ82524.1|  peptidase S41                                         53.1    5e-05   
ref|WP_015149178.1|  C-terminal processing peptidase                  53.1    5e-05   
ref|WP_036903185.1|  peptidase S41                                    53.1    5e-05   
ref|WP_027404035.1|  peptidase S41                                    53.1    6e-05   
ref|WP_010997570.1|  peptidase S41                                    52.8    6e-05   
ref|WP_007099997.1|  peptidase S41                                    52.8    6e-05   
ref|WP_009557210.1|  C-terminal processing peptidase-2                52.8    6e-05   
ref|WP_011320161.1|  peptidase S41                                    52.8    6e-05   
ref|WP_044105651.1|  peptidase S41                                    52.8    6e-05   
ref|WP_019487571.1|  MULTISPECIES: peptidase S41                      52.8    6e-05   
ref|WP_029633390.1|  peptidase S41 [                                  52.8    6e-05   
ref|WP_015175882.1|  C-terminal processing peptidase-2                52.8    6e-05   
ref|WP_015222000.1|  C-terminal processing peptidase-2                52.8    6e-05   
ref|WP_036389304.1|  peptidase S41                                    52.8    7e-05   
ref|WP_041034080.1|  carboxyl-terminal protease                       52.8    7e-05   
ref|WP_006515294.1|  C-terminal processing peptidase                  52.8    7e-05   
ref|WP_010304811.1|  peptidase S41                                    52.8    7e-05   
ref|WP_009787475.1|  peptidase S41                                    52.8    7e-05   
gb|AFY80437.1|  C-terminal processing peptidase-2                     52.8    7e-05   
ref|WP_006619594.1|  peptidase S41                                    52.8    7e-05   
ref|WP_013322399.1|  peptidase S41                                    52.8    7e-05   
ref|WP_017316703.1|  peptidase S41                                    52.8    7e-05   
ref|WP_015229556.1|  C-terminal processing peptidase                  52.8    7e-05   
ref|WP_039727523.1|  MULTISPECIES: carboxyl-terminal protease         52.4    7e-05   
ref|WP_015129801.1|  C-terminal processing peptidase-2                52.4    7e-05   
ref|WP_044194415.1|  peptidase S41                                    52.4    7e-05   
ref|WP_026148389.1|  peptidase S41                                    52.4    8e-05   
ref|WP_028084403.1|  peptidase S41                                    52.4    8e-05   
ref|WP_019501119.1|  hypothetical protein                             52.4    8e-05   
gb|KGG13029.1|  Periplasmic protease                                  52.4    8e-05   
dbj|BAI88613.1|  carboxyl-terminal processing protease                52.4    8e-05   
ref|WP_015205151.1|  C-terminal processing peptidase-2                52.4    8e-05   
ref|WP_036901989.1|  peptidase S41                                    52.4    8e-05   
ref|WP_026731031.1|  carboxyl-terminal protease                       52.4    9e-05   
gb|KGG02536.1|  Carboxyl-terminal protease                            52.4    9e-05   
ref|WP_016877325.1|  peptidase S41                                    52.4    9e-05   
ref|WP_032513420.1|  peptidase S41                                    52.4    9e-05   
ref|WP_041035928.1|  peptidase S41                                    52.4    1e-04   
ref|WP_015214151.1|  C-terminal processing peptidase-2                52.4    1e-04   
ref|WP_017321025.1|  peptidase S41                                    52.4    1e-04   
gb|KGF92356.1|  Carboxyl-terminal protease                            52.4    1e-04   
ref|WP_027841880.1|  peptidase S41                                    52.4    1e-04   
ref|WP_017804205.1|  peptidase S41                                    52.0    1e-04   
ref|WP_032515316.1|  peptidase S41                                    52.0    1e-04   
ref|WP_015190966.1|  C-terminal processing peptidase-2                52.0    1e-04   
ref|WP_040935732.1|  peptidase S41                                    52.0    1e-04   
ref|WP_006195475.1|  carboxyl-terminal protease                       52.0    1e-04   
ref|WP_011611990.1|  peptidase S41                                    52.0    1e-04   
ref|WP_040931819.1|  peptidase S41                                    52.0    1e-04   
ref|WP_039725354.1|  MULTISPECIES: peptidase S41                      52.0    1e-04   
ref|WP_015168366.1|  C-terminal processing peptidase                  52.0    1e-04   
ref|WP_015123562.1|  C-terminal processing peptidase                  52.0    1e-04   
ref|XP_005763962.1|  hypothetical protein EMIHUDRAFT_214344           52.0    1e-04   
ref|WP_040943199.1|  peptidase S41                                    52.0    1e-04   
ref|WP_015209634.1|  C-terminal processing peptidase-2                52.0    1e-04   
ref|WP_006277346.1|  peptidase S41                                    52.0    1e-04   
ref|WP_011058158.1|  peptidase S41                                    52.0    1e-04   
ref|WP_015213696.1|  C-terminal processing peptidase-2                52.0    1e-04   
ref|WP_016872668.1|  peptidase S41                                    52.0    1e-04   
gb|ABM71959.1|  carboxyl-terminal processing protease                 52.0    1e-04   
ref|WP_017306804.1|  hypothetical protein                             52.0    1e-04   
ref|WP_028089377.1|  peptidase S41                                    52.0    1e-04   
ref|WP_041710703.1|  peptidase S41                                    52.0    1e-04   
ref|WP_009633511.1|  C-terminal processing peptidase                  52.0    1e-04   
ref|WP_039738608.1|  peptidase S41                                    52.0    1e-04   
ref|WP_036007749.1|  peptidase S41                                    51.6    1e-04   
ref|WP_029315437.1|  peptidase S41                                    51.6    1e-04   
ref|WP_015169836.1|  C-terminal processing peptidase                  51.6    1e-04   
ref|WP_017314451.1|  peptidase S41                                    51.6    1e-04   
ref|XP_005771480.1|  hypothetical protein EMIHUDRAFT_243334           51.6    1e-04   
ref|WP_012165731.1|  peptidase S41                                    51.6    1e-04   
ref|WP_012411348.1|  peptidase S41                                    51.6    2e-04   
ref|WP_012164941.1|  peptidase S41                                    51.6    2e-04   



>ref|XP_002271932.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Vitis vinifera]
 ref|XP_010655629.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Vitis vinifera]
Length=462

 Score =   137 bits (344),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+D+   +     PE+V+NE IV E W IVNDSFL++SRR WS +IW+ KKEDIL TSI
Sbjct  73   CRQDDDTEAMPETAPELVTNEAIVEEAWNIVNDSFLDSSRRRWSSDIWKQKKEDILGTSI  132

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AHDIIRRMLASLGDPYTRFLSPAE F  MA
Sbjct  133  QTRSKAHDIIRRMLASLGDPYTRFLSPAE-FSKMA  166


 Score = 45.4 bits (106),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGIN+REV  DN
Sbjct  161  EFSKMARYDMTGIGINIREVQDDN  184



>emb|CBI30818.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   137 bits (344),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+D+   +     PE+V+NE IV E W IVNDSFL++SRR WS +IW+ KKEDIL TSI
Sbjct  111  CRQDDDTEAMPETAPELVTNEAIVEEAWNIVNDSFLDSSRRRWSSDIWKQKKEDILGTSI  170

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AHDIIRRMLASLGDPYTRFLSPAE F  MA
Sbjct  171  QTRSKAHDIIRRMLASLGDPYTRFLSPAE-FSKMA  204


 Score = 45.4 bits (106),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGIN+REV  DN
Sbjct  199  EFSKMARYDMTGIGINIREVQDDN  222



>ref|XP_011096495.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Sesamum indicum]
Length=476

 Score =   132 bits (332),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 2/100 (2%)
 Frame = +1

Query  244  EQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDI  423
            +++L+CREDE   +   A  +VV+NE IV E WQIVNDSFL+T R+ WSP+ W  KK DI
Sbjct  83   QEELNCREDENYENDKVAA-DVVTNEEIVEEAWQIVNDSFLDTGRQRWSPDHWLKKKGDI  141

Query  424  LSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            L TSIQ+R RAH+IIRRMLASLGDPYTRFLSPAE F  MA
Sbjct  142  LGTSIQTRSRAHEIIRRMLASLGDPYTRFLSPAE-FSKMA  180


 Score = 49.7 bits (117),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLRE+P DN
Sbjct  175  EFSKMARYDMTGIGINLREIPDDN  198



>ref|XP_011045311.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Populus euphratica]
Length=468

 Score =   136 bits (342),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = +1

Query  223  ALVQTNEEQQLDCREDE--QELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPE  396
            +L+Q+   + L CRE+E  Q+       P+VV+NEGIV E W+IVNDSFL++ RR W+P+
Sbjct  66   SLLQSQSTEYL-CREEEIQQDFKVESEAPQVVTNEGIVEEAWEIVNDSFLDSGRRRWTPQ  124

Query  397  IWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
             W+ K+EDILS SIQSR +AHDIIRRMLASLGDPYTRFLSPAE F  M 
Sbjct  125  SWQQKREDILSGSIQSRAKAHDIIRRMLASLGDPYTRFLSPAE-FSKMG  172


 Score = 43.1 bits (100),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM RYD++GIGINLRE+P +N
Sbjct  167  EFSKMGRYDISGIGINLREIPDEN  190



>ref|XP_002316739.1| peptidase S41 family protein [Populus trichocarpa]
 gb|EEE97351.1| peptidase S41 family protein [Populus trichocarpa]
Length=468

 Score =   136 bits (343),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 3/97 (3%)
 Frame = +1

Query  259  CREDE--QELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            CRE+E  Q+       P+VV+NEGIV E W+IVNDSFL++ RR W+P+ W+ KKEDILS 
Sbjct  77   CREEETQQDFKVESEAPQVVTNEGIVEEAWEIVNDSFLDSGRRRWTPQSWQQKKEDILSG  136

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQSR +AHDIIRRMLASLGDPYTRFLSPAE F  M 
Sbjct  137  SIQSRAKAHDIIRRMLASLGDPYTRFLSPAE-FSKMG  172


 Score = 43.1 bits (100),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM RYD++GIGINLRE+P +N
Sbjct  167  EFSKMGRYDVSGIGINLREIPDEN  190



>ref|XP_011045312.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Populus euphratica]
Length=440

 Score =   136 bits (342),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = +1

Query  223  ALVQTNEEQQLDCREDE--QELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPE  396
            +L+Q+   + L CRE+E  Q+       P+VV+NEGIV E W+IVNDSFL++ RR W+P+
Sbjct  66   SLLQSQSTEYL-CREEEIQQDFKVESEAPQVVTNEGIVEEAWEIVNDSFLDSGRRRWTPQ  124

Query  397  IWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
             W+ K+EDILS SIQSR +AHDIIRRMLASLGDPYTRFLSPAE F  M 
Sbjct  125  SWQQKREDILSGSIQSRAKAHDIIRRMLASLGDPYTRFLSPAE-FSKMG  172


 Score = 43.5 bits (101),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM RYD++GIGINLRE+P +N
Sbjct  167  EFSKMGRYDISGIGINLREIPDEN  190



>gb|KDP21204.1| hypothetical protein JCGZ_21675 [Jatropha curcas]
Length=484

 Score =   131 bits (330),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  PEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            P+ V+NEGIV E WQIVNDSFL+T R  W+PE W+ K+EDILSTSIQSR +AHDII+RML
Sbjct  109  PQAVTNEGIVEEAWQIVNDSFLDTGRHRWTPESWQQKREDILSTSIQSRSKAHDIIKRML  168

Query  481  ASLGDPYTRFLSPAECFYSMA  543
            ASLGDPYTRFLSPAE F  MA
Sbjct  169  ASLGDPYTRFLSPAE-FSKMA  188


 Score = 46.6 bits (109),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREVP ++
Sbjct  183  EFSKMARYDMTGIGINLREVPDES  206



>gb|AAL99045.1|AF487527_1 D1 protease-like protein precursor [Nicotiana plumbaginifolia]
Length=467

 Score =   133 bits (334),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            L+C E+E E   +    +VVSNE IV E WQIVNDSFLNTS RSWSPE W  KK+DILS+
Sbjct  76   LNCPENEVEEVYSTEVSKVVSNEKIVEEAWQIVNDSFLNTSPRSWSPESWLKKKDDILSS  135

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AHDII+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  SIQTRSKAHDIIKRMLASLGDPYTRFLSPEE-FSKMA  171


 Score = 45.1 bits (105),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIG+NLR+VP  N
Sbjct  166  EFSKMARYDMTGIGVNLRDVPDGN  189



>gb|EYU28171.1| hypothetical protein MIMGU_mgv1a008508mg [Erythranthe guttata]
Length=371

 Score =   127 bits (320),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +1

Query  244  EQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDI  423
            +++L+CRE++  +  +   P VV+NE IV E WQIVND FL+  R  WS + W  KKED+
Sbjct  93   QEELNCREEDDYVDGSLTAP-VVTNEEIVGEAWQIVNDGFLDAGRHRWSSDSWLKKKEDV  151

Query  424  LSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            L  SIQSR RAHDIIRRMLASLGDPYTRFLSP E F  MA
Sbjct  152  LGASIQSRSRAHDIIRRMLASLGDPYTRFLSPTE-FSKMA  190


 Score = 49.7 bits (117),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLRE+P DN
Sbjct  185  EFSKMARYDMTGIGINLREIPDDN  208



>ref|XP_009614039.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=407

 Score =   132 bits (331),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            L+C E+E E   +    +VVSNE IV E WQIVNDSFLNTS RSWSPE W  KK+DILS+
Sbjct  76   LNCPENEVEEVYSTEVSKVVSNERIVEEAWQIVNDSFLNTSPRSWSPESWLKKKDDILSS  135

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            S+Q+R +AHDII+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  SVQTRSKAHDIIKRMLASLGDPYTRFLSPEE-FSKMA  171


 Score = 45.1 bits (105),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIG+NLR+VP  N
Sbjct  166  EFSKMARYDMTGIGVNLRDVPDGN  189



>ref|XP_009614038.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=467

 Score =   131 bits (330),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            L+C E+E E   +    +VVSNE IV E WQIVNDSFLNTS RSWSPE W  KK+DILS+
Sbjct  76   LNCPENEVEEVYSTEVSKVVSNERIVEEAWQIVNDSFLNTSPRSWSPESWLKKKDDILSS  135

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            S+Q+R +AHDII+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  SVQTRSKAHDIIKRMLASLGDPYTRFLSPEE-FSKMA  171


 Score = 45.1 bits (105),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIG+NLR+VP  N
Sbjct  166  EFSKMARYDMTGIGVNLRDVPDGN  189



>ref|XP_009785931.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=410

 Score =   131 bits (329),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            ++C E+E E        +VVSNE IV E WQIVNDSFLNTS RSWSPE W  KK+DILS+
Sbjct  76   VNCPENEVEEVYTTEVSKVVSNERIVEEAWQIVNDSFLNTSPRSWSPESWLKKKDDILSS  135

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AHDII+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  SIQTRSKAHDIIKRMLASLGDPYTRFLSPEE-FSKMA  171


 Score = 45.1 bits (105),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIG+NLR+VP  N
Sbjct  166  EFSKMARYDMTGIGVNLRDVPDGN  189



>ref|XP_010666703.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=478

 Score =   129 bits (325),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +1

Query  256  DCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS  435
            DCREDE       + P +V+NEGIV E W+IVNDSFL T R  WSPE W  KKEDILS+S
Sbjct  89   DCREDELVAQLGLSAPNMVTNEGIVEEAWEIVNDSFLYTGRDRWSPESWLHKKEDILSSS  148

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            I++R +AH+I+++MLASLGDPYTRFLSP E F  MA
Sbjct  149  IKTRSKAHNIVQKMLASLGDPYTRFLSPEE-FSKMA  183


 Score = 46.6 bits (109),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLRE+P  N
Sbjct  178  EFSKMARYDMTGIGINLREMPDSN  201



>ref|XP_009785926.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   130 bits (328),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            ++C E+E E        +VVSNE IV E WQIVNDSFLNTS RSWSPE W  KK+DILS+
Sbjct  76   VNCPENEVEEVYTTEVSKVVSNERIVEEAWQIVNDSFLNTSPRSWSPESWLKKKDDILSS  135

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AHDII+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  SIQTRSKAHDIIKRMLASLGDPYTRFLSPEE-FSKMA  171


 Score = 45.1 bits (105),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIG+NLR+VP  N
Sbjct  166  EFSKMARYDMTGIGVNLRDVPDGN  189



>ref|XP_004295422.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=468

 Score =   131 bits (329),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = +1

Query  259  CREDEQELSAAPAEPE-VVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS  435
            CREDE ++ A P  PE V +NEGIV E W+IVNDSFL+T  RSW PE W+ KKEDI ++S
Sbjct  78   CREDEGDVIAEPGAPEPVATNEGIVEEAWEIVNDSFLDTGGRSWLPENWKMKKEDIRTSS  137

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            I++R +AH++I+RMLASLGDPYTRFLSP E F  MA
Sbjct  138  IKTRSKAHNMIKRMLASLGDPYTRFLSPDE-FSKMA  172


 Score = 44.3 bits (103),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREV  DN
Sbjct  167  EFSKMARYDMSGIGINLREVLDDN  190



>ref|XP_006355597.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Solanum tuberosum]
Length=474

 Score =   129 bits (324),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = +1

Query  259  CREDE-QELSAAPAE-PEVVSNEGIVAEVWQIVNDSFLNTS-RRSWSPEIWRSKKEDILS  429
            CRE+E  E+     E  +VVSNE IV E WQIVNDSFLNTS RRSWSPE W  KK+DILS
Sbjct  82   CRENEADEVYVKDTEVSKVVSNESIVEEAWQIVNDSFLNTSDRRSWSPESWLQKKDDILS  141

Query  430  TSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            +SIQ+R +AHDII+RMLASLGDPYTRFLSP E F  MA
Sbjct  142  SSIQTRSKAHDIIKRMLASLGDPYTRFLSP-EQFSKMA  178


 Score = 45.4 bits (106),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIG+NLR+VP  N
Sbjct  173  QFSKMARYDMTGIGVNLRDVPDGN  196



>ref|XP_010316905.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=474

 Score =   129 bits (324),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 4/98 (4%)
 Frame = +1

Query  259  CREDE-QELSAAPAE-PEVVSNEGIVAEVWQIVNDSFLNTS-RRSWSPEIWRSKKEDILS  429
            CRE+E +E+     E  +VVSNE IV E WQIVNDSFLNTS RRSWSPE W  KK+DILS
Sbjct  82   CRENEGEEVYEKDTEVSKVVSNENIVEEAWQIVNDSFLNTSDRRSWSPESWLQKKDDILS  141

Query  430  TSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            +SIQ+R +AHDII+RMLASLGDPYTRFLSP E F  MA
Sbjct  142  SSIQTRSKAHDIIKRMLASLGDPYTRFLSP-EQFSKMA  178


 Score = 45.4 bits (106),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIG+NLR+VP  N
Sbjct  173  QFSKMARYDMTGIGVNLRDVPDGN  196



>ref|XP_010243687.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=476

 Score =   127 bits (320),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  PEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            PE V+NE IV E W+IVNDS+LNT RR WSP+IW  KK DI+ +SIQ+R +AHDIIRRML
Sbjct  109  PEFVTNEAIVEEAWEIVNDSYLNTGRRQWSPDIWMQKKTDIVGSSIQTRSKAHDIIRRML  168

Query  481  ASLGDPYTRFLSPAECFYSMA  543
            ASLGDPYTRFLSP+E F  MA
Sbjct  169  ASLGDPYTRFLSPSE-FSKMA  188


 Score = 46.6 bits (109),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMA+YD+TGIG+NLREVP DN
Sbjct  183  EFSKMAKYDVTGIGVNLREVPDDN  206



>ref|XP_010243686.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=484

 Score =   127 bits (318),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  PEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            PE V+NE IV E W+IVNDS+LNT RR WSP+IW  KK DI+ +SIQ+R +AHDIIRRML
Sbjct  109  PEFVTNEAIVEEAWEIVNDSYLNTGRRQWSPDIWMQKKTDIVGSSIQTRSKAHDIIRRML  168

Query  481  ASLGDPYTRFLSPAECFYSMA  543
            ASLGDPYTRFLSP+E F  MA
Sbjct  169  ASLGDPYTRFLSPSE-FSKMA  188


 Score = 46.2 bits (108),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMA+YD+TGIG+NLREVP DN
Sbjct  183  EFSKMAKYDVTGIGVNLREVPDDN  206



>gb|KDO78061.1| hypothetical protein CISIN_1g012084mg [Citrus sinensis]
Length=454

 Score =   127 bits (319),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            L C E E    + P +    +NEGIV E WQIVNDSFL+T R  W+P+ W+ K+EDILS+
Sbjct  80   LTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS  139

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AH II+RMLASLGDPYTRFLSPAE F  MA
Sbjct  140  SIQTRSKAHGIIKRMLASLGDPYTRFLSPAE-FSKMA  175


 Score = 46.2 bits (108),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP  N
Sbjct  170  EFSKMARYDMSGIGINLREVPDAN  193



>ref|XP_006467532.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Citrus sinensis]
Length=473

 Score =   127 bits (319),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            L C E E    + P +    +NEGIV E WQIVNDSFL+T R  W+P+ W+ K+EDILS+
Sbjct  82   LTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS  141

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AH II+RMLASLGDPYTRFLSPAE F  MA
Sbjct  142  SIQTRSKAHGIIKRMLASLGDPYTRFLSPAE-FSKMA  177


 Score = 46.2 bits (108),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP  N
Sbjct  172  EFSKMARYDMSGIGINLREVPDAN  195



>ref|XP_006449623.1| hypothetical protein CICLE_v10018134mg [Citrus clementina]
 gb|ESR62863.1| hypothetical protein CICLE_v10018134mg [Citrus clementina]
Length=498

 Score =   127 bits (319),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            L C E E    + P +    +NEGIV E WQIVNDSFL+T R  W+P+ W+ K+EDILS+
Sbjct  82   LTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS  141

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AH II+RMLASLGDPYTRFLSPAE F  MA
Sbjct  142  SIQTRSKAHGIIKRMLASLGDPYTRFLSPAE-FSKMA  177


 Score = 46.2 bits (108),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP  N
Sbjct  172  EFSKMARYDMSGIGINLREVPDAN  195



>gb|KDO78060.1| hypothetical protein CISIN_1g012084mg [Citrus sinensis]
Length=471

 Score =   127 bits (319),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            L C E E    + P +    +NEGIV E WQIVNDSFL+T R  W+P+ W+ K+EDILS+
Sbjct  80   LTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS  139

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AH II+RMLASLGDPYTRFLSPAE F  MA
Sbjct  140  SIQTRSKAHGIIKRMLASLGDPYTRFLSPAE-FSKMA  175


 Score = 46.2 bits (108),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP  N
Sbjct  170  EFSKMARYDMSGIGINLREVPDAN  193



>gb|KDO78062.1| hypothetical protein CISIN_1g012084mg [Citrus sinensis]
Length=393

 Score =   126 bits (317),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +1

Query  253  LDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            L C E E    + P +    +NEGIV E WQIVNDSFL+T R  W+P+ W+ K+EDILS+
Sbjct  80   LTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS  139

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AH II+RMLASLGDPYTRFLSPAE F  MA
Sbjct  140  SIQTRSKAHGIIKRMLASLGDPYTRFLSPAE-FSKMA  175


 Score = 46.2 bits (108),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP  N
Sbjct  170  EFSKMARYDMSGIGINLREVPDAN  193



>gb|KCW73752.1| hypothetical protein EUGRSUZ_E023601, partial [Eucalyptus grandis]
 gb|KCW73753.1| hypothetical protein EUGRSUZ_E023601, partial [Eucalyptus grandis]
 gb|KCW73754.1| hypothetical protein EUGRSUZ_E023601, partial [Eucalyptus grandis]
Length=173

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CRE+E E  AA A PE V+NEGIV E W IVN+SFL T RRSWSPE W+ KKEDILSTSI
Sbjct  86   CREEEGEDGAA-AVPERVTNEGIVEEAWSIVNESFLGTGRRSWSPEAWQRKKEDILSTSI  144

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
             +R +AH++IRRMLA LGDPYTRFLSP E
Sbjct  145  PTRSKAHELIRRMLAGLGDPYTRFLSPDE  173



>ref|XP_009406283.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009406284.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   127 bits (320),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTS  435
            CRED+ E+++    PE ++NEG+V E W++VN+SFL +   RSWSPE W  KK+DIL + 
Sbjct  102  CREDDGEMASTDVLPESITNEGLVEEAWEVVNESFLPDAGGRSWSPEKWMQKKQDILDSK  161

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            IQ+R RAHD+I++MLASLGDPYTRFLSPAE F  MA
Sbjct  162  IQTRSRAHDVIKKMLASLGDPYTRFLSPAE-FSKMA  196


 Score = 45.1 bits (105),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGD  635
            +FSKMA+YD+TGIGINLREVP D
Sbjct  191  EFSKMAKYDVTGIGINLREVPDD  213



>ref|XP_002519743.1| Carboxyl-terminal-processing protease precursor, putative [Ricinus 
communis]
 gb|EEF42716.1| Carboxyl-terminal-processing protease precursor, putative [Ricinus 
communis]
Length=491

 Score =   125 bits (314),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = +1

Query  310  VSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASL  489
            V+NEGIV E WQIVNDSFL+  R  W+P+ W+ KKEDILSTSIQSR +AHD+I+RMLASL
Sbjct  103  VTNEGIVEEAWQIVNDSFLDAGRHRWTPQSWQQKKEDILSTSIQSRSKAHDLIKRMLASL  162

Query  490  GDPYTRFLSPAECFYSMA  543
            GDPYTRFLSPAE F  MA
Sbjct  163  GDPYTRFLSPAE-FSKMA  179


 Score = 47.4 bits (111),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP +N
Sbjct  174  EFSKMARYDMSGIGINLREVPEEN  197



>ref|XP_010100991.1| Carboxyl-terminal-processing protease [Morus notabilis]
 gb|EXB86582.1| Carboxyl-terminal-processing protease [Morus notabilis]
Length=501

 Score =   125 bits (314),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CRE + E  A        +NEG+V E W+IVNDSFL+  RR WSPE W+ KKEDI STSI
Sbjct  66   CREQDSEDRAETGSDSGFTNEGVVEEAWEIVNDSFLDAGRRRWSPETWQRKKEDIRSTSI  125

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESS  573
            Q+R +AH+II+RMLASLGDPYTRFLSP +   S  +   I  ESS
Sbjct  126  QTRSKAHEIIKRMLASLGDPYTRFLSPEQGTVSNKHRPPIEDESS  170


 Score = 45.8 bits (107),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  555  HHL*KFSKMARYDMTGIGINLREVPGDN  638
            H L  FSKMARYD++GIGIN+REVP +N
Sbjct  177  HLLLVFSKMARYDLSGIGINIREVPDEN  204



>gb|KJB57309.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=393

 Score =   124 bits (312),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  KKEDIL TSIQ+R +AH++I+RM
Sbjct  97   KPEFVTNEEIVQEAWQIVNDSFLDTGRHRWSPQSWEQKKEDILGTSIQTRSKAHELIKRM  156

Query  478  LASLGDPYTRFLSPAECFYSMA  543
            LASLGDPYTRFLSPAE F  MA
Sbjct  157  LASLGDPYTRFLSPAE-FSKMA  177


 Score = 45.8 bits (107),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYD+TGIGIN+REVP D 
Sbjct  172  EFSKMARYDITGIGINIREVPDDT  195



>gb|KHG18570.1| Carboxyl-terminal-processing protease [Gossypium arboreum]
Length=514

 Score =   124 bits (312),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  KKEDIL TSIQ+R +AH++I+RM
Sbjct  97   KPEFVTNEEIVQEAWQIVNDSFLDTGRHRWSPQSWEQKKEDILGTSIQTRSKAHELIKRM  156

Query  478  LASLGDPYTRFLSPAECFYSMA  543
            LASLGDPYTRFLSPAE F  MA
Sbjct  157  LASLGDPYTRFLSPAE-FSKMA  177


 Score = 45.4 bits (106),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGD  635
            +FSKMARYD+TGIGIN+REVP D
Sbjct  172  EFSKMARYDITGIGINIREVPDD  194



>gb|KJB57306.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=445

 Score =   124 bits (311),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  KKEDIL TSIQ+R +AH++I+RM
Sbjct  97   KPEFVTNEEIVQEAWQIVNDSFLDTGRHRWSPQSWEQKKEDILGTSIQTRSKAHELIKRM  156

Query  478  LASLGDPYTRFLSPAECFYSMA  543
            LASLGDPYTRFLSPAE F  MA
Sbjct  157  LASLGDPYTRFLSPAE-FSKMA  177


 Score = 45.4 bits (106),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYD+TGIGIN+REVP D 
Sbjct  172  EFSKMARYDITGIGINIREVPDDT  195



>gb|KEH20705.1| carboxy-terminal processing peptidase-like protein [Medicago 
truncatula]
Length=305

 Score =   124 bits (311),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E      P  PEVV+NEG+V E WQIV+D FL+T R  WS + W+ KK DILS +I
Sbjct  76   CRDVELRNITVPTAPEVVTNEGLVQEAWQIVDDDFLDTGRNRWSQDTWQLKKNDILSNTI  135

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH+II+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  QTRSKAHNIIKRMLASLGDPYTRFLSPEE-FSKMA  169


 Score = 45.8 bits (107),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREV  +N
Sbjct  164  EFSKMARYDMTGIGINLREVTDEN  187



>gb|AFK39374.1| unknown [Medicago truncatula]
Length=465

 Score =   124 bits (312),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E      P  PEVV+NEG+V E WQIV+D FL+T R  WS + W+ KK DILS +I
Sbjct  76   CRDVELRNITVPTAPEVVTNEGLVQEAWQIVDDDFLDTGRNRWSQDTWQLKKNDILSNTI  135

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH+II+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  QTRSKAHNIIKRMLASLGDPYTRFLSPEE-FSKMA  169


 Score = 45.4 bits (106),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREV  +N
Sbjct  164  EFSKMARYDMTGIGINLREVTDEN  187



>ref|XP_003629901.1| Carboxyl-terminal-processing protease [Medicago truncatula]
 gb|AET04377.1| carboxy-terminal processing peptidase-like protein [Medicago 
truncatula]
Length=465

 Score =   124 bits (312),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E      P  PEVV+NEG+V E WQIV+D FL+T R  WS + W+ KK DILS +I
Sbjct  76   CRDVELRNITVPTAPEVVTNEGLVQEAWQIVDDDFLDTGRNRWSQDTWQLKKNDILSNTI  135

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH+II+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  QTRSKAHNIIKRMLASLGDPYTRFLSPEE-FSKMA  169


 Score = 45.4 bits (106),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREV  +N
Sbjct  164  EFSKMARYDMTGIGINLREVTDEN  187



>gb|KJB57308.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
 gb|KJB57310.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=473

 Score =   124 bits (311),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  KKEDIL TSIQ+R +AH++I+RM
Sbjct  97   KPEFVTNEEIVQEAWQIVNDSFLDTGRHRWSPQSWEQKKEDILGTSIQTRSKAHELIKRM  156

Query  478  LASLGDPYTRFLSPAECFYSMA  543
            LASLGDPYTRFLSPAE F  MA
Sbjct  157  LASLGDPYTRFLSPAE-FSKMA  177


 Score = 45.4 bits (106),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYD+TGIGIN+REVP D 
Sbjct  172  EFSKMARYDITGIGINIREVPDDT  195



>ref|XP_003629902.1| Carboxyl-terminal-processing protease [Medicago truncatula]
 gb|AET04378.1| carboxy-terminal processing peptidase-like protein [Medicago 
truncatula]
Length=356

 Score =   124 bits (312),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E      P  PEVV+NEG+V E WQIV+D FL+T R  WS + W+ KK DILS +I
Sbjct  76   CRDVELRNITVPTAPEVVTNEGLVQEAWQIVDDDFLDTGRNRWSQDTWQLKKNDILSNTI  135

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH+II+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  QTRSKAHNIIKRMLASLGDPYTRFLSPEE-FSKMA  169


 Score = 45.4 bits (106),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREV  +N
Sbjct  164  EFSKMARYDMTGIGINLREVTDEN  187



>ref|XP_004504235.1| PREDICTED: carboxyl-terminal-processing protease-like isoform 
X1 [Cicer arietinum]
Length=461

 Score =   123 bits (308),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +1

Query  259  CRE-DEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS  435
            CR+ D  +++     PEVV+NEG+V E WQIVND FL+T R  WS + W+ KK+D+LS S
Sbjct  71   CRDADSSDVTVPTNAPEVVTNEGLVQEAWQIVNDDFLDTGRHRWSHDTWQLKKQDLLSNS  130

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            IQ+R +AH+II+RMLASLGDPYTR+LSP E F  MA
Sbjct  131  IQTRSKAHNIIKRMLASLGDPYTRYLSPEE-FSKMA  165


 Score = 46.2 bits (108),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREV  DN
Sbjct  160  EFSKMARYDMTGIGINLREVNDDN  183



>gb|KEH20706.1| carboxy-terminal processing peptidase-like protein [Medicago 
truncatula]
Length=331

 Score =   124 bits (311),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E      P  PEVV+NEG+V E WQIV+D FL+T R  WS + W+ KK DILS +I
Sbjct  76   CRDVELRNITVPTAPEVVTNEGLVQEAWQIVDDDFLDTGRNRWSQDTWQLKKNDILSNTI  135

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH+II+RMLASLGDPYTRFLSP E F  MA
Sbjct  136  QTRSKAHNIIKRMLASLGDPYTRFLSPEE-FSKMA  169


 Score = 45.4 bits (106),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREV  +N
Sbjct  164  EFSKMARYDMTGIGINLREVTDEN  187



>gb|AIA26575.1| serine protease [Cicer arietinum]
Length=476

 Score =   123 bits (308),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +1

Query  259  CRE-DEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS  435
            CR+ D  +++     PEVV+NEG+V E WQIVND FL+T R  WS + W+ KK+D+LS S
Sbjct  71   CRDADSSDVTVPTNAPEVVTNEGLVQEAWQIVNDDFLDTGRHRWSHDTWQLKKQDLLSNS  130

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            IQ+R +AH+II+RMLASLGDPYTR+LSP E F  MA
Sbjct  131  IQTRSKAHNIIKRMLASLGDPYTRYLSPEE-FSKMA  165


 Score = 46.2 bits (108),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREV  DN
Sbjct  160  EFSKMARYDMTGIGINLREVNDDN  183



>ref|XP_010056858.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010056859.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Eucalyptus grandis]
Length=427

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CRE+E E  AA A PE V+NEGIV E W IVN+SFL T RRSWSPE W+ KKEDILSTSI
Sbjct  86   CREEEGEDGAA-AVPERVTNEGIVEEAWSIVNESFLGTGRRSWSPEAWQRKKEDILSTSI  144

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
             +R +AH++IRRMLA LGDPYTRFLSP E
Sbjct  145  PTRSKAHELIRRMLAGLGDPYTRFLSPDE  173



>ref|XP_007213023.1| hypothetical protein PRUPE_ppa023076mg [Prunus persica]
 gb|EMJ14222.1| hypothetical protein PRUPE_ppa023076mg [Prunus persica]
Length=475

 Score =   117 bits (293),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            C EDE + +A       V++EGIV E W+IVNDSFLNTSR    PE W+ K+EDI S+SI
Sbjct  86   CSEDEGDETAELGSEPAVTSEGIVEEAWEIVNDSFLNTSRSRSFPETWQRKREDIRSSSI  145

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            ++R +AHD I+RMLASLGDPYTRFLSP E F  MA
Sbjct  146  KTRSKAHDTIKRMLASLGDPYTRFLSPEE-FSKMA  179


 Score = 48.9 bits (115),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP DN
Sbjct  174  EFSKMARYDMSGIGINLREVPDDN  197



>ref|XP_007025177.1| Peptidase S41 family protein isoform 1 [Theobroma cacao]
 gb|EOY27799.1| Peptidase S41 family protein isoform 1 [Theobroma cacao]
Length=477

 Score =   122 bits (305),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  K+EDIL TSIQ+R +AH++I+RM
Sbjct  101  KPEFVTNEEIVQEAWQIVNDSFLDTRRHRWSPQSWLQKREDILGTSIQTRSKAHELIKRM  160

Query  478  LASLGDPYTRFLSPAECFYSMA  543
            LASLGDPYTRFLSPAE F  MA
Sbjct  161  LASLGDPYTRFLSPAE-FSKMA  181


 Score = 43.5 bits (101),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGD  635
            +FSKMARYDMTGIGIN+REV  D
Sbjct  176  EFSKMARYDMTGIGINIREVSDD  198



>ref|XP_007025180.1| Peptidase S41 family protein isoform 4, partial [Theobroma cacao]
 gb|EOY27802.1| Peptidase S41 family protein isoform 4, partial [Theobroma cacao]
Length=357

 Score =   121 bits (304),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  K+EDIL TSIQ+R +AH++I+RM
Sbjct  100  KPEFVTNEEIVQEAWQIVNDSFLDTRRHRWSPQSWLQKREDILGTSIQTRSKAHELIKRM  159

Query  478  LASLGDPYTRFLSPAECFYSMA  543
            LASLGDPYTRFLSPAE F  MA
Sbjct  160  LASLGDPYTRFLSPAE-FSKMA  180


 Score = 43.5 bits (101),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGD  635
            +FSKMARYDMTGIGIN+REV  D
Sbjct  175  EFSKMARYDMTGIGINIREVSDD  197



>ref|XP_007025179.1| Peptidase S41 family protein isoform 3, partial [Theobroma cacao]
 gb|EOY27801.1| Peptidase S41 family protein isoform 3, partial [Theobroma cacao]
Length=349

 Score =   122 bits (305),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  K+EDIL TSIQ+R +AH++I+RM
Sbjct  95   KPEFVTNEEIVQEAWQIVNDSFLDTRRHRWSPQSWLQKREDILGTSIQTRSKAHELIKRM  154

Query  478  LASLGDPYTRFLSPAECFYSMA  543
            LASLGDPYTRFLSPAE F  MA
Sbjct  155  LASLGDPYTRFLSPAE-FSKMA  175


 Score = 43.5 bits (101),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGD  635
            +FSKMARYDMTGIGIN+REV  D
Sbjct  170  EFSKMARYDMTGIGINIREVSDD  192



>ref|XP_007025178.1| Peptidase S41 family protein isoform 2, partial [Theobroma cacao]
 gb|EOY27800.1| Peptidase S41 family protein isoform 2, partial [Theobroma cacao]
Length=439

 Score =   121 bits (304),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  K+EDIL TSIQ+R +AH++I+RM
Sbjct  106  KPEFVTNEEIVQEAWQIVNDSFLDTRRHRWSPQSWLQKREDILGTSIQTRSKAHELIKRM  165

Query  478  LASLGDPYTRFLSPAECFYSMA  543
            LASLGDPYTRFLSPAE F  MA
Sbjct  166  LASLGDPYTRFLSPAE-FSKMA  186


 Score = 43.5 bits (101),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGD  635
            +FSKMARYDMTGIGIN+REV  D
Sbjct  181  EFSKMARYDMTGIGINIREVSDD  203



>ref|XP_008225367.1| PREDICTED: C-terminal processing peptidase, chloroplastic [Prunus 
mume]
Length=475

 Score =   116 bits (290),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            C EDE + +A       V++EGIV E W+IVNDSFLNTS     PE W+ KKEDI S+SI
Sbjct  86   CSEDEGDETAELGSEPAVTSEGIVEEAWEIVNDSFLNTSGSRSFPETWQRKKEDIRSSSI  145

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            ++R +AHD I+RMLASLGDPYTRFLSP E F  MA
Sbjct  146  KTRSKAHDTIKRMLASLGDPYTRFLSPEE-FSKMA  179


 Score = 48.9 bits (115),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP DN
Sbjct  174  EFSKMARYDMSGIGINLREVPDDN  197



>ref|XP_006580200.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
isoform X1 [Glycine max]
Length=442

 Score =   116 bits (290),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E         PEVV+NEG+V E WQIVND+FL+T R  WS + W+ K+E ILS SI
Sbjct  53   CRDVEPIQETLQTAPEVVTNEGLVEEAWQIVNDTFLDTGRHRWSQDTWQLKREAILSNSI  112

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH II+RML+SL DPYTRFLSP E F  MA
Sbjct  113  QTRSKAHHIIKRMLSSLADPYTRFLSPDE-FSKMA  146


 Score = 46.6 bits (109),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTG+GINL+EVP +N
Sbjct  141  EFSKMARYDMTGVGINLKEVPDEN  164



>gb|KHN06461.1| Carboxyl-terminal-processing protease [Glycine soja]
Length=442

 Score =   116 bits (290),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E         PEVV+NEG+V E WQIVND+FL+T R  WS + W+ K+E ILS SI
Sbjct  53   CRDVEPIQETLQTAPEVVTNEGLVEEAWQIVNDTFLDTGRHRWSQDTWQLKREAILSNSI  112

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH II+RML+SL DPYTRFLSP E F  MA
Sbjct  113  QTRSKAHHIIKRMLSSLADPYTRFLSPDE-FSKMA  146


 Score = 46.6 bits (109),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTG+GINL+EVP +N
Sbjct  141  EFSKMARYDMTGVGINLKEVPDEN  164



>gb|EPS62840.1| hypothetical protein M569_11946, partial [Genlisea aurea]
Length=420

 Score =   117 bits (294),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = +1

Query  247  QQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            ++L C EDE    +    P+ V+NE IV E WQ+VND++L+  RR WS + W  +KEDIL
Sbjct  5    EELICIEDEN--YSNDKLPDEVTNEEIVEEAWQLVNDAYLDVGRRHWSADSWLERKEDIL  62

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            S+SIQ+R RAH+II++MLASLGDPYTRFLSPAE F  MA
Sbjct  63   SSSIQTRSRAHEIIKKMLASLGDPYTRFLSPAE-FSKMA  100


 Score = 45.1 bits (105),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGD  635
            +FSKMARYDMTGIG+NL+E+P D
Sbjct  95   EFSKMARYDMTGIGVNLKEIPDD  117



>gb|ACU24465.1| unknown [Glycine max]
Length=358

 Score =   116 bits (290),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E         PEVV+NEG+V E WQIVND+FL+T R  WS + W+ K+E ILS SI
Sbjct  53   CRDVEPIQETLQTAPEVVTNEGLVEEAWQIVNDTFLDTGRHRWSQDTWQLKREAILSNSI  112

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH II+RML+SL DPYTRFLSP E F  MA
Sbjct  113  QTRSKAHHIIKRMLSSLADPYTRFLSPDE-FSKMA  146


 Score = 46.6 bits (109),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTG+GINL+EVP +N
Sbjct  141  EFSKMARYDMTGVGINLKEVPDEN  164



>ref|XP_006580201.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
isoform X2 [Glycine max]
Length=429

 Score =   116 bits (290),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CR+ E         PEVV+NEG+V E WQIVND+FL+T R  WS + W+ K+E ILS SI
Sbjct  53   CRDVEPIQETLQTAPEVVTNEGLVEEAWQIVNDTFLDTGRHRWSQDTWQLKREAILSNSI  112

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            Q+R +AH II+RML+SL DPYTRFLSP E F  MA
Sbjct  113  QTRSKAHHIIKRMLSSLADPYTRFLSPDE-FSKMA  146


 Score = 46.6 bits (109),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTG+GINL+EVP +N
Sbjct  141  EFSKMARYDMTGVGINLKEVPDEN  164



>gb|KJB57307.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=470

 Score =   123 bits (308),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  298  EPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            +PE V+NE IV E WQIVNDSFL+T R  WSP+ W  KKEDIL TSIQ+R +AH++I+RM
Sbjct  97   KPEFVTNEEIVQEAWQIVNDSFLDTGRHRWSPQSWEQKKEDILGTSIQTRSKAHELIKRM  156

Query  478  LASLGDPYTRFLSPAE  525
            LASLGDPYTRFLSPAE
Sbjct  157  LASLGDPYTRFLSPAE  172


 Score = 39.7 bits (91),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  573  SKMARYDMTGIGINLREVPGDN  638
            ++MARYD+TGIGIN+REVP D 
Sbjct  171  AEMARYDITGIGINIREVPDDT  192



>ref|XP_007159532.1| hypothetical protein PHAVU_002G245300g [Phaseolus vulgaris]
 gb|ESW31526.1| hypothetical protein PHAVU_002G245300g [Phaseolus vulgaris]
Length=446

 Score =   115 bits (289),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  301  PEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            PEVV+N+G+V E WQIVND+FL+T R  WS + W+ K+E ILS SIQ+R +AH II+RML
Sbjct  71   PEVVTNQGLVEEAWQIVNDTFLDTGRHRWSQDTWQLKREAILSNSIQTRSKAHQIIKRML  130

Query  481  ASLGDPYTRFLSPAECFYSMA  543
            +SLGDPYTRFLSP E F  MA
Sbjct  131  SSLGDPYTRFLSPDE-FSKMA  150


 Score = 46.6 bits (109),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTG+GINL+EVP +N
Sbjct  145  EFSKMARYDMTGVGINLKEVPDEN  168



>ref|XP_008443944.1| PREDICTED: C-terminal processing peptidase, chloroplastic [Cucumis 
melo]
Length=490

 Score =   112 bits (280),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = +1

Query  259  CREDEQ--ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILST  432
            C +++Q  E  ++       +NE IV E W+IVNDSFL+  R  WSPE W+ ++EDI + 
Sbjct  100  CLDEDQLHEFGSSETGSPPATNEDIVREAWEIVNDSFLDAGRNRWSPEAWKQRQEDITNI  159

Query  433  SIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            SIQ+R +AH+IIRRMLASLGDPYTRFL PAE F  MA
Sbjct  160  SIQTRSKAHNIIRRMLASLGDPYTRFLPPAE-FSKMA  195


 Score = 50.1 bits (118),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREVP DN
Sbjct  190  EFSKMARYDMTGIGINLREVPDDN  213



>ref|XP_004147402.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis 
sativus]
 ref|XP_004171819.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis 
sativus]
 gb|KGN65570.1| hypothetical protein Csa_1G458990 [Cucumis sativus]
Length=489

 Score =   112 bits (279),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = +1

Query  265  EDE-QELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQ  441
            EDE  E  ++       +NE IV E W+IVNDSFL++ R  WSPE W+ ++EDI + SIQ
Sbjct  102  EDELHEFGSSETVSSPATNEDIVREAWEIVNDSFLDSGRNRWSPEAWKQRQEDITNISIQ  161

Query  442  SRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            +R +AH+IIRRMLASLGDPYTRFL PAE F  MA
Sbjct  162  TRSKAHNIIRRMLASLGDPYTRFLPPAE-FSKMA  194


 Score = 50.1 bits (118),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREVP DN
Sbjct  189  EFSKMARYDMTGIGINLREVPDDN  212



>ref|XP_008364177.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Malus domestica]
Length=471

 Score =   115 bits (287),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +1

Query  292  PAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIR  471
            P     V+NEGIV E W+IVNDSF+NT R S  PE W+ KKEDI S+SI++R +AHD+I+
Sbjct  93   PEAAAAVTNEGIVEEAWEIVNDSFINTGRLSSFPETWQRKKEDIRSSSIKTRAKAHDMIK  152

Query  472  RMLASLGDPYTRFLSPAECFYSMA  543
            RMLASLGDPYTRFLSP E F  MA
Sbjct  153  RMLASLGDPYTRFLSPEE-FSKMA  175


 Score = 47.0 bits (110),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDM+GIGINLREVP +N
Sbjct  170  EFSKMARYDMSGIGINLREVPDEN  193



>ref|XP_010538514.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=477

 Score =   120 bits (300),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  256  DCREDEQELSAAPAE----PEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDI  423
            +CR++E   S  P +    PE V++E IV E WQIVND+FL+T R SW+PE W+ KKED+
Sbjct  93   NCRDEEDAESEQPRDDDVRPEFVTDEDIVQEAWQIVNDAFLDTGRHSWTPETWQKKKEDL  152

Query  424  LSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            LS+ I+SR +AH++IR MLA LGDPYTRFLSP E
Sbjct  153  LSSPIRSRSKAHEVIRTMLAGLGDPYTRFLSPEE  186


 Score = 39.7 bits (91),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVP  629
            +FS+M++YD++GIGINLRE+P
Sbjct  186  EFSRMSKYDLSGIGINLREIP  206



>ref|XP_010538513.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=493

 Score =   120 bits (300),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +1

Query  256  DCREDEQELSAAPAE----PEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDI  423
            +CR++E   S  P +    PE V++E IV E WQIVND+FL+T R SW+PE W+ KKED+
Sbjct  93   NCRDEEDAESEQPRDDDVRPEFVTDEDIVQEAWQIVNDAFLDTGRHSWTPETWQKKKEDL  152

Query  424  LSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            LS+ I+SR +AH++IR MLA LGDPYTRFLSP E
Sbjct  153  LSSPIRSRSKAHEVIRTMLAGLGDPYTRFLSPEE  186


 Score = 39.7 bits (91),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVP  629
            +FS+M++YD++GIGINLRE+P
Sbjct  186  EFSRMSKYDLSGIGINLREIP  206



>emb|CDP17322.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   110 bits (276),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 10/99 (10%)
 Frame = +1

Query  256  DCREDE--QELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRS-WSPEIWRSKKEDIL  426
            +CREDE  QE S       +V+NEGIV E W++V DSFL+T+ R  WSPE W  KK D+L
Sbjct  101  NCREDEERQEDSG------LVTNEGIVEEAWEVVYDSFLDTTNRHRWSPETWLQKKFDVL  154

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
              S Q+R +AH +IRRMLASLGDPYTRFL+P E F  MA
Sbjct  155  GMSYQTRSKAHAVIRRMLASLGDPYTRFLTPEE-FSKMA  192


 Score = 47.4 bits (111),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLRE+P D+
Sbjct  187  EFSKMARYDMTGIGINLREIPDDS  210



>ref|XP_006646179.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Oryza brachyantha]
Length=455

 Score =   111 bits (277),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTS  435
            CR+   E+       EVV+NE +V E W++VN+ FL +   R WSPE+W  KK+DIL +S
Sbjct  66   CRDGAAEIKEE-TRTEVVTNEQLVEEAWEVVNEGFLPDAGSRPWSPEMWMKKKQDILQSS  124

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            I+SR RAHDIIR+MLA+LGDPYTRFLSP+E
Sbjct  125  IRSRSRAHDIIRKMLANLGDPYTRFLSPSE  154


 Score = 46.2 bits (108),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTG+G+NLREVP DN
Sbjct  154  EFSKMSKYDMTGVGLNLREVPNDN  177



>ref|XP_002456095.1| hypothetical protein SORBIDRAFT_03g030380 [Sorghum bicolor]
 gb|EES01215.1| hypothetical protein SORBIDRAFT_03g030380 [Sorghum bicolor]
Length=463

 Score =   105 bits (262),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  304  EVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            E V+NE +V E W++VN+SFL + + R WSPE+W  +K+D+L  +I+SR RAHDII++ML
Sbjct  88   EAVTNEQLVEEAWEVVNESFLPDAASRPWSPEMWMQRKQDVLQGTIKSRARAHDIIQKML  147

Query  481  ASLGDPYTRFLSPAE  525
            ASLGDPYTRFLSP+E
Sbjct  148  ASLGDPYTRFLSPSE  162


 Score = 48.5 bits (114),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTGIG+NLRE+PGDN
Sbjct  162  EFSKMSKYDMTGIGLNLREIPGDN  185



>ref|XP_006398333.1| hypothetical protein EUTSA_v10001155mg [Eutrema salsugineum]
 gb|ESQ39786.1| hypothetical protein EUTSA_v10001155mg [Eutrema salsugineum]
Length=490

 Score =   114 bits (286),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 73/93 (78%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQELSAAPAE---PEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+  +  P +   P++V+NEGIV E W+IVND+FL+T   +W+PE W+ +KE+IL
Sbjct  97   DCPNEEEADTETPDDDVRPQLVTNEGIVEEAWEIVNDAFLDTRSHNWTPETWQKQKEEIL  156

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            ++ I+SR +AH++I++MLA+LGDPYTRFLSP E
Sbjct  157  ASPIKSRSKAHEVIKKMLANLGDPYTRFLSPDE  189


 Score = 38.1 bits (87),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  189  EFSRMSKYDITGIGINLREV  208



>ref|XP_008656718.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Zea mays]
Length=403

 Score =   108 bits (269),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTS  435
            CR    E+       E V+NE +V E W++VN+SFL + + R WSPE+W  +K+D+L  +
Sbjct  74   CRNGGAEM-VEEVRAEAVTNEQLVEEAWEVVNESFLPDAASRPWSPEMWMQRKQDVLQGT  132

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            I+SR RAHDIIR+MLASLGDPYTRFLSP+E
Sbjct  133  IKSRARAHDIIRKMLASLGDPYTRFLSPSE  162


 Score = 44.3 bits (103),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTGIG+NLRE+P +N
Sbjct  162  EFSKMSKYDMTGIGLNLREIPDEN  185



>gb|ACG26821.1| carboxyl-terminal-processing protease precursor [Zea mays]
Length=463

 Score =   108 bits (269),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTS  435
            CR    E+       E V+NE +V E W++VN+SFL + + R WSPE+W  +K+D+L  +
Sbjct  74   CRNGGAEM-VEEVRAEAVTNEQLVEEAWEVVNESFLPDAASRPWSPEMWMQRKQDVLQGT  132

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            I+SR RAHDIIR+MLASLGDPYTRFLSP+E
Sbjct  133  IKSRARAHDIIRKMLASLGDPYTRFLSPSE  162


 Score = 43.9 bits (102),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTGIG+NLRE+P +N
Sbjct  162  EFSKMSKYDMTGIGLNLREIPDEN  185



>ref|XP_004969441.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Setaria italica]
Length=457

 Score =   106 bits (264),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  304  EVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            E V+NE +V E W++VN+SFL +   R WSPE+W  +K+DIL  +I+SR RAHDII++ML
Sbjct  82   EAVTNEQLVEEAWEVVNESFLPDAGSRPWSPEMWMQRKQDILQGTIKSRARAHDIIQKML  141

Query  481  ASLGDPYTRFLSPAE  525
            ASLGDPYTRFLSP+E
Sbjct  142  ASLGDPYTRFLSPSE  156


 Score = 45.8 bits (107),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTGIG+NLRE+P DN
Sbjct  156  EFSKMSKYDMTGIGLNLREIPDDN  179



>ref|XP_010926294.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Elaeis guineensis]
 ref|XP_010926303.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=484

 Score =   105 bits (261),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  PEVVSNEGIVAEVWQIVNDSFLNTS-RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            PE ++NE +V E W +VN+SFL  +  RSWSPE W  KK+D L  SIQ+R RAH++I++M
Sbjct  108  PESITNEALVEEAWDVVNESFLGDAVSRSWSPEKWLKKKQDFLHKSIQTRSRAHNVIQKM  167

Query  478  LASLGDPYTRFLSPAE  525
            LASLGDPYTRFLSP+E
Sbjct  168  LASLGDPYTRFLSPSE  183


 Score = 45.8 bits (107),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YD+TGIGINLREVP DN
Sbjct  183  EFSKMSKYDVTGIGINLREVPDDN  206



>ref|XP_010926256.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010926264.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010926281.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=488

 Score =   105 bits (261),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  PEVVSNEGIVAEVWQIVNDSFLNTS-RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            PE ++NE +V E W +VN+SFL  +  RSWSPE W  KK+D L  SIQ+R RAH++I++M
Sbjct  108  PESITNEALVEEAWDVVNESFLGDAVSRSWSPEKWLKKKQDFLHKSIQTRSRAHNVIQKM  167

Query  478  LASLGDPYTRFLSPAE  525
            LASLGDPYTRFLSP+E
Sbjct  168  LASLGDPYTRFLSPSE  183


 Score = 46.2 bits (108),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YD+TGIGINLREVP DN
Sbjct  183  EFSKMSKYDVTGIGINLREVPDDN  206



>ref|XP_010926312.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=473

 Score =   105 bits (261),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  PEVVSNEGIVAEVWQIVNDSFLNTS-RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            PE ++NE +V E W +VN+SFL  +  RSWSPE W  KK+D L  SIQ+R RAH++I++M
Sbjct  108  PESITNEALVEEAWDVVNESFLGDAVSRSWSPEKWLKKKQDFLHKSIQTRSRAHNVIQKM  167

Query  478  LASLGDPYTRFLSPAE  525
            LASLGDPYTRFLSP+E
Sbjct  168  LASLGDPYTRFLSPSE  183


 Score = 46.2 bits (108),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YD+TGIGINLREVP DN
Sbjct  183  EFSKMSKYDVTGIGINLREVPDDN  206



>ref|XP_010926320.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=469

 Score =   105 bits (261),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  PEVVSNEGIVAEVWQIVNDSFLNTS-RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM  477
            PE ++NE +V E W +VN+SFL  +  RSWSPE W  KK+D L  SIQ+R RAH++I++M
Sbjct  108  PESITNEALVEEAWDVVNESFLGDAVSRSWSPEKWLKKKQDFLHKSIQTRSRAHNVIQKM  167

Query  478  LASLGDPYTRFLSPAE  525
            LASLGDPYTRFLSP+E
Sbjct  168  LASLGDPYTRFLSPSE  183


 Score = 46.2 bits (108),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YD+TGIGINLREVP DN
Sbjct  183  EFSKMSKYDVTGIGINLREVPDDN  206



>gb|AFW83480.1| carboxyl-terminal-processing protease [Zea mays]
Length=298

 Score =   107 bits (266),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTS  435
            CR    E+       E V+NE +V E W++VN+SFL + + R WSPE+W  +K+D+L  +
Sbjct  74   CRNGGAEM-VEEVRAEAVTNEQLVEEAWEVVNESFLPDAASRPWSPEMWMQRKQDVLQGT  132

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            I+SR RAHDIIR+MLASLGDPYTRFLSP+E
Sbjct  133  IKSRARAHDIIRKMLASLGDPYTRFLSPSE  162


 Score = 44.3 bits (103),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTGIG+NLRE+P +N
Sbjct  162  EFSKMSKYDMTGIGLNLREIPDEN  185



>dbj|BAB11094.1| carboxy-terminal proteinase D1-like protein [Arabidopsis thaliana]
Length=488

 Score =   111 bits (278),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+     EP++V+NEGIV E W+IVN +FL+T   SW+PE W+ +K+DIL
Sbjct  96   DCPNEEEADTEIQDDDIEPQLVTNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDIL  155

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            ++ I+SR +AH++I+ MLASLGD YTRFLSP E
Sbjct  156  ASPIKSRSKAHEVIKNMLASLGDQYTRFLSPDE  188


 Score = 38.5 bits (88),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  188  EFSRMSKYDITGIGINLREV  207



>gb|KFK31469.1| hypothetical protein AALP_AA6G116300 [Arabis alpina]
Length=483

 Score =   112 bits (281),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQELSAAPAE---PEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC E+E+  S  P +   P++VSNEGIV E W+IVND+FL+T    W+PE W+ +KE+IL
Sbjct  90   DCPEEEEADSEIPEDEIKPQLVSNEGIVEEAWEIVNDAFLDTRSLKWTPETWQKQKEEIL  149

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            ++  +SR +AH++I++MLASLGD YTRFLSP E
Sbjct  150  ASPFKSRSKAHEVIKKMLASLGDQYTRFLSPDE  182


 Score = 37.0 bits (84),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD++GIGINLREV
Sbjct  182  EFSRMSKYDISGIGINLREV  201



>ref|NP_974893.1| peptidase S41 family protein [Arabidopsis thaliana]
 sp|F4KHG6.1|CTPA1_ARATH RecName: Full=Carboxyl-terminal-processing peptidase 1, chloroplastic; 
AltName: Full=D1 C-terminal processing protease 1; 
AltName: Full=Photosystem II D1 protein processing peptidase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AED95378.1| peptidase S41 family protein [Arabidopsis thaliana]
Length=489

 Score =   111 bits (278),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+     EP++V+NEGIV E W+IVN +FL+T   SW+PE W+ +K+DIL
Sbjct  96   DCPNEEEADTEIQDDDIEPQLVTNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDIL  155

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            ++ I+SR +AH++I+ MLASLGD YTRFLSP E
Sbjct  156  ASPIKSRSKAHEVIKNMLASLGDQYTRFLSPDE  188


 Score = 38.5 bits (88),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  188  EFSRMSKYDITGIGINLREV  207



>ref|NP_199451.2| peptidase S41 family protein [Arabidopsis thaliana]
 gb|AAL32845.1| carboxy-terminal proteinase D1-like protein [Arabidopsis thaliana]
 gb|AAM10212.1| carboxy-terminal proteinase D1-like protein [Arabidopsis thaliana]
 gb|AED95377.1| peptidase S41 family protein [Arabidopsis thaliana]
Length=428

 Score =   111 bits (277),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+     EP++V+NEGIV E W+IVN +FL+T   SW+PE W+ +K+DIL
Sbjct  96   DCPNEEEADTEIQDDDIEPQLVTNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDIL  155

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            ++ I+SR +AH++I+ MLASLGD YTRFLSP E
Sbjct  156  ASPIKSRSKAHEVIKNMLASLGDQYTRFLSPDE  188


 Score = 38.5 bits (88),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  188  EFSRMSKYDITGIGINLREV  207



>ref|NP_001043789.2| Os01g0664000 [Oryza sativa Japonica Group]
 gb|EAY75274.1| hypothetical protein OsI_03161 [Oryza sativa Indica Group]
 dbj|BAF05703.2| Os01g0664000 [Oryza sativa Japonica Group]
Length=474

 Score =   107 bits (266),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  304  EVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            EVV+NE +V E W++VN+ FL +   R WSPE+W  KK+DI+ TSI+SR RAHDII++ML
Sbjct  86   EVVTNEQLVEEAWEVVNEGFLPDAGSRPWSPEMWMKKKQDIVQTSIRSRSRAHDIIQKML  145

Query  481  ASLGDPYTRFLSPAE  525
            A+LGDPYTRFL+P+E
Sbjct  146  ANLGDPYTRFLTPSE  160


 Score = 42.7 bits (99),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTGIG+NLRE+P  N
Sbjct  160  EFSKMSKYDMTGIGLNLREIPDGN  183



>ref|XP_010494811.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=405

 Score =   111 bits (277),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +1

Query  238  NEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKE  417
            NEE+  D    + + +    +P++V+NEGIV E W+IVND+FL+T  RSW+PE W+ +K+
Sbjct  99   NEEEADDAEMQDDDFN----KPQLVTNEGIVEEAWEIVNDAFLDTRSRSWTPEAWQKQKD  154

Query  418  DILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
             IL++ I+SR +AH++I++MLASLGD YTRFLSP E
Sbjct  155  VILASPIKSRSKAHEVIKKMLASLGDQYTRFLSPDE  190


 Score = 38.5 bits (88),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  190  EFSRMSKYDITGIGINLREV  209



>dbj|BAD72341.1| carboxy-terminal proteinase-like [Oryza sativa Japonica Group]
Length=461

 Score =   107 bits (266),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  304  EVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            EVV+NE +V E W++VN+ FL +   R WSPE+W  KK+DI+ TSI+SR RAHDII++ML
Sbjct  86   EVVTNEQLVEEAWEVVNEGFLPDAGSRPWSPEMWMKKKQDIVQTSIRSRSRAHDIIQKML  145

Query  481  ASLGDPYTRFLSPAE  525
            A+LGDPYTRFL+P+E
Sbjct  146  ANLGDPYTRFLTPSE  160


 Score = 42.7 bits (99),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTGIG+NLRE+P  N
Sbjct  160  EFSKMSKYDMTGIGLNLREIPDGN  183



>gb|EAZ12995.1| hypothetical protein OsJ_02915 [Oryza sativa Japonica Group]
Length=474

 Score =   107 bits (266),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  304  EVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML  480
            EVV+NE +V E W++VN+ FL +   R WSPE+W  KK+DI+ TSI+SR RAHDII++ML
Sbjct  86   EVVTNEQLVEEAWEVVNEGFLPDAGSRPWSPEMWMKKKQDIVQTSIRSRSRAHDIIQKML  145

Query  481  ASLGDPYTRFLSPAE  525
            A+LGDPYTRFL+P+E
Sbjct  146  ANLGDPYTRFLTPSE  160


 Score = 42.7 bits (99),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKM++YDMTGIG+NLRE+P  N
Sbjct  160  EFSKMSKYDMTGIGLNLREIPDGN  183



>ref|XP_010494810.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=480

 Score =   111 bits (277),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +1

Query  238  NEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKE  417
            NEE+  D    + + +    +P++V+NEGIV E W+IVND+FL+T  RSW+PE W+ +K+
Sbjct  99   NEEEADDAEMQDDDFN----KPQLVTNEGIVEEAWEIVNDAFLDTRSRSWTPEAWQKQKD  154

Query  418  DILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
             IL++ I+SR +AH++I++MLASLGD YTRFLSP E
Sbjct  155  VILASPIKSRSKAHEVIKKMLASLGDQYTRFLSPDE  190


 Score = 38.5 bits (88),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  190  EFSRMSKYDITGIGINLREV  209



>ref|XP_010494809.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=491

 Score =   111 bits (277),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +1

Query  238  NEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKE  417
            NEE+  D    + + +    +P++V+NEGIV E W+IVND+FL+T  RSW+PE W+ +K+
Sbjct  99   NEEEADDAEMQDDDFN----KPQLVTNEGIVEEAWEIVNDAFLDTRSRSWTPEAWQKQKD  154

Query  418  DILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
             IL++ I+SR +AH++I++MLASLGD YTRFLSP E
Sbjct  155  VILASPIKSRSKAHEVIKKMLASLGDQYTRFLSPDE  190


 Score = 38.5 bits (88),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  190  EFSRMSKYDITGIGINLREV  209



>ref|XP_010441589.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X3 [Camelina sativa]
Length=408

 Score =   110 bits (276),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 5/96 (5%)
 Frame = +1

Query  238  NEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKE  417
            NEE+  D    + +        ++V+NEGIV E W IVND+FL+T  RSW+PE W+ +K+
Sbjct  99   NEEEAGDAEMQDDDFKT-----QLVTNEGIVEEAWDIVNDAFLDTRSRSWTPETWQKQKD  153

Query  418  DILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            DIL++ I+SR +AH++I++MLASLGD YTRFLSP E
Sbjct  154  DILASPIKSRSKAHEVIKKMLASLGDQYTRFLSPDE  189


 Score = 38.5 bits (88),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  189  EFSRMSKYDITGIGINLREV  208



>ref|XP_010441586.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=490

 Score =   110 bits (276),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 5/96 (5%)
 Frame = +1

Query  238  NEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKE  417
            NEE+  D    + +        ++V+NEGIV E W IVND+FL+T  RSW+PE W+ +K+
Sbjct  99   NEEEAGDAEMQDDDFKT-----QLVTNEGIVEEAWDIVNDAFLDTRSRSWTPETWQKQKD  153

Query  418  DILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            DIL++ I+SR +AH++I++MLASLGD YTRFLSP E
Sbjct  154  DILASPIKSRSKAHEVIKKMLASLGDQYTRFLSPDE  189


 Score = 38.5 bits (88),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  189  EFSRMSKYDITGIGINLREV  208



>ref|XP_010441587.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=479

 Score =   110 bits (276),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 5/96 (5%)
 Frame = +1

Query  238  NEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKE  417
            NEE+  D    + +        ++V+NEGIV E W IVND+FL+T  RSW+PE W+ +K+
Sbjct  99   NEEEAGDAEMQDDDFKT-----QLVTNEGIVEEAWDIVNDAFLDTRSRSWTPETWQKQKD  153

Query  418  DILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            DIL++ I+SR +AH++I++MLASLGD YTRFLSP E
Sbjct  154  DILASPIKSRSKAHEVIKKMLASLGDQYTRFLSPDE  189


 Score = 38.1 bits (87),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  189  EFSRMSKYDITGIGINLREV  208



>ref|XP_006280370.1| hypothetical protein CARUB_v10026297mg [Capsella rubella]
 gb|EOA13268.1| hypothetical protein CARUB_v10026297mg [Capsella rubella]
Length=489

 Score =   110 bits (274),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   ++     +P++V+NEGIV E W IVN +FLNT   +WSPE W+ +K+DIL
Sbjct  96   DCPNEEEADTKMQDDDFKPQLVTNEGIVEEAWDIVNGAFLNTRNNNWSPEAWQKQKDDIL  155

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            ++ I+SR +AH++I++MLASLGD YTRFLSP E
Sbjct  156  ASPIKSRSKAHEVIKKMLASLGDQYTRFLSPDE  188


 Score = 38.1 bits (87),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  188  EFSRMSKYDITGIGINLREV  207



>ref|XP_002865196.1| peptidase S41 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41455.1| peptidase S41 family protein [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score =   109 bits (273),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+     +P++V+NEGIV E W+IVN +FL+T   SW+PE W+ +K+DIL
Sbjct  96   DCPNEEEADTEMQDDDFKPQLVTNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDIL  155

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            ++ I+SR +AH++I+ MLASLGD YTRFLSP E
Sbjct  156  ASPIKSRSKAHEVIKNMLASLGDQYTRFLSPDE  188


 Score = 38.1 bits (87),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  188  EFSRMSKYDITGIGINLREV  207



>emb|CDY35162.1| BnaA09g17990D [Brassica napus]
Length=489

 Score =   109 bits (272),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+      P++V+NEGIV E W+IVNDSFL+     W+PE W+ +KE+IL
Sbjct  85   DCPNEEEADTEVLEDDVRPQLVTNEGIVEEAWEIVNDSFLDARSNRWTPETWQKQKEEIL  144

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            S+ I+SR +AH++I++ML SLGD YTRFLSP E
Sbjct  145  SSPIKSRSKAHEVIKKMLGSLGDQYTRFLSPDE  177


 Score = 38.1 bits (87),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  177  EFSRMSKYDITGIGINLREV  196



>ref|XP_008797514.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797515.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Phoenix dactylifera]
Length=488

 Score =   104 bits (260),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +1

Query  310  VSNEGIVAEVWQIVNDSFLNTS-RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLAS  486
            ++NEG+V E W++VN+SFL  +  RSWSPE W  KK+D L  SIQ+R RAHD I++MLAS
Sbjct  115  ITNEGLVEEAWEVVNESFLGDAVSRSWSPEKWLKKKQDFLHKSIQTRSRAHDAIQKMLAS  174

Query  487  LGDPYTRFLSPAE  525
            LGDPYTRFLSP+E
Sbjct  175  LGDPYTRFLSPSE  187


 Score = 42.0 bits (97),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVP  629
            +FSKM++YD+TGIGINLREVP
Sbjct  187  EFSKMSKYDVTGIGINLREVP  207



>gb|AAL99044.1|AF487526_1 D1 protease-like protein precursor [Triticum aestivum]
Length=400

 Score =   100 bits (249),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 6/92 (7%)
 Frame = +1

Query  259  CR--EDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILS  429
            CR  +D +E+     + E V+NE +V E W++VN+ FL +   R WSPE+W  +K+DIL 
Sbjct  11   CRGQDDGREVEV---KAEAVTNEQLVEEAWEVVNEGFLPDAGSRPWSPELWMQRKQDILQ  67

Query  430  TSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
             SI+SR RAHDII +MLASLGDPYTRFLS ++
Sbjct  68   GSIKSRSRAHDIITKMLASLGDPYTRFLSSSD  99


 Score = 45.4 bits (106),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  570  FSKMARYDMTGIGINLREVPGDN  638
            FSKM++YDMTGIG+NLRE+P DN
Sbjct  100  FSKMSKYDMTGIGLNLREIPDDN  122



>dbj|BAK05409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   101 bits (252),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 72/104 (69%), Gaps = 7/104 (7%)
 Frame = +1

Query  214  SAVALVQTNEEQQLDCR--EDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRS  384
            +AVA+    +  +L CR  +D +E+     + E V+NE +V E W++VN+ FL +   R 
Sbjct  55   NAVAVAPVEQPPEL-CRGQDDGREVEV---KAETVTNEQLVEEAWEVVNEGFLPDAGSRP  110

Query  385  WSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLS  516
            WSPE+W  +K+DIL  SI+SR RAHDII +MLASLGDPYTRFLS
Sbjct  111  WSPELWMQRKQDILQGSIKSRSRAHDIITKMLASLGDPYTRFLS  154


 Score = 44.3 bits (103),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  570  FSKMARYDMTGIGINLREVPGDN  638
            FSKM++YDMTGIG+N+RE+P DN
Sbjct  158  FSKMSKYDMTGIGLNIREIPDDN  180



>ref|XP_006837882.1| hypothetical protein AMTR_s00100p00127450 [Amborella trichopoda]
 gb|ERN00451.1| hypothetical protein AMTR_s00100p00127450 [Amborella trichopoda]
Length=415

 Score =   100 bits (248),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = +1

Query  256  DCREDEQ------ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKE  417
            DCR+ E+      E S      E+V N  IV E WQIVNDSF +    SWS E W   +E
Sbjct  72   DCRKSEEGGDEVREFSL-----ELVPNRRIVEEAWQIVNDSFFDAHLHSWSTEKWLKNQE  126

Query  418  DILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            +ILS SI +R +AHDIIR MLASL DPYTRFL+P+E F  MA
Sbjct  127  EILSGSIDTRSQAHDIIRSMLASLADPYTRFLTPSE-FSKMA  167


 Score = 45.4 bits (106),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYD+TG+G+NLREVP D+
Sbjct  162  EFSKMARYDITGVGMNLREVPNDD  185



>ref|XP_009114355.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Brassica rapa]
Length=415

 Score =   106 bits (265),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+       ++V+NEGIV E W+IVND+FL+    +WSPE W+ +KE+IL
Sbjct  85   DCPNEEEADTEVLEDDVRSQLVTNEGIVEEAWEIVNDAFLDARSNTWSPETWQKQKEEIL  144

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            S+ I+SR +AH++I++ML SLGD YTRFLSP E
Sbjct  145  SSPIKSRSKAHEVIKKMLGSLGDQYTRFLSPDE  177


 Score = 38.5 bits (88),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  177  EFSRMSKYDITGIGINLREV  196



>ref|XP_009114354.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Brassica rapa]
Length=478

 Score =   106 bits (265),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+       ++V+NEGIV E W+IVND+FL+    +WSPE W+ +KE+IL
Sbjct  85   DCPNEEEADTEVLEDDVRSQLVTNEGIVEEAWEIVNDAFLDARSNTWSPETWQKQKEEIL  144

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            S+ I+SR +AH++I++ML SLGD YTRFLSP E
Sbjct  145  SSPIKSRSKAHEVIKKMLGSLGDQYTRFLSPDE  177


 Score = 38.1 bits (87),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  177  EFSRMSKYDITGIGINLREV  196



>ref|XP_009114356.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X3 [Brassica rapa]
Length=386

 Score =   106 bits (265),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+       ++V+NEGIV E W+IVND+FL+    +WSPE W+ +KE+IL
Sbjct  85   DCPNEEEADTEVLEDDVRSQLVTNEGIVEEAWEIVNDAFLDARSNTWSPETWQKQKEEIL  144

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            S+ I+SR +AH++I++ML SLGD YTRFLSP E
Sbjct  145  SSPIKSRSKAHEVIKKMLGSLGDQYTRFLSPDE  177


 Score = 38.1 bits (87),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  177  EFSRMSKYDITGIGINLREV  196



>ref|XP_003569507.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Brachypodium distachyon]
Length=456

 Score =   102 bits (254),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTS  435
            CR  +     A  + E V+NE +V E W++VN+ FL +   R WSPE+W  +K+DIL  S
Sbjct  67   CRGGDGG-GKAEVKAEAVTNEQLVEEAWEVVNEGFLPDAGSRPWSPELWLQRKQDILQGS  125

Query  436  IQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            I+SR RAHDII +MLASLGDPYTRFL P++
Sbjct  126  IKSRSRAHDIITKMLASLGDPYTRFLPPSD  155


 Score = 42.0 bits (97),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +3

Query  570  FSKMARYDMTGIGINLREVPGDN  638
            FSKM++YDMTGIG+NLRE+  DN
Sbjct  156  FSKMSKYDMTGIGLNLREISDDN  178



>emb|CDY03220.1| BnaC09g19360D [Brassica napus]
Length=478

 Score =   105 bits (263),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +1

Query  256  DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL  426
            DC  +E+   E+      P++V+NEGIV E W+IVND+FL+     WS E W+ +KE+IL
Sbjct  85   DCPNEEEADTEVLEDDVRPQLVTNEGIVEEAWEIVNDAFLDARSNRWSSETWQKRKEEIL  144

Query  427  STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            S+ I+SR +AH++I++ML SLGD YTRFLSP E
Sbjct  145  SSPIKSRSKAHEVIKKMLGSLGDQYTRFLSPDE  177


 Score = 38.1 bits (87),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  177  EFSRMSKYDITGIGINLREV  196



>ref|XP_010481459.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic-like 
[Camelina sativa]
Length=491

 Score =   105 bits (261),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = +1

Query  256  DC-REDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDI  423
            DC +EDE    E+     + ++V+NEGIV E W IVND+FL+T   SW+PE W+ +K+ I
Sbjct  97   DCPKEDEADDAEMQDDDFKTQLVTNEGIVEEAWDIVNDAFLDTRSHSWTPEAWQKQKDAI  156

Query  424  LSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            L++ I++R +AH++I++MLASLGD YTRFLSP E
Sbjct  157  LASPIKNRSKAHEVIKKMLASLGDQYTRFLSPDE  190


 Score = 38.5 bits (88),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREV  626
            +FS+M++YD+TGIGINLREV
Sbjct  190  EFSRMSKYDITGIGINLREV  209



>gb|ABR16660.1| unknown [Picea sitchensis]
Length=472

 Score =   100 bits (250),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = +1

Query  223  ALVQT---NEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSP  393
            AL QT    + Q++  R  E   +   AE + ++NEGIV E W +VN++FL+    +WS 
Sbjct  89   ALGQTLDLGQPQEMVDRCKEGMPTDTGAEEKAITNEGIVEEAWLVVNENFLDARHHTWSA  148

Query  394  EIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            + W  KKE+ LS  IQ+R  AHDIIRRMLA+L DPYTRFL+P+E F  +A
Sbjct  149  KAWLKKKEEALSRPIQTRSTAHDIIRRMLATLDDPYTRFLTPSE-FTKLA  197


 Score = 36.6 bits (83),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +F+K+ARYD++G+GINL+EV  ++
Sbjct  192  EFTKLARYDLSGVGINLKEVSDED  215



>gb|ABR16649.1| unknown [Picea sitchensis]
Length=500

 Score =   100 bits (250),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = +1

Query  223  ALVQT---NEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSP  393
            AL QT    + Q++  R  E   +   AE + ++NEGIV E W +VN++FL+    +WS 
Sbjct  89   ALGQTLDLGQPQEMVDRCKEGMPTDTGAEEKAITNEGIVEEAWLVVNENFLDARHHTWSA  148

Query  394  EIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMA  543
            + W  KKE+ LS  IQ+R  AHDIIRRMLA+L DPYTRFL+P+E F  +A
Sbjct  149  KAWLKKKEEALSRPIQTRSTAHDIIRRMLATLDDPYTRFLTPSE-FTKLA  197


 Score = 37.0 bits (84),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +F+K+ARYD++G+GINL+EV  ++
Sbjct  192  EFTKLARYDLSGVGINLKEVSDED  215



>gb|ACJ85416.1| unknown [Medicago truncatula]
Length=252

 Score = 87.8 bits (216),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +1

Query  358  SFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYS  537
            +FL+T R  WS + W+ KK DILS +IQ+R +AH+II+RMLASLGDPYTRFLSP E F  
Sbjct  32   TFLDTGRNRWSQDTWQLKKNDILSNTIQTRSKAHNIIKRMLASLGDPYTRFLSPEE-FSK  90

Query  538  MA  543
            MA
Sbjct  91   MA  92


 Score = 45.1 bits (105),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +3

Query  567  KFSKMARYDMTGIGINLREVPGDN  638
            +FSKMARYDMTGIGINLREV  +N
Sbjct  87   EFSKMARYDMTGIGINLREVTDEN  110



>emb|CAA62434.1| C-terminal peptidase of the D1 protein [Hordeum vulgare subsp. 
vulgare]
Length=354

 Score = 79.7 bits (195),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  379  RSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
            R WSPE+W  +K+DIL  SI+SR RAHDII +MLASLGDPYTRFLS ++
Sbjct  4    RPWSPELWMQRKQDILQGSIKSRSRAHDIITKMLASLGDPYTRFLSSSD  52


 Score = 44.7 bits (104),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  570  FSKMARYDMTGIGINLREVPGDN  638
            FSKM++YDMTGIG+N+RE+P DN
Sbjct  53   FSKMSKYDMTGIGLNIREIPDDN  75



>ref|XP_001775798.1| predicted protein [Physcomitrella patens]
 gb|EDQ59337.1| predicted protein [Physcomitrella patens]
Length=384

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = +1

Query  310  VSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASL  489
            V NE ++ E WQ+VN++FL+    SWS + W  KK+++L   I+SR  A+  IR MLASL
Sbjct  8    VPNESVIQEAWQVVNENFLDARHNSWSADAWLKKKQEVLKNPIRSRMAAYGSIRNMLASL  67

Query  490  GDPYTRFLSPAECF----YSMAYITTITSESSP  576
             DP+TRFL+P +      Y +  I     ES+P
Sbjct  68   DDPFTRFLTPEQFLQLSKYDVTGIGLNIGESAP  100



>ref|XP_001760142.1| predicted protein [Physcomitrella patens]
 gb|EDQ74898.1| predicted protein, partial [Physcomitrella patens]
Length=364

 Score = 76.3 bits (186),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  310  VSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASL  489
            V+NE IV EVWQ+VN++FL+    +W+ + W+ KK+  L   IQSR  A+  IR ML+SL
Sbjct  1    VTNESIVEEVWQVVNENFLDARHNAWTADDWQKKKQSALKNPIQSRMAAYRAIRTMLSSL  60

Query  490  GDPYTRFLS  516
             D YTRFL+
Sbjct  61   DDRYTRFLT  69


 Score = 30.0 bits (66),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  561  L*KFSKMARYDMTGIGINLRE  623
            L +FS++++YD+TGIG+N+ E
Sbjct  70   LDQFSQLSKYDVTGIGLNIGE  90



>ref|XP_002994603.1| hypothetical protein SELMODRAFT_432513 [Selaginella moellendorffii]
 gb|EFJ04331.1| hypothetical protein SELMODRAFT_432513 [Selaginella moellendorffii]
Length=434

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 10/120 (8%)
 Frame = +1

Query  211  LSAVALVQTNEEQQLDCREDEQELSAAPAEPEV-----VSNEGIVAEVWQIVNDSFLNTS  375
            L+A A+V+++       RED    S A   P+      V++E +V   W++VND +L+  
Sbjct  41   LAAPAVVESSS-----VREDCASSSLAGGIPDASSSLEVTDESLVESAWELVNDFYLDAR  95

Query  376  RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMAYITT  555
               WSP++W ++KE +     Q+R  A+  IR MLA+L DP+TRFL+P E   +  Y  T
Sbjct  96   HHKWSPDLWLAQKEKVFQRPFQNRKAAYSAIREMLATLDDPFTRFLTPDEFSQTSKYDIT  155



>ref|XP_002968066.1| hypothetical protein SELMODRAFT_33876, partial [Selaginella moellendorffii]
 gb|EFJ30320.1| hypothetical protein SELMODRAFT_33876, partial [Selaginella moellendorffii]
Length=343

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  310  VSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASL  489
            V++E +V   W++VND +L+     WSP++W ++KE +     Q+R  A+  IR MLA+L
Sbjct  1    VTDESLVESAWELVNDFYLDARHHKWSPDLWLAQKEKVFQRPFQNRKAAYSAIREMLATL  60

Query  490  GDPYTRFLSPAECFYSMAYITT  555
             DP+TRFL+P E   +  Y  T
Sbjct  61   DDPFTRFLTPDEFSQTSKYDIT  82



>ref|WP_038544790.1| peptidase S41 [Synechococcus sp. KORDI-100]
 gb|AII43515.1| peptidase S41 [Synechococcus sp. KORDI-100]
Length=450

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   FL++S  S+SP+ W+  + D+L+ S      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDFLDSSG-SYSPDRWKQLRRDLLAQSYSGTGESYEAIRGMLASLKDPYT  111

Query  505  RFLSPAE  525
            RFL P E
Sbjct  112  RFLDPKE  118



>ref|WP_011130154.1| peptidase S41 [Prochlorococcus marinus]
 emb|CAE20951.1| carboxyl-terminal processing protease [Prochlorococcus marinus 
str. MIT 9313]
Length=453

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++ + ++PE+W+  ++D+L+ +  +   +++ IR MLASL DPYT
Sbjct  54   VIDQVWQIVYRDYLDSTGK-YNPEVWKGLRKDLLAKNYSATSESYEAIRGMLASLDDPYT  112

Query  505  RFLSPAE  525
            RFL P E
Sbjct  113  RFLDPKE  119



>ref|WP_009543121.1| MULTISPECIES: peptidase S41 [Cyanothece]
Length=461

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  280  LSAAPAEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            +++AP +PEV+ +  + IV E+WQIVN+ F+N   R ++   W++K+ ++LS   +S  +
Sbjct  32   VNSAP-QPEVLEDNPKAIVDEMWQIVNNEFVN---RDFNRVDWQAKRRELLSQDYESPKQ  87

Query  454  AHDIIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            A+  IR  L  LGDPYTRFL P E        + +TS+++    G+
Sbjct  88   AYKAIREALEDLGDPYTRFLPPNE-------FSVLTSQTTGELSGI  126



>gb|ACB49432.1| carboxyl-terminal protease [Cyanothece sp. ATCC 51142]
Length=478

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 13/106 (12%)
 Frame = +1

Query  280  LSAAPAEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            +++AP +PEV+ +  + IV E+WQIVN+ F+N   R ++   W++K+ ++LS   +S  +
Sbjct  49   VNSAP-QPEVLEDNPKAIVDEMWQIVNNEFVN---RDFNRVDWQAKRRELLSQDYESPKQ  104

Query  454  AHDIIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            A+  IR  L  LGDPYTRFL P E        + +TS+++    G+
Sbjct  105  AYKAIREALEDLGDPYTRFLPPNE-------FSVLTSQTTGELSGI  143



>ref|WP_012594914.1| MULTISPECIES: peptidase S41 [Cyanothece]
 gb|ACK65641.1| carboxyl-terminal protease [Cyanothece sp. PCC 8801]
 gb|ACV00522.1| carboxyl-terminal protease [Cyanothece sp. PCC 8802]
Length=458

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 12/100 (12%)
 Frame = +1

Query  298  EPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIR  471
            EPEV+ +  + I+ E+WQIVN+ F++   R ++   W  K++++L     S  +A+  I 
Sbjct  37   EPEVLEDNPKAIIDEMWQIVNNEFVD---RKFNRVDWLEKRQELLGQEYSSNKQAYKAIN  93

Query  472  RMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            + L  LGDPYTRFL+P +         T+TS++S    G+
Sbjct  94   KALKDLGDPYTRFLAPDD-------FATLTSQTSGELSGI  126



>ref|WP_011933379.1| peptidase S41 [Synechococcus sp. WH 7803]
 emb|CAK23902.1| Carboxyl-terminal processing protease [Synechococcus sp. WH 7803]
Length=450

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++ + +SPE W S + D+L+ S      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDYLDSTGQ-YSPERWTSLRRDLLNKSYAGTDESYEAIRGMLASLDDPYT  111

Query  505  RFLSPAECFYSM  540
            RFL P E F  M
Sbjct  112  RFLDPKE-FKQM  122



>ref|WP_008276666.1| peptidase S41 [Cyanothece sp. CCY0110]
 gb|EAZ90243.1| carboxyl-terminal protease [Cyanothece sp. CCY0110]
Length=461

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = +1

Query  280  LSAAPAEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            + +AP +PEV+ +  + IV E+WQIVN+ F+N   R ++   W+ K+ ++LS    S  +
Sbjct  32   VKSAP-QPEVLEDNPKAIVDEMWQIVNNEFVN---RDFNRVDWQEKRRELLSEDYDSPKQ  87

Query  454  AHDIIRRMLASLGDPYTRFLSPAE  525
            A+  IR  L  LGDPYTRFL P E
Sbjct  88   AYKAIREALEDLGDPYTRFLPPNE  111



>ref|WP_018396182.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=449

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = +1

Query  292  PAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            PAE  +  N + IV E+WQIVN  F++T+   +    W + +ED+LS    S  +A+  I
Sbjct  44   PAETRLEDNPKVIVDEMWQIVNREFVHTT---FDAAEWLTIREDLLSRQYTSPDQAYSAI  100

Query  469  RRMLASLGDPYTRFLSPAE  525
            RR L SLGDPYTRFL+P +
Sbjct  101  RRALRSLGDPYTRFLTPKQ  119



>gb|EHJ10582.1| carboxyl-terminal protease [Crocosphaera watsonii WH 0003]
 emb|CCQ66903.1| carboxyl-terminal protease [Crocosphaera watsonii WH 0402]
Length=283

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = +1

Query  280  LSAAPAEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            +++AP EPEV+ N  + IV E+WQIVN+ F+N      +   W+ K+ ++LS    S  +
Sbjct  25   VNSAP-EPEVLENNPKAIVDEIWQIVNNEFVNPDFNRVN---WQEKRRELLSQDYDSPKQ  80

Query  454  AHDIIRRMLASLGDPYTRFLSPAE  525
            A+  IR  L  L DPYTRFL P E
Sbjct  81   AYKAIREALEDLSDPYTRFLPPNE  104



>ref|WP_012598012.1| peptidase S41 [Cyanothece sp. PCC 7424]
 gb|ACK69065.1| carboxyl-terminal protease [Cyanothece sp. PCC 7424]
Length=440

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + ++ EVWQI+N+ F++   R ++   W  K++++L+ +  +R +A+  IR  L  LG
Sbjct  45   SPKALIDEVWQIINNEFVD---RDFNNTDWIKKRQELLNGNYSNRKQAYKAIREALKELG  101

Query  493  DPYTRFLSPAE  525
            DPYTRFLSP E
Sbjct  102  DPYTRFLSPEE  112



>gb|KGG30018.1| Carboxyl-terminal protease [Prochlorococcus sp. MIT 0702]
 gb|KGG31000.1| Carboxyl-terminal protease [Prochlorococcus sp. MIT 0703]
Length=462

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++ + ++PE W+  ++D+L+ +  +   +++ IR MLASL DPYT
Sbjct  63   VIDQVWQIVYRDYLDSTGK-YNPEAWKVLRKDLLAKNYSATSESYEAIRGMLASLDDPYT  121

Query  505  RFLSPAE  525
            RFL P E
Sbjct  122  RFLDPKE  128



>ref|WP_041619883.1| peptidase S41 [Stanieria cyanosphaera]
Length=429

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN+ F++   R ++   W+ +++++L  +   R +A+  IR  L +LGDPYT
Sbjct  40   VVDEVWQIVNNEFVD---REFNHIDWQKQRQELLKKTYGDRKQAYQAIRGSLKTLGDPYT  96

Query  505  RFLSPAE  525
            RFL PAE
Sbjct  97   RFLDPAE  103



>ref|WP_036915712.1| MULTISPECIES: peptidase S41 [Prochlorococcus]
 gb|KGG24674.1| Carboxyl-terminal protease [Prochlorococcus sp. MIT 0701]
Length=453

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++ + ++PE W+  ++D+L+ +  +   +++ IR MLASL DPYT
Sbjct  54   VIDQVWQIVYRDYLDSTGK-YNPEAWKVLRKDLLAKNYSATSESYEAIRGMLASLDDPYT  112

Query  505  RFLSPAE  525
            RFL P E
Sbjct  113  RFLDPKE  119



>gb|AFZ35247.1| carboxyl-terminal protease [Stanieria cyanosphaera PCC 7437]
Length=454

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN+ F++   R ++   W+ +++++L  +   R +A+  IR  L +LGDPYT
Sbjct  65   VVDEVWQIVNNEFVD---REFNHIDWQKQRQELLKKTYGDRKQAYQAIRGSLKTLGDPYT  121

Query  505  RFLSPAE  525
            RFL PAE
Sbjct  122  RFLDPAE  128



>ref|WP_026079927.1| peptidase S41 [Spirulina subsalsa]
Length=447

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ EVWQIVN+ F+    R++    W+ K++++LS    S+  A+  IR+ L  LGDPYT
Sbjct  46   VIDEVWQIVNNEFVG---RNFDQAAWQRKRQELLSRDYSSQGEAYKAIRQALRDLGDPYT  102

Query  505  RFLSPAE  525
            RFL P E
Sbjct  103  RFLDPKE  109



>ref|WP_011826078.1| peptidase S41 [Prochlorococcus marinus]
 gb|ABM78181.1| carboxyl-terminal processing protease [Prochlorococcus marinus 
str. MIT 9303]
Length=453

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++ + ++PE W+  ++D+L+ +  +   +++ IR MLASL DPYT
Sbjct  54   VIDQVWQIVYRDYLDSTGQ-YNPEDWKGLRKDLLAKNYSATSESYEAIRGMLASLDDPYT  112

Query  505  RFLSPAE  525
            RFL P E
Sbjct  113  RFLDPKE  119



>ref|WP_028952101.1| peptidase S41 [Synechococcus sp. CC9616]
Length=450

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   FL++S  S+SP+ W+  +  +L+ S      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDFLDSSV-SYSPDRWKQLRRQLLAKSYSGTGESYEAIRGMLASLKDPYT  111

Query  505  RFLSPAE  525
            RFL P E
Sbjct  112  RFLDPKE  118



>ref|XP_009406285.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=452

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIW---RSKKEDIL  426
            CRED+ E+++    PE ++NEG+V E W++VN+SFL +   RSWSPE W   +  K D+ 
Sbjct  102  CREDDGEMASTDVLPESITNEGLVEEAWEVVNESFLPDAGGRSWSPEKWMFSKMAKYDVT  161

Query  427  STSIQSR  447
               I  R
Sbjct  162  GIGINLR  168



>ref|WP_021833211.1| carboxyl-terminal protease [Crocosphaera watsonii]
 emb|CCQ60941.1| carboxyl-terminal protease [Crocosphaera watsonii WH 0401]
 emb|CCQ56509.1| carboxyl-terminal protease [Crocosphaera watsonii WH 0005]
Length=454

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = +1

Query  280  LSAAPAEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            +++AP EPEV+ N  + IV E+WQIVN+ F+N      +   W+ K+ ++LS    S  +
Sbjct  25   VNSAP-EPEVLENNPKAIVDEIWQIVNNEFVNPDFNRVN---WQEKRRELLSQDYDSPKQ  80

Query  454  AHDIIRRMLASLGDPYTRFLSPAE  525
            A+  IR  L  L DPYTRFL P E
Sbjct  81   AYKAIREALEDLSDPYTRFLPPNE  104



>ref|WP_006909374.1| peptidase S41 [Cyanobium sp. PCC 7001]
 gb|EDY37472.1| carboxyl-terminal-processing protease [Cyanobium sp. PCC 7001]
Length=448

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ + WQIV   +L+ + + ++PE WR  + D+L+ S  +   A++ IR MLA+L DPYT
Sbjct  44   VIDQTWQIVFRDYLDINGK-YTPEQWRQLRRDVLAKSYGTPKEAYEAIRGMLATLDDPYT  102

Query  505  RFLSPAE  525
            RFL P E
Sbjct  103  RFLDPRE  109



>ref|WP_007308102.1| peptidase S41 [Crocosphaera watsonii]
 gb|EAM48088.1| Peptidase S41A, C-terminal protease [Crocosphaera watsonii WH 
8501]
Length=461

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = +1

Query  280  LSAAPAEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            +++AP EPEV+ N  + IV E+WQIVN+ F+N      +   W+ K+ ++LS    S  +
Sbjct  32   VNSAP-EPEVLENNPKAIVDEIWQIVNNEFVNPDFNRVN---WQEKRRELLSQDYDSPKQ  87

Query  454  AHDIIRRMLASLGDPYTRFLSPAE  525
            A+  IR  L  L DPYTRFL P E
Sbjct  88   AYKAIREALEDLSDPYTRFLPPNE  111



>ref|WP_021830269.1| carboxyl-terminal protease [Crocosphaera watsonii]
 emb|CCQ50682.1| carboxyl-terminal protease [Crocosphaera watsonii WH 8502]
Length=461

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = +1

Query  280  LSAAPAEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            +++AP EPEV+ N  + IV E+WQIVN+ F+N      +   W+ K+ ++LS    S  +
Sbjct  32   VNSAP-EPEVLENNPKAIVDEIWQIVNNEFVNPDFNRVN---WQEKRRELLSQDYDSPKQ  87

Query  454  AHDIIRRMLASLGDPYTRFLSPAE  525
            A+  IR  L  L DPYTRFL P E
Sbjct  88   AYKAIREALEDLSDPYTRFLPPNE  111



>ref|WP_036486247.1| peptidase S41 [Myxosarcina sp. GI1]
Length=442

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 10/89 (11%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN+ F++   R ++   WR +++++L  +      A+  IR  L SLGDPYT
Sbjct  54   VVDEVWQIVNNEFVD---RGFNRVDWRQQRQELLRKNYTDNAEAYQAIRHSLKSLGDPYT  110

Query  505  RFLSPAECFYSMAYITTITSESSPRWRGM  591
            RFL P E          +TS++S    G+
Sbjct  111  RFLDPDE-------FEQLTSQTSGELSGV  132



>ref|WP_019506254.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=446

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 11/96 (11%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            I+ EVWQIVN  F++   R ++   W+ K++++L      +  A+  IRR L  LGDPYT
Sbjct  56   IIDEVWQIVNSEFVD---REFNHIDWKIKRQELLRAEYTDQKTAYKAIRRSLKDLGDPYT  112

Query  505  RFLSPAECFYSMAYITTITSESSPRWRGM-I*LGLE  609
            RFL+P E          +TS++S    G+ I LG++
Sbjct  113  RFLAPEEY-------EELTSQTSGELSGIGIRLGID  141



>ref|WP_036483670.1| peptidase S41 [Myxosarcina sp. GI1]
Length=430

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQI+N  +++TS   ++ + W   +++ L  + Q + +A+  IR MLA LGDPYT
Sbjct  43   LVDEVWQIINYQYVDTS---FNDKDWVKVRQEYLEKNYQDKEQAYQAIRDMLAQLGDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+ P E F +M
Sbjct  100  RFMDPEE-FKNM  110



>ref|WP_010309391.1| peptidase S41 [Synechococcus sp. CB0101]
Length=447

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ + WQIV   +L+ + + ++PE WRS +  +LS +  S   +++ IR MLASL DPYT
Sbjct  42   VIDQTWQIVFRDYLDINGK-YTPEKWRSLRRQVLSKTYGSSKESYEAIRGMLASLDDPYT  100

Query  505  RFLSPAE  525
            RF+ P E
Sbjct  101  RFMDPRE  107



>ref|XP_002506449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67707.1| predicted protein [Micromonas sp. RCC299]
Length=444

 Score = 56.2 bits (134),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNT-SRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPY  501
            IV EVW++V+D+FL   S   +    W   +ED + +    R  A+D IR +L +LGDP+
Sbjct  81   IVEEVWKVVDDNFLPARSVDGFDRAAWAKLREDFVRSPPADRDEAYDTIRSILRTLGDPF  140

Query  502  TRFLSPAECFYSMAY  546
            +RF+ P++    + Y
Sbjct  141  SRFVEPSDFAPLLKY  155


 Score = 28.1 bits (61),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  570  FSKMARYDMTGIGINLREVPGDN  638
            F+ + +YD++G+G+N+ E P D+
Sbjct  149  FAPLLKYDISGVGMNVAEDPDDS  171



>ref|WP_013321822.1| peptidase S41 [Cyanothece sp. PCC 7822]
 gb|ADN13715.1| carboxyl-terminal protease [Cyanothece sp. PCC 7822]
Length=441

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +1

Query  319  EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDP  498
            + ++ EVWQIVN+ F++   R+++   W  K++++LS +  ++ +A+  IR+ L  +GDP
Sbjct  48   KALIDEVWQIVNNEFVD---RNFNNVDWLQKRQELLSGTYTNKKQAYIAIRKALKDVGDP  104

Query  499  YTRFLSPAE  525
            YTRFL P E
Sbjct  105  YTRFLEPEE  113



>ref|WP_015117245.1| C-terminal processing peptidase-2 [Rivularia sp. PCC 7116]
 gb|AFY53667.1| C-terminal processing peptidase-2 [Rivularia sp. PCC 7116]
Length=442

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 54/89 (61%), Gaps = 11/89 (12%)
 Frame = +1

Query  259  CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI  438
            CRE +  L  +P        + IV +VWQ+VN  +++ S   ++ + W++ ++ +LS + 
Sbjct  34   CREVKAALQDSP--------KAIVDQVWQLVNREYVDGS---FNNQNWQTARKTLLSKNY  82

Query  439  QSRPRAHDIIRRMLASLGDPYTRFLSPAE  525
             SR +A+  +R+ L  LGDPYTRF++P E
Sbjct  83   TSREQAYTAVRQALKRLGDPYTRFMNPRE  111



>ref|XP_007511360.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17481.1| predicted protein [Bathycoccus prasinos]
Length=612

 Score = 55.5 bits (132),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 46/71 (65%), Gaps = 4/71 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFL---NTSRRSWSPEIWRS-KKEDILSTSIQSRPRAHDIIRRMLASLG  492
            +V EVWQ+V+D+FL   N     +  E W + ++E ++    +SR  A++ +R ML++L 
Sbjct  203  VVDEVWQLVSDTFLPVRNDISVGFDREAWNALREESVVKNPPKSRQEAYEYVRGMLSTLN  262

Query  493  DPYTRFLSPAE  525
            DP+TRF++P +
Sbjct  263  DPFTRFVAPKD  273


 Score = 28.5 bits (62),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  570  FSKMARYDMTGIGINLREVP  629
            F ++ +YD++G+G+N+ E+P
Sbjct  274  FQELLKYDISGVGLNIAEMP  293



>gb|EAU73900.1| carboxyl-terminal processing protease [Synechococcus sp. RS9916]
Length=436

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++ + + P+ WR+ + ++L+ +      +++ IR MLASL DPYT
Sbjct  37   VIDQVWQIVYRDYLDSTGK-YDPQQWRTLRRNLLTKAYAGSEESYEAIRGMLASLDDPYT  95

Query  505  RFLSPAECFYSM  540
            RFL P E F  M
Sbjct  96   RFLDPKE-FKDM  106



>ref|WP_038023249.1| peptidase S41 [Synechococcus sp. RS9916]
Length=450

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++ + + P+ WR+ + ++L+ +      +++ IR MLASL DPYT
Sbjct  51   VIDQVWQIVYRDYLDSTGK-YDPQQWRTLRRNLLTKAYAGSEESYEAIRGMLASLDDPYT  109

Query  505  RFLSPAECFYSM  540
            RFL P E F  M
Sbjct  110  RFLDPKE-FKDM  120



>ref|WP_015194200.1| carboxyl-terminal protease [Stanieria cyanosphaera]
 gb|AFZ36534.1| carboxyl-terminal protease [Stanieria cyanosphaera PCC 7437]
Length=430

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ EVWQI+N  +++TS   ++ + W++ +++ L  S +++  A+  IR ML  LGDPYT
Sbjct  43   LIDEVWQIINYQYVDTS---FNAQDWQAVRQEYLGKSYKTQEDAYKAIREMLEKLGDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+ P E F +M
Sbjct  100  RFMDPEE-FKNM  110



>ref|WP_006041652.1| peptidase S41 [Synechococcus sp. WH 7805]
 gb|EAR17961.1| carboxyl-terminal processing protease [Synechococcus sp. WH 7805]
Length=450

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++  ++SPE W   + D+L+ +      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDYLDSTG-NYSPERWTRLRRDLLTKNYAGTDESYEAIRGMLASLDDPYT  111

Query  505  RFLSPAECFYSM  540
            RFL P E F  M
Sbjct  112  RFLDPKE-FKQM  122



>ref|WP_041487826.1| peptidase S41, partial [Candidatus Atelocyanobacterium thalassa]
Length=421

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 54/91 (59%), Gaps = 10/91 (11%)
 Frame = +1

Query  319  EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDP  498
            + ++ E+WQIVN+ F++      +   W+ K++++LS   ++  +A+ II   L  LGDP
Sbjct  43   KAVIDEIWQIVNNEFVDLEFNRIN---WKEKRQELLSQKYKNSKQAYKIISEALKKLGDP  99

Query  499  YTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            YTRFL P E  +SM     +TS++S    G+
Sbjct  100  YTRFLPPQE--FSM-----LTSQTSGELSGI  123



>gb|ADB95188.1| C-terminal processing peptidase-2 [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=435

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 54/91 (59%), Gaps = 10/91 (11%)
 Frame = +1

Query  319  EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDP  498
            + ++ E+WQIVN+ F++      +   W+ K++++LS   ++  +A+ II   L  LGDP
Sbjct  43   KAVIDEIWQIVNNEFVDLEFNRIN---WKEKRQELLSQKYKNSKQAYKIISEALKKLGDP  99

Query  499  YTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            YTRFL P E  +SM     +TS++S    G+
Sbjct  100  YTRFLPPQE--FSM-----LTSQTSGELSGI  123



>ref|WP_017294436.1| hypothetical protein [Geminocystis herdmanii]
Length=430

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V E+WQI+N+ F++   R+++   W+ K+E++LS +  +R +A+  I + L  LGDPYT
Sbjct  43   VVDEMWQIINNEFVD---RNFNQVNWQKKREELLSKNYSNRTQAYRAINQALKELGDPYT  99

Query  505  RFLSP  519
            RFL P
Sbjct  100  RFLPP  104



>ref|WP_006170377.1| peptidase S41 [Synechococcus sp. WH 5701]
 gb|EAQ75042.1| carboxyl-terminal processing protease [Synechococcus sp. WH 5701]
Length=448

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ + WQIV   +L+T+ + ++P+ WR  + D+L+ S  S   +++ IR ML +L DPYT
Sbjct  44   VMDQAWQIVFRDYLDTTGK-YTPDQWRKLRRDLLAKSYGSTKESYEAIRGMLGTLDDPYT  102

Query  505  RFLSPAE  525
            RF+ P E
Sbjct  103  RFMDPRE  109



>ref|WP_038555034.1| peptidase S41 [Synechococcus sp. KORDI-52]
 gb|AII49484.1| peptidase S41 [Synechococcus sp. KORDI-52]
Length=449

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++  +++   WR  + D+LS S      ++++IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDYLDSTG-TYNESAWRRLRGDLLSKSYGGTSESYEVIRGMLASLDDPYT  111

Query  505  RFLSPAE  525
            RFL P +
Sbjct  112  RFLDPKQ  118



>ref|WP_043705489.1| peptidase S41, partial [Synechococcus sp. CB0205]
Length=415

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +1

Query  280  LSAAPAEPEVVSNEG--IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            L+AAPA   +  N+G  +V E W++VN S+++  R  +    W+  ++  L  SIQS   
Sbjct  32   LTAAPA---LALNDGQQLVVESWRLVNQSYVDPDR--FDTIHWKRLRQKALERSIQSSAD  86

Query  454  AHDIIRRMLASLGDPYTRFLSPAE  525
            A+D I  MLA +GDPYTR L PA+
Sbjct  87   AYDAIEAMLAPIGDPYTRLLRPAD  110



>ref|WP_011935880.1| peptidase S41 [Synechococcus sp. RCC307]
 emb|CAK28366.1| Carboxyl-terminal processing protease [Synechococcus sp. RCC307]
Length=446

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ E WQIV   +L+T+  ++S E W++ + D+LS S  +   A++ IR ML +L DPYT
Sbjct  47   VMDEAWQIVFRDYLDTTG-NYSEEKWKTLRRDLLSKSYGNTKDAYEAIRGMLGTLDDPYT  105

Query  505  RFLSPAE  525
            RF+ P E
Sbjct  106  RFMDPRE  112



>emb|CCI26542.1| Carboxyl-terminal-processing protease [Microcystis aeruginosa 
PCC 9809]
Length=455

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 60/103 (58%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P+E        + +TS++S    G+
Sbjct  105  AIREALKELGDTYTRFLTPSE-------FSVLTSQTSGELSGI  140



>dbj|GAL93713.1| carboxyl-terminal protease [Microcystis aeruginosa NIES-44]
Length=455

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 60/103 (58%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P+E        + +TS++S    G+
Sbjct  105  AIREALKELGDTYTRFLTPSE-------FSVLTSQTSGELSGI  140



>ref|WP_015206408.1| C-terminal processing peptidase-2 [Cylindrospermum stagnale]
 gb|AFZ23152.1| C-terminal processing peptidase-2 [Cylindrospermum stagnale PCC 
7417]
Length=414

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  292  PAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIR  471
            P    +  ++ +V+EVW+IVN S+L+    S++ + W + ++  LS  +Q+   A++ I+
Sbjct  28   PPAAALTDDQKLVSEVWRIVNRSYLD---ESFNHQNWAAVRQQTLSKPLQNHQAAYEAIQ  84

Query  472  RMLASLGDPYTRFLSP  519
            RML SL DP+TRFL P
Sbjct  85   RMLKSLDDPFTRFLDP  100



>ref|WP_044034600.1| peptidase S41 [Microcystis aeruginosa]
Length=441

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 60/103 (58%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P+E        + +TS++S    G+
Sbjct  91   AIREALKELGDTYTRFLTPSE-------FSVLTSQTSGELSGI  126



>ref|WP_010872128.1| peptidase S41 [Synechocystis sp. PCC 6803]
 ref|NP_440818.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAA17498.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAK49672.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAL28671.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31840.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL35009.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM51230.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 gb|AGF51187.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
Length=423

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN ++++ +   ++ E W + ++D L+   +++  A+  IR ML  L DPYT
Sbjct  43   LVDEVWQIVNRTYVDGT---FNGEDWVAVRQDYLTRDYKNQEEAYTAIREMLEKLNDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+SP E F SM
Sbjct  100  RFMSPDE-FQSM  110



>ref|WP_017662089.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=408

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ EVWQI+N ++++ +   ++   WR+ + D L+ S  S+  A+D IR ML  L DPYT
Sbjct  27   LIDEVWQIINKNYVDAT---FNQVDWRAVRNDYLNRSYTSQEEAYDAIREMLEQLEDPYT  83

Query  505  RFLSPAECFYSM  540
            RF+ P E F SM
Sbjct  84   RFMDPDE-FRSM  94



>ref|WP_015224006.1| C-terminal processing peptidase-2 [Cyanobacterium stanieri]
 gb|AFZ48693.1| C-terminal processing peptidase-2 [Cyanobacterium stanieri PCC 
7202]
Length=424

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            IV EVWQ++N  +++ +   ++ + WRS + + L     S+  A++ +R ML +L DPYT
Sbjct  43   IVDEVWQVINSRYVDAT---FNGQDWRSIRNEFLEREYASKEEAYEAVREMLKTLDDPYT  99

Query  505  RFLSPAECFYSM  540
            RF++P E F SM
Sbjct  100  RFMNPEE-FRSM  110



>ref|WP_015108330.1| C-terminal processing peptidase [Cyanobium gracile]
 gb|AFY27876.1| C-terminal processing peptidase [Cyanobium gracile PCC 6307]
Length=443

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ + WQIV   +L+T+ + ++PE WR  +  +LS S  +   A++ IR ML++L DPYT
Sbjct  44   VMDQAWQIVFRDYLDTTGK-YTPEQWRKLRRSVLSKSYSTPKDAYEGIRGMLSTLDDPYT  102

Query  505  RFLSPAE  525
            RFL P E
Sbjct  103  RFLDPRE  109



>ref|WP_011364272.1| peptidase S41 [Synechococcus sp. CC9605]
 gb|ABB35053.1| carboxyl-terminal protease [Synechococcus sp. CC9605]
Length=449

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+ S  S+    WR  + ++LS S      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDYLD-STGSYDEATWRQLRSNLLSKSYGGSAESYEAIRGMLASLDDPYT  111

Query  505  RFLSPAE  525
            RFL P E
Sbjct  112  RFLDPKE  118



>ref|WP_030006393.1| peptidase S41 [Synechococcus sp. NKBG042902]
Length=461

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + IV E+WQIV   +  +  +++ PE W   +ED+LS +  +   A+  IR  L SLG
Sbjct  61   SPKAIVDEMWQIV---YTESVAKNFEPESWLKLREDLLSQNYDTYDTAYRQIRGALRSLG  117

Query  493  DPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            DPYTRFL P E         T+TS+++    G+
Sbjct  118  DPYTRFLDPEE-------FETLTSQTTGELSGI  143



>ref|WP_029983998.1| peptidase S41, partial [Prochlorococcus sp. scB245a_521N3]
Length=147

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  27   AEATVLNNSYKDVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  85

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  86   RDMLSNLDDSYTRFLEPKE  104



>emb|CCI36833.1| Similar to Q4BW15_CROWT Peptidase S41A [Microcystis aeruginosa 
PCC 9701]
Length=455

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E        + +TS++S    G+
Sbjct  105  AIREALKELGDTYTRFLTPRE-------FSVLTSQTSGELSGI  140



>ref|WP_007100043.1| peptidase S41 [Synechococcus sp. RS9917]
 gb|EAQ67866.1| carboxyl-terminal processing protease [Synechococcus sp. RS9917]
Length=451

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++   ++PE W+S + ++L+        +++ IR MLASL DPYT
Sbjct  54   VIDQVWQIVYRDYLDSTGE-YNPERWQSLRRNLLAKPYNGTEESYEAIRGMLASLDDPYT  112

Query  505  RFLSPAE  525
            RFL P E
Sbjct  113  RFLDPKE  119



>ref|WP_015219152.1| C-terminal processing peptidase-2 [Cyanobacterium aponinum]
 gb|AFZ53423.1| C-terminal processing peptidase-2 [Cyanobacterium aponinum PCC 
10605]
Length=437

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 52/89 (58%), Gaps = 10/89 (11%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQI+N  F++   R+++   W  K+E++L  +  S+ +A+  I + L  LGDPYT
Sbjct  48   VVDEVWQIINHEFVD---RNFNRIDWIKKREELLEKNYSSKKQAYRAINQALKELGDPYT  104

Query  505  RFLSPAECFYSMAYITTITSESSPRWRGM  591
            RFL P +         T+TS++S    G+
Sbjct  105  RFLPPEQ-------FETLTSQTSGEVSGV  126



>ref|WP_015956958.1| peptidase S41 [Cyanothece sp. PCC 7424]
 gb|ACK73378.1| carboxyl-terminal protease [Cyanothece sp. PCC 7424]
Length=429

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQI+N ++++ +   ++   W+  + D L+ S + +  A++ IR ML  LGDPYT
Sbjct  43   LVDEVWQIINRTYVDAT---FNQVDWQKVRNDYLNRSYKDKEEAYEAIREMLKQLGDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+ P E F +M
Sbjct  100  RFMDPDE-FRNM  110



>ref|WP_006853028.1| peptidase S41 [Synechococcus sp. WH 8016]
 gb|EHA63845.1| carboxyl-terminal protease [Synechococcus sp. WH 8016]
Length=450

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   FL++S   +  + W   ++D+LS S      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDFLDSSG-GYDLDQWSILRKDLLSKSYAGTAESYEAIRGMLASLDDPYT  111

Query  505  RFLSPAE  525
            RFL P E
Sbjct  112  RFLDPKE  118



>emb|CCH97909.1| Carboxyl-terminal-processing protease [Microcystis aeruginosa 
PCC 9717]
Length=455

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E        + +TS++S    G+
Sbjct  105  AIREALKELGDTYTRFLTPRE-------FSVLTSQTSGELSGI  140



>ref|WP_026086846.1| carboxyl-terminal protease [Fischerella muscicola]
Length=415

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V+EVW+IVN ++L+ +   ++ + W + ++ ILSTS+  +  A+  I++ML SL DP+T
Sbjct  39   LVSEVWRIVNRTYLDDT---FNHQNWAAVRQKILSTSLSDQKSAYTAIQKMLKSLNDPFT  95

Query  505  RFLSP  519
            RFL P
Sbjct  96   RFLDP  100



>ref|WP_038027478.1| peptidase S41 [Synechococcus sp. PCC 7336]
Length=417

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 62/111 (56%), Gaps = 13/111 (12%)
 Frame = +1

Query  208  RLSAVALVQTNEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSW  387
            +L+A+A+V +    Q+       EL ++P E        IV EVWQ+VN  F++T    +
Sbjct  5    KLAAIAIVTSLLSMQM-ASPSWAELRSSPKE--------IVDEVWQLVNREFVDTG---Y  52

Query  388  SPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSM  540
            + + W  ++ ++L+    +   A+D IR +L +L DP+TRFL P + F SM
Sbjct  53   NGQDWLQQRAELLAREYVTDEDAYDTIRDLLGTLDDPFTRFLDP-DAFASM  102



>ref|WP_043997972.1| peptidase S41 [Microcystis aeruginosa]
Length=441

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E        + +TS++S    G+
Sbjct  91   AIREALKELGDTYTRFLTPRE-------FSVLTSQTSGELSGI  126



>ref|WP_011619593.1| peptidase S41 [Synechococcus sp. CC9311]
 gb|ABI46623.1| C-terminal processing peptidase [Synechococcus sp. CC9311]
Length=450

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   FL++S   +  + W   ++D+LS S      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDFLDSSG-GYDLDQWSILRKDLLSKSYAGTAESYEAIRGMLASLDDPYT  111

Query  505  RFLSPAE  525
            RFL P E
Sbjct  112  RFLDPKE  118



>ref|WP_012267231.1| peptidase S41 [Microcystis aeruginosa]
 dbj|BAG04500.1| periplasmic carboxyl-terminal protease [Microcystis aeruginosa 
NIES-843]
Length=441

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E        + +TS++S    G+
Sbjct  91   AIREALKELGDTYTRFLTPRE-------FSVLTSQTSGELSGI  126



>emb|CCI31838.1| Carboxyl-terminal-processing protease [Microcystis sp. T1-4]
Length=455

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNPQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P+E        + +TS++S    G+
Sbjct  105  AIREALKELGDSYTRFLTPSE-------FSVLTSQTSGELSGI  140



>ref|WP_043999194.1| peptidase S41 [Microcystis aeruginosa]
Length=441

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E        + +TS++S    G+
Sbjct  91   AIREALKELGDTYTRFLTPRE-------FSVLTSQTSGELSGI  126



>ref|WP_028948408.1| peptidase S41 [Synechocystis sp. PCC 6714]
 gb|AIE74233.1| carboxyl-terminal protease [Synechocystis sp. PCC 6714]
Length=462

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + +V EVWQ+VN  F++   + ++   W SK++++L  + + R  A+  I R+L  L 
Sbjct  62   SPKAVVDEVWQLVNQQFVD---KDFNHSNWLSKRQELLGRNYKDRADAYRQIGRLLKDLN  118

Query  493  DPYTRFLSPAE  525
            DPYTRFLSP E
Sbjct  119  DPYTRFLSPEE  129



>emb|CCI13266.1| Carboxyl-terminal-processing protease [Microcystis aeruginosa 
PCC 9806]
Length=455

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNPQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P+E        + +TS++S    G+
Sbjct  105  AIREALKELGDTYTRFLTPSE-------FSVLTSQTSGELSGI  140



>ref|WP_040930335.1| peptidase S41 [Prochloron didemni]
Length=422

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN  F+N     +    W+  + D+L+        A++ IR+ L  LGDPYT
Sbjct  45   VVDEVWQIVNTEFVNPK---FDRAEWQDTRNDLLTRRYSDNKEAYESIRKALKKLGDPYT  101

Query  505  RFLSPAE  525
            RFL+P+E
Sbjct  102  RFLAPSE  108



>ref|WP_040943270.1| peptidase S41 [Prochloron didemni]
Length=422

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN  F+N     +    W+  + D+L+        A++ IR+ L  LGDPYT
Sbjct  45   VVDEVWQIVNTEFVNPK---FDRAEWQDTRNDLLTRRYSDNKEAYESIRKALKKLGDPYT  101

Query  505  RFLSPAE  525
            RFL+P+E
Sbjct  102  RFLAPSE  108



>ref|WP_040939244.1| peptidase S41 [Prochloron didemni]
Length=422

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN  F+N     +    W+  + D+L+        A++ IR+ L  LGDPYT
Sbjct  45   VVDEVWQIVNTEFVNPK---FDRAEWQDTRNDLLTRRYSDNKEAYESIRKALKKLGDPYT  101

Query  505  RFLSPAE  525
            RFL+P+E
Sbjct  102  RFLAPSE  108



>ref|WP_044000024.1| peptidase S41 [Microcystis aeruginosa]
Length=441

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNPQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P+E        + +TS++S    G+
Sbjct  91   AIREALKELGDTYTRFLTPSE-------FSVLTSQTSGELSGI  126



>ref|WP_039899822.1| peptidase S41 [Microcystis sp. T1-4]
Length=441

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNPQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P+E        + +TS++S    G+
Sbjct  91   AIREALKELGDSYTRFLTPSE-------FSVLTSQTSGELSGI  126



>ref|WP_040054219.1| peptidase S41 [Candidatus Atelocyanobacterium thalassa]
 gb|KFF42065.1| C-terminal processing peptidase-2 [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=435

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 54/91 (59%), Gaps = 10/91 (11%)
 Frame = +1

Query  319  EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDP  498
            + ++ E+WQIVN+ F++      +   W+ +++++LS   ++  +A+  I   L  LGDP
Sbjct  43   KAVIDEIWQIVNNEFVDLEFNRIN---WQEERQELLSQKYKNSKQAYKFINESLKKLGDP  99

Query  499  YTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            YTRFLSP E  +SM     +TS++S    G+
Sbjct  100  YTRFLSPQE--FSM-----LTSQTSGELSGI  123



>ref|WP_026722361.1| carboxyl-terminal protease [Fischerella sp. PCC 9431]
Length=415

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V+EVW+IVN ++L+ +   ++ + W + ++ ILSTS+  +  A+  I++ML SL DP+T
Sbjct  39   LVSEVWRIVNRTYLDDT---FNHQNWAAVRQKILSTSLSDQKSAYTAIQKMLKSLDDPFT  95

Query  505  RFLSP  519
            RFL P
Sbjct  96   RFLDP  100



>ref|WP_017310516.1| peptidase S41 [Fischerella sp. PCC 9339]
Length=415

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +++EVW+IVN ++L+ +   ++ + W + ++ ILSTS+  +  A+  I++ML SL DP+T
Sbjct  39   LISEVWRIVNRTYLDDT---FNHQNWAAVRQKILSTSVSDQKSAYTAIQKMLKSLDDPFT  95

Query  505  RFLSP  519
            RFL P
Sbjct  96   RFLDP  100



>ref|WP_012307455.1| peptidase S41 [Synechococcus sp. PCC 7002]
 gb|ACA99832.1| putative carboxyl-terminal protease [Synechococcus sp. PCC 7002]
Length=461

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + IV E+WQIV   +  +  +++ PE W   +ED+LS +  +   A+  IR  L +LG
Sbjct  61   SPKAIVDEMWQIV---YTESVAKNFEPESWLKLREDLLSQNYDTYDTAYRQIRGALRTLG  117

Query  493  DPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            DPYTRFL P E         T+TS+++    G+
Sbjct  118  DPYTRFLDPEE-------FETLTSQTTGELSGI  143



>ref|WP_044449365.1| carboxyl-terminal protease [Mastigocladus laminosus]
 gb|KIY13482.1| carboxyl-terminal protease [Mastigocladus laminosus UU774]
Length=415

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +++EVW+IVN ++L+ +   ++ + W + ++ ILSTS+  +  A+  I++ML SL DP+T
Sbjct  39   LISEVWRIVNRTYLDDT---FNHQNWAAVRQKILSTSVSDQKSAYTAIQKMLKSLDDPFT  95

Query  505  RFLSP  519
            RFL P
Sbjct  96   RFLDP  100



>ref|WP_028948323.1| peptidase S41 [Synechocystis sp. PCC 6714]
 gb|AIE75827.1| carboxyl-terminal protease [Synechocystis sp. PCC 6714]
Length=423

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN ++++ +   ++ E W + ++D L     ++  A+  IR ML  L DPYT
Sbjct  43   LVDEVWQIVNRTYVDGT---FNGEDWVAVRQDYLKRDYSNQEEAYAAIREMLEKLNDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+SP E F SM
Sbjct  100  RFMSPDE-FQSM  110



>ref|WP_038652044.1| peptidase S41 [Prochlorococcus sp. MIT 0801]
 gb|AIQ96871.1| Carboxyl-terminal protease [Prochlorococcus sp. MIT 0801]
Length=434

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            I+ +VWQI+   FL+ S + + PE W   +++ILST       A+  I+ ML  L DPYT
Sbjct  37   IIDQVWQIIYRDFLDYSGK-YKPEDWIKLRKEILSTKYFDNDEAYIAIKDMLTELDDPYT  95

Query  505  RFLSPAECFYSMAYITT  555
            RFL P E F  M   TT
Sbjct  96   RFLDPKE-FNEMRIDTT  111



>emb|CCI02121.1| Carboxyl-terminal-processing protease [Microcystis aeruginosa 
PCC 9443]
Length=455

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNSQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E          +TS++S    G+
Sbjct  105  AIRETLKELGDTYTRFLTPRE-------FAVLTSQTSGELSGI  140



>ref|WP_027842882.1| carboxyl-terminal protease [Mastigocoleus testarum]
Length=414

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V+E W+IVN S+L+    +++ + W S +   L  S   R   +  I +MLASL DP+T
Sbjct  39   LVSEAWRIVNRSYLD---HTFNHQNWASVRRKALHKSFPDREEVYQTIGQMLASLNDPFT  95

Query  505  RFLSPAECFYSMAYITT  555
            RFL+PA+ + SM Y T+
Sbjct  96   RFLNPAQ-YRSMIYNTS  111



>ref|WP_015143772.1| C-terminal processing peptidase [Pleurocapsa minor]
 gb|AFY77469.1| C-terminal processing peptidase [Pleurocapsa sp. PCC 7327]
Length=453

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + +V EVWQ+VN  F++   + ++   W+ K++++LS    +  +A+  I+  L  LG
Sbjct  59   SPKAVVDEVWQLVNSEFVD---KEFNHRDWQKKRQELLSRDYANPKQAYKAIQDALQELG  115

Query  493  DPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            DPYTRFL+P E          +TS++S  + G+
Sbjct  116  DPYTRFLAPDE-------FKMLTSQTSGEFTGV  141



>ref|WP_025940222.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_520M11]
Length=178

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>emb|CCI17240.1| Carboxyl-terminal-processing protease [Microcystis aeruginosa 
PCC 9807]
Length=455

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNSQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E          +TS++S    G+
Sbjct  105  AIREALKELGDTYTRFLTPRE-------FAVLTSQTSGELSGI  140



>ref|WP_011128040.1| peptidase S41 [Synechococcus sp. WH 8102]
 emb|CAE07690.1| carboxyl-terminal processing protease [Synechococcus sp. WH 8102]
Length=445

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++  ++S   WR  ++D+L+ S      +++ IR ML+SL DPYT
Sbjct  51   VIDQVWQIVFRDYLDSTG-AYSDARWRQLRKDLLAKSYAGDEESYEAIRGMLSSLDDPYT  109

Query  505  RFLSPAE  525
            RFL P E
Sbjct  110  RFLDPKE  116



>gb|KJB57305.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=315

 Score = 40.8 bits (94),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 17/17 (100%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +1

Query  475  MLASLGDPYTRFLSPAE  525
            MLASLGDPYTRFLSPAE
Sbjct  1    MLASLGDPYTRFLSPAE  17


 Score = 39.3 bits (90),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  573  SKMARYDMTGIGINLREVPGD  635
            ++MARYD+TGIGIN+REVP D
Sbjct  16   AEMARYDITGIGINIREVPDD  36



>ref|WP_043996280.1| peptidase S41 [Microcystis aeruginosa]
Length=441

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNSQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E          +TS++S    G+
Sbjct  91   AIRETLKELGDTYTRFLTPRE-------FAVLTSQTSGELSGI  126



>gb|ABB26142.1| C-terminal processing peptidase-2. Serine peptidase. MEROPS family 
S41A [Synechococcus sp. CC9902]
Length=444

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L++S   +    WR  + D+L  S      +++ IR MLASL DPYT
Sbjct  68   VIDQVWQIVYRDYLDSSG-DYDESSWRQLRRDLLKKSFAGSAESYEAIRGMLASLNDPYT  126

Query  505  RFLSPAE  525
            RFL P +
Sbjct  127  RFLDPKQ  133



>emb|CAO91281.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCI21352.1| Carboxyl-terminal-processing protease [Microcystis aeruginosa 
PCC 9808]
Length=455

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNPQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E        + +TS++S    G+
Sbjct  105  AIREALKELGDSYTRFLTPRE-------FSVLTSQTSGELSGI  140



>ref|WP_006511473.1| C-terminal processing peptidase [Xenococcus sp. PCC 7305]
 gb|ELS01411.1| C-terminal processing peptidase [Xenococcus sp. PCC 7305]
Length=425

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQI+N  +++T+  + +   W+  +++ L  S   + + +D +R ML  LGDPYT
Sbjct  43   LVDEVWQIINHQYVDTNFNNLN---WQEVRQEYLERSYTDQEQVYDAVREMLEQLGDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+ P E F +M
Sbjct  100  RFMDPEE-FQNM  110



>ref|WP_043995750.1| peptidase S41 [Microcystis aeruginosa]
Length=441

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNSQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E          +TS++S    G+
Sbjct  91   AIREALKELGDTYTRFLTPRE-------FAVLTSQTSGELSGI  126



>ref|WP_010871361.1| peptidase S41 [Synechocystis sp. PCC 6803]
 ref|NP_440051.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 emb|CAA65344.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAA16731.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAK48903.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAL27902.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31072.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34241.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50436.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 gb|AGF50420.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
Length=462

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + +V EVWQ+VN  F++   + ++   W SK++++L  + Q    A+  I R+L  L 
Sbjct  62   SPKAVVDEVWQLVNQQFVD---KDFNHSNWLSKRQELLGRNYQDNAEAYRQIGRILKDLN  118

Query  493  DPYTRFLSPAE  525
            DPYTRFLSP E
Sbjct  119  DPYTRFLSPEE  129



>ref|WP_015218840.1| C-terminal processing peptidase-2 [Cyanobacterium aponinum]
 gb|AFZ53109.1| C-terminal processing peptidase-2 [Cyanobacterium aponinum PCC 
10605]
Length=421

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            IV EVWQ++N  +++ +   ++ E WR  +++ L      +  A++ ++ ML  L DPYT
Sbjct  43   IVDEVWQVINRQYVDAT---FNGEDWRGIRQEYLDKEYSDKEEAYEAVKEMLKKLNDPYT  99

Query  505  RFLSPAECFYSM  540
            RF++P E F SM
Sbjct  100  RFMNPEE-FKSM  110



>ref|WP_041425395.1| peptidase S41, partial [Synechococcus sp. CC9902]
Length=428

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L++S   +    WR  + D+L  S      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDYLDSSG-DYDESSWRQLRRDLLKKSFAGSAESYEAIRGMLASLNDPYT  111

Query  505  RFLSPAE  525
            RFL P +
Sbjct  112  RFLDPKQ  118



>ref|WP_002748078.1| C-terminal processing peptidase family protein [Microcystis aeruginosa]
 gb|ELS45530.1| C-terminal processing peptidase family protein [Microcystis aeruginosa 
DIANCHI905]
Length=441

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   R +    W+ K++++LS +  +  +A+ 
Sbjct  34   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RGFHQIDWQKKRQELLSRNYTNPQQAYT  90

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  LGD YTRFL+P E        + +TS++S    G+
Sbjct  91   AIREALKELGDSYTRFLTPRE-------FSVLTSQTSGELSGI  126



>ref|WP_017295499.1| hypothetical protein [Geminocystis herdmanii]
Length=423

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQ++N  +++ +   ++ E WR  +++ L      + +A++ IR ML  L DPYT
Sbjct  43   LVDEVWQVINGRYVDAT---FNGEDWREVRKEYLGKEYSDKEQAYEAIREMLKKLNDPYT  99

Query  505  RFLSPAECFYSM  540
            RF++P E F +M
Sbjct  100  RFMNPEE-FKTM  110



>gb|EAU71788.1| Peptidase S41A [Synechococcus sp. BL107]
Length=399

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L++S   +  + WR  + ++L  S      +++ IR MLASL DPYT
Sbjct  23   VIDQVWQIVYRDYLDSSG-DYDEKTWRQLRRNLLQKSFAGSAESYEAIRGMLASLNDPYT  81

Query  505  RFLSPAE  525
            RFL P +
Sbjct  82   RFLDPKQ  88



>gb|AFZ44744.1| C-terminal processing peptidase-2 [Halothece sp. PCC 7418]
Length=443

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN S+++     ++ + W + +E++L  +  S+  A+  IR+ L  L DPYT
Sbjct  47   VVDEVWQIVNQSYVDPE---FNHDDWETTREELLERNYTSKAEAYRAIRKALNKLNDPYT  103

Query  505  RFLSPAE  525
            RFL+P E
Sbjct  104  RFLNPEE  110



>ref|WP_015223281.1| C-terminal processing peptidase-2 [Cyanobacterium stanieri]
 gb|AFZ47965.1| C-terminal processing peptidase-2 [Cyanobacterium stanieri PCC 
7202]
Length=432

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = +1

Query  280  LSAAPAEPEVV-SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRA  456
            L   P   E+V S + IV EVWQIVN  F++     ++   W+ K+ ++LS   ++  +A
Sbjct  28   LQPLPTHAEMVDSPKAIVDEVWQIVNREFVD---EDFNKVDWQRKRNELLSREYRNHRQA  84

Query  457  HDIIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            +  I   L  LGDPYTRFL P +          +T+++S R  G+
Sbjct  85   YQAIENALKDLGDPYTRFLVPDQ-------FEALTNQTSGRVSGV  122



>ref|WP_037988894.1| peptidase S41, partial [Synechococcus sp. BL107]
Length=417

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L++S   +  + WR  + ++L  S      +++ IR MLASL DPYT
Sbjct  53   VIDQVWQIVYRDYLDSSG-DYDEKTWRQLRRNLLQKSFAGSAESYEAIRGMLASLNDPYT  111

Query  505  RFLSPAE  525
            RFL P +
Sbjct  112  RFLDPKQ  118



>ref|WP_035829920.1| peptidase S41 [Cyanobium sp. CACIAM 14]
 gb|KEF42723.1| peptidase S41 [Cyanobium sp. CACIAM 14]
Length=443

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ + WQIV   +L+T+ + ++P+ WR  +  +L+ S  +   A++ IR ML +L DPYT
Sbjct  44   VMDQAWQIVFRDYLDTTGK-YTPDHWRELRRSVLAKSYATPKDAYEGIRGMLGTLDDPYT  102

Query  505  RFLSPAE  525
            RFL P E
Sbjct  103  RFLDPRE  109



>ref|WP_041596658.1| peptidase S41, partial [Halothece sp. PCC 7418]
Length=421

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN S+++     ++ + W + +E++L  +  S+  A+  IR+ L  L DPYT
Sbjct  47   VVDEVWQIVNQSYVDPE---FNHDDWETTREELLERNYTSKAEAYRAIRKALNKLNDPYT  103

Query  505  RFLSPAE  525
            RFL+P E
Sbjct  104  RFLNPEE  110



>ref|WP_022604252.1| C-terminal peptidase (prc) [Rubidibacter lacunae]
 gb|ERN42802.1| C-terminal peptidase (prc) [Rubidibacter lacunae KORDI 51-2]
Length=427

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQI+N  +L+ +   ++   WR+ + + L  S  S+  A+D I+ ML  L DPYT
Sbjct  43   LVDEVWQIINRQYLDAT---FNQVDWRAVRNEYLDMSYDSKEDAYDAIQEMLDKLEDPYT  99

Query  505  RFLSPAE  525
            RFL P E
Sbjct  100  RFLKPEE  106



>ref|WP_029626349.1| peptidase S41 [Synechococcus sp. CB0205]
Length=444

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = +1

Query  292  PAEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDI  465
            P+   +VS+  + ++ + WQIV   +L+T+ + ++ + W+  +  +LS S  S   +++ 
Sbjct  28   PSSASLVSDSPKEVIDQTWQIVFRDYLDTNGK-YTTDKWKDLRRQVLSKSYGSTKESYEA  86

Query  466  IRRMLASLGDPYTRFLSPAE  525
            IR MLA+L DPYTRFL P E
Sbjct  87   IRGMLATLDDPYTRFLDPRE  106



>ref|WP_036892683.1| peptidase S41, partial [Prochlorococcus marinus]
Length=212

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +1

Query  295  AEPEVVSNEG--IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AEP +  N+G  +V E W IVN+ FLN  +  ++   WR  ++  +   I +   A+  I
Sbjct  33   AEPLIALNDGQQLVLETWNIVNEGFLNPEK--FNEVQWRRLRQQAIEKPITTSDEAYSAI  90

Query  469  RRMLASLGDPYTRFLSP  519
              ML  LGDPYTR L P
Sbjct  91   ETMLLPLGDPYTRLLRP  107



>ref|WP_015230264.1| C-terminal processing peptidase [Dactylococcopsis salina]
 gb|AFZ51275.1| C-terminal processing peptidase [Dactylococcopsis salina PCC 
8305]
Length=432

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            IV EVWQ+VN+++++     ++ + W   +E++L  +  S+  A+  +R  L  LGDPYT
Sbjct  47   IVDEVWQLVNENYVDPD---FNHDNWEKTREELLDRNYNSKQEAYRAVRNALNKLGDPYT  103

Query  505  RFLSPAECFYSM  540
            RFL P E + S+
Sbjct  104  RFLDP-EAYQSL  114



>ref|WP_029633475.1| peptidase S41 [[Scytonema hofmanni] UTEX B 1581]
Length=445

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + IV +VWQ+VN  +++     ++ + W++ ++ +LS +  SR  A+  IR  L  LG
Sbjct  44   SPKAIVDQVWQLVNREYVDGK---FNQQDWQATRQTLLSKNYSSREEAYTAIREALKKLG  100

Query  493  DPYTRFLSPAE  525
            DPYTRFL P +
Sbjct  101  DPYTRFLDPKQ  111



>ref|WP_036923215.1| peptidase S41 [Prochlorococcus marinus]
Length=431

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            SN+ ++  VWQI+   FL+ S   ++   W   ++ +L+    +   A+D IR MLA L 
Sbjct  31   SNKEVIDHVWQIIYRDFLD-SDGDFNRSNWIKLRKKLLTRKYANSSDAYDAIREMLAKLN  89

Query  493  DPYTRFLSPAECFYSM  540
            DPYTRFL P + FY M
Sbjct  90   DPYTRFLDPKQ-FYEM  104



>ref|WP_015142506.1| C-terminal processing peptidase [Pleurocapsa minor]
 gb|AFY76198.1| C-terminal processing peptidase [Pleurocapsa sp. PCC 7327]
Length=432

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQI+N ++++ +   ++   WR+ + + L     ++ +A+  IR ML  LGDPYT
Sbjct  43   LVDEVWQIINRTYVDGT---FNKVDWRAIRNEYLGREYANKEQAYKAIREMLEKLGDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+ P E F +M
Sbjct  100  RFMDPEE-FQNM  110



>gb|AHF63752.1| carboxyl-terminal protease [Synechococcus sp. WH 8109]
Length=432

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            ++ +VWQIV   +L+++  S+    WR  + ++L  S      +++ IR MLASL DPYT
Sbjct  36   VIDQVWQIVYRDYLDSTG-SYDERKWRQLRSNLLRKSYGGSAESYEAIRGMLASLDDPYT  94

Query  505  RFLSPAE  525
            RFL P E
Sbjct  95   RFLDPKE  101



>ref|WP_018396142.1| peptidase S41 [filamentous cyanobacterium ESFC-1]
Length=437

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQI+N  +++ +   ++ E WRS + + L  +   +  A+  IR ML  L DPYT
Sbjct  42   LVDEVWQIINRQYVDAT---FNGEDWRSIRSEYLDRTYSDKEEAYGAIREMLERLEDPYT  98

Query  505  RFLSPAECFYSMAYITT  555
            RF++P E F SM   T+
Sbjct  99   RFMNPDE-FQSMQIDTS  114



>ref|WP_024546109.1| peptidase S41 [Synechococcus sp. NKBG15041c]
Length=446

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 10/93 (11%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + +V E+WQIV   +  +  + + PE W   +E++LS +  S   A+  IR  L +LG
Sbjct  45   SPKAVVDEMWQIV---YSESVAKDFEPEAWLKLREELLSQNYDSYEGAYRQIRNALRTLG  101

Query  493  DPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            DPYTRFL P E         T+TS+++    G+
Sbjct  102  DPYTRFLDPRE-------FETLTSQTTGELSGI  127



>ref|WP_025968593.1| peptidase S41 [Prochlorococcus sp. scB245a_519D13]
Length=444

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE +V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEAKVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_025942289.1| MULTISPECIES: peptidase S41 [Prochlorococcus]
Length=444

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE +V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEAKVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_023174000.1| carboxyl-terminal protease [Gloeobacter kilaueensis]
 gb|AGY58810.1| carboxyl-terminal protease [Gloeobacter kilaueensis JS1]
Length=448

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 59/100 (59%), Gaps = 11/100 (11%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            +N+ I+ EVWQ++   +++T+   ++ + W+  ++  L    ++R  A+   + ML SLG
Sbjct  36   ANKEIIDEVWQVIAREYVDTT---YNKQDWQQMRQKYLGKDYKTREDAYKGAKEMLKSLG  92

Query  493  DPYTRFLSPAECFYSMAYITTITSESSPRWRGM-I*LGLE  609
            DPYTRF+ P + + SM        E+S  ++G+ I LGL+
Sbjct  93   DPYTRFMEPKQ-YESMKV------ETSGEFQGVGIQLGLD  125



>ref|WP_015957337.1| peptidase S41 [Cyanothece sp. PCC 8801]
 gb|ACK68179.1| carboxyl-terminal protease [Cyanothece sp. PCC 8801]
Length=430

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQ++N ++++ +   ++   WR  +++ L+    ++  A+  IR ML  LGDPYT
Sbjct  43   LVDEVWQVINRTYVDAT---FNQVDWRKVRQEYLNRPYSNKEEAYKAIREMLEKLGDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+ P E F +M
Sbjct  100  RFMDPEE-FKNM  110



>ref|WP_044106509.1| peptidase S41 [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP17752.1| carboxyl-terminal protease [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=457

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 59/105 (56%), Gaps = 15/105 (14%)
 Frame = +1

Query  277  ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRA  456
            E++     P+VV     + E+WQIVN+ F++   + ++   W+ K++++LS    +  +A
Sbjct  39   EMTILEDNPKVV-----IDEMWQIVNNEFVD---KEFNRVEWKEKRQELLSRDYANHKQA  90

Query  457  HDIIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
            +  I++ L  LGDPYTRFL+P           T+TS++S    G+
Sbjct  91   YKAIQKTLKWLGDPYTRFLTPDN-------FATLTSQTSGELSGV  128



>ref|WP_015170194.1| C-terminal processing peptidase-2 [Geitlerinema sp. PCC 7407]
 gb|AFY64626.1| C-terminal processing peptidase-2 [Geitlerinema sp. PCC 7407]
Length=432

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQI++ S+++ +   ++   WRS + D L+ S  S+  A+  +R ML  L DPYT
Sbjct  43   LVDEVWQIIDRSYVDAT---FNQVDWRSVRTDYLNRSYTSKEDAYKAVREMLEKLEDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+ P E F +M
Sbjct  100  RFMDPTE-FKNM  110



>ref|WP_015785232.1| peptidase S41 [Cyanothece sp. PCC 8802]
 gb|ACV03102.1| carboxyl-terminal protease [Cyanothece sp. PCC 8802]
Length=430

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQ++N ++++ +   ++   WR  +++ L+    ++  A+  IR ML  LGDPYT
Sbjct  43   LVDEVWQVINRTYVDAT---FNQVDWRKVRQEYLNRPYSNKEEAYKAIREMLEKLGDPYT  99

Query  505  RFLSPAECFYSM  540
            RF+ P E F +M
Sbjct  100  RFMDPEE-FKNM  110



>ref|WP_029984527.1| peptidase S41, partial [Prochlorococcus sp. scB245a_521N5]
Length=125

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D  
Sbjct  23   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAN  81

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  82   RDMLSNLDDSYTRFLEPKE  100



>ref|WP_025970691.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_521M10]
Length=189

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  14   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  72

Query  469  RRMLASLGDPYTRFLSPAE  525
            R +L++L D YTRFL P E
Sbjct  73   RDLLSNLDDSYTRFLEPKE  91



>ref|WP_012165099.1| peptidase S41 [Acaryochloris marina]
 gb|ABW29820.1| carboxyl-terminal protease [Acaryochloris marina MBIC11017]
Length=440

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +1

Query  295  AEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRR  474
            A P   S++ I+ EVWQI+ + +L+TS   ++   W + +   L+ +  S+   +D +R 
Sbjct  31   AAPNSDSSKAIIDEVWQIIKNDYLDTS---FNGTDWPAIRSQYLNRTYTSKEEVYDAVRE  87

Query  475  MLASLGDPYTRFLSPAEC  528
            ML  L DPYTRFL P + 
Sbjct  88   MLDQLEDPYTRFLDPQQL  105



>ref|WP_035158073.1| peptidase S41 [Calothrix sp. 336/3]
 gb|KFB86073.1| peptidase S41 [Calothrix sp. 336/3]
Length=445

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + IV +VWQ+VN  +++ S   ++ + W++ ++ +LS +  SR  A+  IR  L  +G
Sbjct  44   SPKAIVDQVWQLVNREYVDPS---FNKQNWQAVRQSLLSKNYSSREEAYAAIREALQKMG  100

Query  493  DPYTRFLSPAE  525
            DPYTRF+ P +
Sbjct  101  DPYTRFMDPKQ  111



>ref|WP_040054262.1| peptidase S41 [Candidatus Atelocyanobacterium thalassa]
 gb|KFF42122.1| C-terminal processing peptidase-2 [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=430

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 7/75 (9%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL---STSIQSRPRAHDIIRRMLASLGD  495
            +V EVW I+ND++++ +   ++   W + ++D +   S S Q++  A+  IR ML  LGD
Sbjct  43   LVDEVWHIINDTYVDDT---FNQVDWLAVRQDYVVGDSQSYQTKEEAYKAIREMLEQLGD  99

Query  496  PYTRFLSPAECFYSM  540
            PYTRF+ P E F +M
Sbjct  100  PYTRFMDPEE-FKNM  113



>ref|WP_036266255.1| peptidase S41, partial [Mastigocoleus testarum]
Length=422

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            IV  VWQ+VN  ++++S   ++ + W++ + ++LS +  S+  A+  + ++L SL DPYT
Sbjct  45   IVDRVWQLVNRDYVDSS---FNQQDWKAVRRELLSKNYSSQEEAYAAVHKLLESLEDPYT  101

Query  505  RFLSPAECFY  534
            RF++P E  Y
Sbjct  102  RFMAPKEYKY  111



>ref|WP_039741239.1| peptidase S41 [Hassallia byssoidea]
 gb|KIF36266.1| peptidase S41 [Hassallia byssoidea VB512170]
Length=445

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + IV +VWQ+VN  +++     ++ + W++ ++ +LS +  SR  A+  IR  L  LG
Sbjct  44   SPKAIVDQVWQLVNREYVDGK---FNQQDWQATRQTLLSKNYSSRDEAYTAIREALKKLG  100

Query  493  DPYTRFLSPAE  525
            DPYTRF+ P +
Sbjct  101  DPYTRFMDPKQ  111



>ref|WP_009456991.1| MULTISPECIES: peptidase S41 [Fischerella]
 gb|EHC14100.1| carboxyl-terminal protease [Fischerella sp. JSC-11]
Length=415

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V+EVW+IVN ++L+ +   ++ + W + ++ ILS S+  +  A+  I++ML SL DP+T
Sbjct  39   LVSEVWRIVNRTYLDDT---FNHQNWAAVRQKILSASLPDQKAAYTAIQKMLKSLDDPFT  95

Query  505  RFLSP  519
            RFL P
Sbjct  96   RFLDP  100



>ref|WP_006528363.1| C-terminal processing peptidase [Gloeocapsa sp. PCC 73106]
 gb|ELR98786.1| C-terminal processing peptidase [Gloeocapsa sp. PCC 73106]
Length=423

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQIVN  +++ +   ++   WR  + + L  S  S+  A+D I+ ML  L DPYT
Sbjct  43   LVDEVWQIVNRQYVDAT---FNQVDWREVRREYLERSYGSKEEAYDAIKEMLEKLEDPYT  99

Query  505  RFLSPAE  525
            RF++P E
Sbjct  100  RFMNPEE  106



>gb|KGG11320.1| Periplasmic protease [Prochlorococcus marinus str. LG]
 gb|KGG18725.1| Periplasmic protease [Prochlorococcus marinus str. SS2]
 gb|KGG22999.1| Periplasmic protease [Prochlorococcus marinus str. SS35]
 gb|KGG37558.1| Periplasmic protease [Prochlorococcus sp. SS52]
Length=455

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +1

Query  295  AEPEVVSNEG--IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AEP +  N+G  +V E W IVN+ FLN  +  ++   WR  ++  +   I +   A+  I
Sbjct  30   AEPLIALNDGQQLVLETWNIVNEGFLNPEK--FNEVQWRRLRQQAIEKPITTSDEAYSAI  87

Query  469  RRMLASLGDPYTRFLSP  519
              ML  LGDPYTR L P
Sbjct  88   ETMLLPLGDPYTRLLRP  104



>ref|WP_022605369.1| C-terminal peptidase (prc) [Rubidibacter lacunae]
 gb|ERN42272.1| C-terminal peptidase (prc) [Rubidibacter lacunae KORDI 51-2]
Length=436

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +V EVWQ+VN  +++T    ++ + W++ + ++L      R  A++ IR  L  LGDPYT
Sbjct  46   VVDEVWQLVNQQYVDTD---FNQDDWKATRLELLERQYSDRMAAYEAIRDALKKLGDPYT  102

Query  505  RFLSPAE  525
            RFL P E
Sbjct  103  RFLDPEE  109



>ref|XP_002185829.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65299.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=476

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 49/84 (58%), Gaps = 10/84 (12%)
 Frame = +1

Query  295  AEPEVVSNEG-------IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPR  453
            A P V S+ G       +VAE W++V++SFL+   R+++ + W   ++  +    ++   
Sbjct  97   ATPAVASDYGSFTPEQKVVAEAWRLVDNSFLD---RTFNGQDWFQLRQKYVKQKYKNMAE  153

Query  454  AHDIIRRMLASLGDPYTRFLSPAE  525
            A D I  M+ SLGD YTR+LSPA+
Sbjct  154  ARDAIDTMVGSLGDRYTRYLSPAK  177



>ref|WP_025961023.1| peptidase S41 [Prochlorococcus sp. scB245a_519L21]
Length=444

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_025954042.1| peptidase S41 [Prochlorococcus sp. scB243_498B22]
Length=444

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_025962894.1| peptidase S41 [Prochlorococcus sp. scB245a_521O20]
Length=444

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>emb|CCH95675.1| Carboxyl-terminal-processing protease [Microcystis aeruginosa 
PCC 9432]
 emb|CCI08078.1| Carboxyl-terminal-processing protease [Microcystis aeruginosa 
PCC 7941]
Length=455

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 11/103 (11%)
 Frame = +1

Query  286  AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD  462
            AA  E  +  N + ++ +VWQIVN+ F++   RS+    W+ K++++LS +  +  +A+ 
Sbjct  48   AAKGEKPLEDNPKAVIDQVWQIVNNEFVD---RSFHQIDWQKKRQELLSRNYTNPQQAYT  104

Query  463  IIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESSPRWRGM  591
             IR  L  L D YTRFL+P E        + +TS++S    G+
Sbjct  105  AIREALKELDDTYTRFLTPRE-------FSVLTSQTSGELSGI  140



>ref|WP_025900402.1| MULTISPECIES: peptidase S41 [Prochlorococcus]
Length=444

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_011124521.1| peptidase S41 [Prochlorococcus marinus]
 ref|NP_874760.1| Periplasmic protease [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 gb|AAP99412.1| Periplasmic protease [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
Length=459

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +1

Query  295  AEPEVVSNEG--IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AEP +  N+G  +V E W IVN+ FLN  +  ++   WR  ++  +   I +   A+  I
Sbjct  34   AEPLIALNDGQQLVLETWNIVNEGFLNPEK--FNEVQWRRLRQQAIEKPITTSDEAYSAI  91

Query  469  RRMLASLGDPYTRFLSP  519
              ML  LGDPYTR L P
Sbjct  92   ETMLLPLGDPYTRLLRP  108



>ref|WP_036896536.1| MULTISPECIES: peptidase S41, partial [Prochlorococcus]
Length=445

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +1

Query  295  AEPEVVSNEG--IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AEP +  N+G  +V E W IVN+ FLN  +  ++   WR  ++  +   I +   A+  I
Sbjct  33   AEPLIALNDGQQLVLETWNIVNEGFLNPEK--FNEVQWRRLRQQAIEKPITTSDEAYSAI  90

Query  469  RRMLASLGDPYTRFLSP  519
              ML  LGDPYTR L P
Sbjct  91   ETMLLPLGDPYTRLLRP  107



>ref|WP_026101674.1| carboxyl-terminal protease [cyanobacterium PCC 7702]
Length=415

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            +VAEVW+IVN ++L+ +   ++ + W + ++ ILST+   +  A+  I  ML SL DP+T
Sbjct  39   LVAEVWRIVNRNYLDDT---FNHQNWAAVRQKILSTAFTDQKAAYAAIEEMLKSLNDPFT  95

Query  505  RFLSP  519
            RFL P
Sbjct  96   RFLDP  100



>ref|WP_025954528.1| peptidase S41 [Prochlorococcus sp. scB243_498C16]
Length=444

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_025953685.1| peptidase S41 [Prochlorococcus sp. scB243_497N18]
Length=444

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_040897737.1| peptidase S41 [Xenococcus sp. PCC 7305]
Length=429

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +1

Query  325  IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT  504
            IV EVWQIV++ F++   R ++   W  K++++L  +  ++ +A+  IR  L  LGDPYT
Sbjct  40   IVDEVWQIVHNEFVD---REFNEIDWLEKRQELLEGNYANQEQAYRAIRESLKELGDPYT  96

Query  505  RFLSP  519
            RFL P
Sbjct  97   RFLDP  101



>ref|WP_025941535.1| peptidase S41 [Prochlorococcus sp. scB245a_518O7]
Length=444

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_007100535.1| peptidase S41 [Synechococcus sp. RS9917]
 gb|EAQ68459.1| PDZ domain (also known as DHR or GLGF):Tail specific protease 
[Synechococcus sp. RS9917]
Length=438

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = +1

Query  295  AEPEVVSNEG--IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            A+P +  N+   +V E W++VN S+++ +R  +    WR  ++  L  SIQ+   A++ I
Sbjct  33   AQPALALNDAQQLVVESWKLVNQSYVDPAR--FDQIHWRRLRQKALEGSIQTSDEAYNAI  90

Query  469  RRMLASLGDPYTRFLSPAE  525
              MLA +GDPYTR L P +
Sbjct  91   DAMLAPIGDPYTRLLRPTD  109



>ref|WP_025964192.1| peptidase S41 [Prochlorococcus sp. scB243_498M14]
Length=444

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +1

Query  295  AEPEVVSN--EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII  468
            AE  V++N  + ++  VWQIV   FL++S + +    W S ++++LS +      A+D I
Sbjct  28   AEATVLNNSYKEVIDHVWQIVYRDFLDSSGK-FQKSNWISLRKEVLSKTYSDSNEAYDAI  86

Query  469  RRMLASLGDPYTRFLSPAE  525
            R ML++L D YTRFL P E
Sbjct  87   RDMLSNLDDSYTRFLEPKE  105



>ref|WP_015186501.1| C-terminal processing peptidase-2 [Gloeocapsa sp. PCC 7428]
 gb|AFZ28624.1| C-terminal processing peptidase-2 [Gloeocapsa sp. PCC 7428]
Length=436

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +1

Query  313  SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG  492
            S + +V EVWQ+VN  +++++   ++   W+  ++++LS +  S+ +A++ IR  L  LG
Sbjct  41   SPKALVDEVWQLVNREYVDST---FNKVNWQLSRQNLLSKNYTSKEQAYNAIRAELEKLG  97

Query  493  DPYTRFLSPAE  525
            DPYTRFL P +
Sbjct  98   DPYTRFLDPQQ  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125