BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF037E04

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011029989.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    139   1e-36   Populus euphratica
ref|XP_011029982.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    139   1e-36   Populus euphratica
ref|XP_006374938.1|  hypothetical protein POPTR_0014s02920g             137   4e-36   
ref|XP_006374941.1|  hypothetical protein POPTR_0014s02920g             136   5e-36   
ref|XP_006374939.1|  hypothetical protein POPTR_0014s02920g             137   6e-36   
ref|XP_006374940.1|  hypothetical protein POPTR_0014s02920g             137   7e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002284743.1|  PREDICTED: thioredoxin-like 4, chloroplastic       136   1e-35   Vitis vinifera
ref|XP_011083841.1|  PREDICTED: thioredoxin-like 4, chloroplastic       125   2e-31   Sesamum indicum [beniseed]
gb|KDP38336.1|  hypothetical protein JCGZ_04261                         119   2e-29   Jatropha curcas
ref|XP_007223464.1|  hypothetical protein PRUPE_ppa011634mg             117   2e-28   Prunus persica
ref|XP_002510215.1|  Thioredoxin, putative                              117   2e-28   Ricinus communis
ref|XP_009348702.1|  PREDICTED: thioredoxin-like 4, chloroplastic       115   9e-28   Pyrus x bretschneideri [bai li]
gb|AFH68081.1|  thioredoxin-like protein 3                              114   1e-27   Populus tremula x Populus tremuloides
ref|XP_008393810.1|  PREDICTED: thioredoxin-like 4, chloroplastic       114   6e-27   
ref|XP_009359520.1|  PREDICTED: thioredoxin-like 4, chloroplastic       114   6e-27   Pyrus x bretschneideri [bai li]
ref|XP_006354885.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    112   1e-26   Solanum tuberosum [potatoes]
ref|XP_009594381.1|  PREDICTED: thioredoxin-like 4, chloroplastic       110   9e-26   Nicotiana tomentosiformis
ref|XP_008220226.1|  PREDICTED: thioredoxin-like 4, chloroplastic       109   1e-25   
ref|XP_007017236.1|  Thioredoxin superfamily protein isoform 1          109   2e-25   
ref|XP_010525983.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    108   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_008777945.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   4e-25   Phoenix dactylifera
ref|XP_008444622.1|  PREDICTED: thioredoxin-like 4, chloroplastic       108   4e-25   Cucumis melo [Oriental melon]
ref|XP_008351997.1|  PREDICTED: thioredoxin-like 4, chloroplastic       108   4e-25   
ref|XP_006581243.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    108   5e-25   
ref|XP_010943061.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   5e-25   
ref|XP_010943060.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   5e-25   
ref|XP_008777942.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    108   5e-25   Phoenix dactylifera
ref|XP_010525984.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    108   5e-25   Tarenaya hassleriana [spider flower]
ref|XP_010525985.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   7e-25   Tarenaya hassleriana [spider flower]
ref|XP_010943054.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   7e-25   
ref|XP_004150883.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   7e-25   Cucumis sativus [cucumbers]
ref|XP_010525982.1|  PREDICTED: uncharacterized protein LOC104803...    107   8e-25   Tarenaya hassleriana [spider flower]
ref|XP_010525980.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    108   8e-25   Tarenaya hassleriana [spider flower]
ref|XP_003523931.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   8e-25   Glycine max [soybeans]
ref|XP_010108614.1|  Thioredoxin-like 4                                 107   8e-25   Morus notabilis
ref|XP_008777943.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   9e-25   Phoenix dactylifera
ref|XP_006578025.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    107   9e-25   Glycine max [soybeans]
ref|XP_006434769.1|  hypothetical protein CICLE_v10002686mg             105   1e-24   
gb|KDO84170.1|  hypothetical protein CISIN_1g0278901mg                  105   2e-24   Citrus sinensis [apfelsine]
gb|KDO84176.1|  hypothetical protein CISIN_1g0278901mg                  105   2e-24   Citrus sinensis [apfelsine]
ref|XP_006434767.1|  hypothetical protein CICLE_v10002686mg             105   2e-24   
gb|KDO84169.1|  hypothetical protein CISIN_1g0278901mg                  106   2e-24   Citrus sinensis [apfelsine]
ref|XP_006434766.1|  hypothetical protein CICLE_v10002686mg             106   2e-24   Citrus clementina [clementine]
ref|XP_006434771.1|  hypothetical protein CICLE_v10002686mg             106   2e-24   
gb|KJB58475.1|  hypothetical protein B456_009G211800                    106   2e-24   Gossypium raimondii
ref|XP_006473325.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    106   2e-24   Citrus sinensis [apfelsine]
gb|EYU25424.1|  hypothetical protein MIMGU_mgv1a013495mg                105   4e-24   Erythranthe guttata [common monkey flower]
ref|XP_007017237.1|  Thioredoxin superfamily protein isoform 2          105   4e-24   
ref|XP_008375989.1|  PREDICTED: thioredoxin-like 4, chloroplastic       105   4e-24   
ref|XP_007136685.1|  hypothetical protein PHAVU_009G065200g             105   4e-24   Phaseolus vulgaris [French bean]
ref|XP_004501566.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    105   5e-24   Cicer arietinum [garbanzo]
gb|KCW66422.1|  hypothetical protein EUGRSUZ_F00226                     104   5e-24   Eucalyptus grandis [rose gum]
ref|XP_010059934.1|  PREDICTED: thioredoxin-like 4, chloroplastic       105   7e-24   Eucalyptus grandis [rose gum]
ref|XP_009775491.1|  PREDICTED: thioredoxin-like 4, chloroplastic       105   8e-24   Nicotiana sylvestris
ref|XP_009401435.1|  PREDICTED: thioredoxin-like 4, chloroplastic       104   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010263549.1|  PREDICTED: thioredoxin-like 4, chloroplastic       103   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010320331.1|  PREDICTED: thioredoxin-like 4, chloroplastic       103   3e-23   Solanum lycopersicum
gb|EMS47929.1|  Thioredoxin-like 4, chloroplastic                       101   3e-23   Triticum urartu
dbj|BAJ87532.1|  predicted protein                                      102   4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010235574.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    102   6e-23   Brachypodium distachyon [annual false brome]
dbj|BAJ99374.1|  predicted protein                                      102   6e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT00850.1|  Thioredoxin                                             102   6e-23   
ref|XP_003575193.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    102   7e-23   Brachypodium distachyon [annual false brome]
ref|XP_010235573.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    102   8e-23   Brachypodium distachyon [annual false brome]
gb|EPS71637.1|  hypothetical protein M569_03123                       99.8    1e-22   Genlisea aurea
ref|XP_006647405.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    101   2e-22   Oryza brachyantha
ref|XP_010667619.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    101   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006838053.1|  hypothetical protein AMTR_s00091p00126620          100   2e-22   
ref|XP_010667621.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    100   2e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV54863.1|  thioredoxin-like 4 chloroplastic-like protein           100   3e-22   Phaseolus vulgaris [French bean]
gb|AIN39829.1|  hypothetical protein                                    100   3e-22   Zoysia matrella [Japanese carpet grass]
gb|AFK47986.1|  unknown                                                 100   3e-22   Lotus japonicus
ref|XP_002889657.1|  predicted protein                                  100   3e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_003603045.1|  Thioredoxin H-type 3                             99.4    3e-22   
gb|AES73296.2|  thioredoxin                                             100   4e-22   Medicago truncatula
emb|CDP01361.1|  unnamed protein product                              99.0    1e-21   Coffea canephora [robusta coffee]
ref|XP_009137448.1|  PREDICTED: thioredoxin-like 4, chloroplastic...  97.4    2e-21   Brassica rapa
emb|CDX92634.1|  BnaC07g38920D                                        97.4    2e-21   
ref|XP_002454035.1|  hypothetical protein SORBIDRAFT_04g023500        98.6    2e-21   Sorghum bicolor [broomcorn]
ref|XP_011458932.1|  PREDICTED: thioredoxin-like 4, chloroplastic     98.2    2e-21   Fragaria vesca subsp. vesca
ref|XP_009137446.1|  PREDICTED: thioredoxin-like 4, chloroplastic...  97.8    3e-21   Brassica rapa
emb|CDY11014.1|  BnaA03g46730D                                        97.8    3e-21   Brassica napus [oilseed rape]
ref|XP_010487849.1|  PREDICTED: thioredoxin-like 4, chloroplastic     97.4    4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002879039.1|  thioredoxin family protein                       96.7    4e-21   
ref|XP_006304213.1|  hypothetical protein CARUB_v10010324mg           97.1    6e-21   Capsella rubella
ref|XP_006413424.1|  hypothetical protein EUTSA_v10026224mg           95.5    9e-21   
ref|XP_006413425.1|  hypothetical protein EUTSA_v10026224mg           96.7    9e-21   Eutrema salsugineum [saltwater cress]
ref|NP_973780.1|  thioredoxin family protein                          95.1    1e-20   
ref|XP_010475538.1|  PREDICTED: thioredoxin-like 4, chloroplastic     95.9    1e-20   Camelina sativa [gold-of-pleasure]
gb|AFW71917.1|  thioredoxin-like 2                                    95.9    2e-20   
ref|NP_001151688.1|  thioredoxin-like 2                               95.9    2e-20   
ref|NP_563794.1|  thioredoxin family protein                          95.5    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973781.1|  thioredoxin family protein                          95.1    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952710.1|  PREDICTED: thioredoxin-like 4, chloroplastic...  94.4    5e-20   Setaria italica
gb|EEC73438.1|  hypothetical protein OsI_07725                        89.4    3e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001047177.1|  Os02g0567100                                     89.4    4e-18   
ref|XP_001764331.1|  predicted protein                                87.0    4e-18   
ref|XP_001780167.1|  predicted protein                                84.7    3e-17   
ref|XP_005647696.1|  hypothetical protein COCSUDRAFT_15621            48.9    2e-04   Coccomyxa subellipsoidea C-169
gb|ACU17167.1|  unknown                                               46.6    6e-04   Glycine max [soybeans]



>ref|XP_011029989.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Populus 
euphratica]
 ref|XP_011029997.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Populus 
euphratica]
Length=217

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 103/155 (66%), Gaps = 15/155 (10%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQ---KLGCLAGSILPIIRKNAIESCYIKTR----GVFRL  352
            MQ+ ++L  KASFGFGR+ + Q   ++ C+A S+LP  R+   +SC +K +      +  
Sbjct  1    MQKQNILYSKASFGFGRNPDRQLDCRIPCVAPSMLP--RRGNKKSCLMKAKFPSITKYEG  58

Query  353  GNVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEK  532
             N  K   A R  RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EK
Sbjct  59   LNFPKNNDAWRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILEK  112

Query  533  AKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            AK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  113  AKETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  147



>ref|XP_011029982.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Populus 
euphratica]
Length=241

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 113/174 (65%), Gaps = 16/174 (9%)
 Frame = +2

Query  140  TWEWWMKRLIL*GLQL-ALMQRLSVLGCKASFGFGRSFNDQ---KLGCLAGSILPIIRKN  307
            T+   +++ I  G+ L  +MQ+ ++L  KASFGFGR+ + Q   ++ C+A S+LP  R+ 
Sbjct  6    TFLLQLQQHIDCGVSLNVVMQKQNILYSKASFGFGRNPDRQLDCRIPCVAPSMLP--RRG  63

Query  308  AIESCYIKTR----GVFRLGNVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCP  475
              +SC +K +      +   N  K   A R  RI +V ++N  EL +   D      LCP
Sbjct  64   NKKSCLMKAKFPSITKYEGLNFPKNNDAWRPGRIKAVVDENPGELSDEDDD------LCP  117

Query  476  VECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            V+CVREF TDEEF RI+EKAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  118  VDCVREFKTDEEFLRILEKAKETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  171



>ref|XP_006374938.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
 gb|ERP52735.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
Length=217

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 104/155 (67%), Gaps = 15/155 (10%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQ---KLGCLAGSILPIIRKNAIESCYIKTR--GVFRLG-  355
            MQ+ ++L  KASFGFGR+ + Q   ++ C+A S+LP  R N  +SC +K +   + +   
Sbjct  1    MQKQNILYSKASFGFGRNPDRQLDCRIPCVAPSMLPC-RGNE-KSCLMKAKFPSITKYAG  58

Query  356  -NVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEK  532
             N  K   A R  RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EK
Sbjct  59   LNFPKNNVASRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILEK  112

Query  533  AKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            AK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  113  AKETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  147



>ref|XP_006374941.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
 gb|ERP52738.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
Length=201

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 105/156 (67%), Gaps = 15/156 (10%)
 Frame = +2

Query  191  LMQRLSVLGCKASFGFGRSFNDQ---KLGCLAGSILPIIRKNAIESCYIKTR--GVFRLG  355
            +MQ+ ++L  KASFGFGR+ + Q   ++ C+A S+LP  R N  +SC +K +   + +  
Sbjct  24   VMQKQNILYSKASFGFGRNPDRQLDCRIPCVAPSMLPC-RGNE-KSCLMKAKFPSITKYA  81

Query  356  --NVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIME  529
              N  K   A R  RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+E
Sbjct  82   GLNFPKNNVASRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILE  135

Query  530  KAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            KAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  136  KAKETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  171



>ref|XP_006374939.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
 gb|ERP52736.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
Length=223

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 105/156 (67%), Gaps = 15/156 (10%)
 Frame = +2

Query  191  LMQRLSVLGCKASFGFGRSFNDQ---KLGCLAGSILPIIRKNAIESCYIKTR--GVFRLG  355
            +MQ+ ++L  KASFGFGR+ + Q   ++ C+A S+LP  R N  +SC +K +   + +  
Sbjct  24   VMQKQNILYSKASFGFGRNPDRQLDCRIPCVAPSMLPC-RGNE-KSCLMKAKFPSITKYA  81

Query  356  --NVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIME  529
              N  K   A R  RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+E
Sbjct  82   GLNFPKNNVASRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILE  135

Query  530  KAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            KAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  136  KAKETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  171



>ref|XP_006374940.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
 gb|ERP52737.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
Length=241

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 105/156 (67%), Gaps = 15/156 (10%)
 Frame = +2

Query  191  LMQRLSVLGCKASFGFGRSFNDQ---KLGCLAGSILPIIRKNAIESCYIKTR--GVFRLG  355
            +MQ+ ++L  KASFGFGR+ + Q   ++ C+A S+LP  R N  +SC +K +   + +  
Sbjct  24   VMQKQNILYSKASFGFGRNPDRQLDCRIPCVAPSMLPC-RGNE-KSCLMKAKFPSITKYA  81

Query  356  --NVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIME  529
              N  K   A R  RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+E
Sbjct  82   GLNFPKNNVASRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILE  135

Query  530  KAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            KAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  136  KAKETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  171



>ref|XP_002284743.1| PREDICTED: thioredoxin-like 4, chloroplastic [Vitis vinifera]
 ref|XP_010664571.1| PREDICTED: thioredoxin-like 4, chloroplastic [Vitis vinifera]
 emb|CBI19519.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 103/154 (67%), Gaps = 14/154 (9%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFN--DQKLGCLAGSILPIIRKNAIESCYIKTR--GVFRLGNV  361
            MQR SVL  KASF FG++ +  D ++ C+  S+LP   +  + SC+++       ++ ++
Sbjct  1    MQRQSVLYNKASFNFGKNSDGFDTRIPCILPSLLP--DRIHVRSCFLRAEIPSSIKIESL  58

Query  362  E--KQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKA  535
            +  K  C  R + + SV  +N  EL +   +      LCPV+CVREF TDEEFSRI+EKA
Sbjct  59   DFTKIGCTFRQAEVRSVAYENEGELSDEDDE------LCPVDCVREFKTDEEFSRILEKA  112

Query  536  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  113  KETNSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  146



>ref|XP_011083841.1| PREDICTED: thioredoxin-like 4, chloroplastic [Sesamum indicum]
Length=220

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 96/152 (63%), Gaps = 10/152 (7%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQ-KLGCLAGSILPIIRKNAIESCYIKTRGVFRLGN---V  361
            MQ+  +L  KA F F    N Q       G     +  +  +SC +K R     G+   +
Sbjct  1    MQKQGILHQKALFNFVTKTNGQIDFEHTMGFGNLFLDTSITKSCQLKARIQCLTGSAIPM  60

Query  362  EKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQ  541
             K   A++ S+I S  ++NV+EL +   +      LCPV+CVREFNTDEEFSRI+EKAK+
Sbjct  61   MKVTSALKLSKIKSTLDENVEELSDDDDE------LCPVDCVREFNTDEEFSRILEKAKE  114

Query  542  TGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            + ALVVVDFYRTSCGSCKYIEQGF+KLCKGSG
Sbjct  115  SNALVVVDFYRTSCGSCKYIEQGFMKLCKGSG  146



>gb|KDP38336.1| hypothetical protein JCGZ_04261 [Jatropha curcas]
Length=209

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (63%), Gaps = 12/152 (8%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQKLGCLAGSILPIIRKNAIESCYIKTRGVFRLGNVE---  364
            MQ+ ++L   ASFG G S  D+K G     ++P +R N  +SC + T+ +     V    
Sbjct  1    MQKQNILYSNASFGLG-SNPDRKCGSRIPHVVPRMRCNT-KSCLVWTKIIPISKTVGLDF  58

Query  365  -KQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQ  541
             K+    +  RI  V + N  EL +   D      LCP +CVREF TDEEF +I+EKAK+
Sbjct  59   LKKSDTFQPGRIKGVADGNPGELSDEDED------LCPADCVREFKTDEEFLKIIEKAKE  112

Query  542  TGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            TG+LVVVDFYRTSCGSCKYIEQGF KLC+G+G
Sbjct  113  TGSLVVVDFYRTSCGSCKYIEQGFAKLCRGAG  144



>ref|XP_007223464.1| hypothetical protein PRUPE_ppa011634mg [Prunus persica]
 gb|EMJ24663.1| hypothetical protein PRUPE_ppa011634mg [Prunus persica]
Length=202

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 91/152 (60%), Gaps = 26/152 (17%)
 Frame = +2

Query  194  MQRLSVL--GCKASFGFGRSFNDQKLGCLAGSILP--IIRKNAIESCYIKTRGVFRLGNV  361
            MQ  ++L    +ASF FG   N  KLG ++ S  P  I R+  + SC I+ + + R    
Sbjct  1    MQSHTILYGKARASFNFGTKPN-TKLGSMSPSEFPTSIPRRTHVRSCLIRAK-IPRCHAF  58

Query  362  EKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQ  541
            E+   +V  + +   ++D                 LCPVECVREF TDEE  RI+E AK+
Sbjct  59   ER---SVNQAEMTDEDDD-----------------LCPVECVREFKTDEELFRILETAKK  98

Query  542  TGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            TG+LVVVDF+RTSCGSCKYIEQGF KLCKG+G
Sbjct  99   TGSLVVVDFFRTSCGSCKYIEQGFSKLCKGAG  130



>ref|XP_002510215.1| Thioredoxin, putative [Ricinus communis]
 gb|EEF52402.1| Thioredoxin, putative [Ricinus communis]
Length=220

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 96/156 (62%), Gaps = 14/156 (9%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQKLGCLAGSILP-IIRKNAIESCYIKTRGVFRLGNVEKQ  370
            MQ+ ++L   ASFGFG+S  +Q LG     ++P +      +SC I+ + V     +   
Sbjct  1    MQKQNILHSNASFGFGKSPEEQ-LGSRIPHVIPRMCLYRYAKSCLIRAKAVPITKTISLD  59

Query  371  ICA------VRSSRI-WSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIME  529
                     ++ +RI   V + N+ EL +   ++     LCPV+CV+EF TDEEF +I+E
Sbjct  60   FLKNSDAFLLQPARIKLGVTDGNLGELSDEDDED-----LCPVDCVKEFKTDEEFFKILE  114

Query  530  KAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            KAK+T +LVVVDFYR SCGSCKYIEQGF KLC+G+G
Sbjct  115  KAKETDSLVVVDFYRPSCGSCKYIEQGFAKLCRGAG  150



>ref|XP_009348702.1| PREDICTED: thioredoxin-like 4, chloroplastic [Pyrus x bretschneideri]
 ref|XP_009348716.1| PREDICTED: thioredoxin-like 4, chloroplastic [Pyrus x bretschneideri]
Length=211

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 92/162 (57%), Gaps = 34/162 (21%)
 Frame = +2

Query  191  LMQRLSVL--GCKASFGFGRSFNDQKLGCLAGSIL-----------PIIRKNAIESCYIK  331
            +M R S+L    KASF F    N  KLG  + S +            II+  A+E     
Sbjct  1    MMHRQSILYGKAKASFNFVTKPN-TKLGSTSPSQVKSRLLRTRNTSTIIKTTALEVSGF-  58

Query  332  TRGVFRLGNVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEE  511
             RG FR  +VE ++       +   ++D+V                CPVECVREF TD E
Sbjct  59   -RGAFR--HVEARVATGNLGELSEEDDDDV----------------CPVECVREFRTDAE  99

Query  512  FSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            FS+I+E+A+++GALVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  100  FSKILERARESGALVVVDFYRTSCGSCKYIEQGFAKLCKGAG  141



>gb|AFH68081.1| thioredoxin-like protein 3 [Populus tremula x Populus tremuloides]
Length=172

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 68/94 (72%), Gaps = 6/94 (6%)
 Frame = +2

Query  356  NVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKA  535
            N  K   A R  RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EKA
Sbjct  15   NFPKNSGAWRPGRIKAVVDENPAELSDEDDD------LCPVDCVREFKTDEEFLRILEKA  68

Query  536  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  69   KETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  102



>ref|XP_008393810.1| PREDICTED: thioredoxin-like 4, chloroplastic [Malus domestica]
Length=238

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 94/165 (57%), Gaps = 33/165 (20%)
 Frame = +2

Query  179  LQLALMQRLSVL-GCKASFGFGRSFN-DQKLG---------CLAGSILPI-IRKNAIESC  322
            L   LMQR ++L G KA+  F  + N + K G         CL  +  P  I K    S 
Sbjct  22   LXFVLMQRQTILYGSKATASFNFATNPNTKHGSTSPFQVKFCLVKANFPSNIIKGLEASG  81

Query  323  YIKTRGVFRLGNVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNT  502
            Y   R  F  G+VE ++ +     +   ++D+V                CPVECVREF+T
Sbjct  82   Y---RHAF--GHVEVRVASGNLGELAEEDDDDV----------------CPVECVREFST  120

Query  503  DEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            D EFS+I+E AK+TGALVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  121  DAEFSKILETAKETGALVVVDFYRTSCGSCKYIEQGFSKLCKGAG  165



>ref|XP_009359520.1| PREDICTED: thioredoxin-like 4, chloroplastic [Pyrus x bretschneideri]
Length=238

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 90/163 (55%), Gaps = 29/163 (18%)
 Frame = +2

Query  179  LQLALMQRLSVL-GCKASFGFGRSFNDQKLGCLAGSILPI-----IRKNAIESCYIKTRG  340
            L   LMQR ++L G KA+  F    N   L    GS  P      + K    S  IK   
Sbjct  22   LAFVLMQRQTILYGSKATASFNFVTN---LNTKHGSTSPFQVKFCLVKANFPSNIIKGLE  78

Query  341  V----FRLGNVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDE  508
            V       G+VE ++ +     +   ++D+V                CPVECVREF+TD 
Sbjct  79   VSGYRHAFGHVEVRVASGNLGELAEEDDDDV----------------CPVECVREFSTDA  122

Query  509  EFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            EFS+I+E AK+TGALVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  123  EFSKILETAKETGALVVVDFYRTSCGSCKYIEQGFSKLCKGAG  165



>ref|XP_006354885.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X1 
[Solanum tuberosum]
 ref|XP_006354886.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X2 
[Solanum tuberosum]
Length=215

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 94/152 (62%), Gaps = 11/152 (7%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQKLGCLAGSILPIIRKNAIESCYIKTRGVFRL----GNV  361
            MQRLS+L  + +  F RS N    G     +     + + ES + KTR   +L     NV
Sbjct  1    MQRLSILDWQCNLSF-RSINLLDGGSAHTYLHSFSCRRSSESYHPKTRLCSKLRHADPNV  59

Query  362  EKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQ  541
              Q    + S I S  +DN+          D++DELCPVECVREF TDEEFS I+EKAK+
Sbjct  60   TLQSLVRQCSEIHSTVHDNI------DELLDEEDELCPVECVREFKTDEEFSIILEKAKK  113

Query  542  TGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
             G+LVVVDF+RT+CGSCKYIEQGF KLC+G+G
Sbjct  114  AGSLVVVDFFRTACGSCKYIEQGFQKLCRGAG  145



>ref|XP_009594381.1| PREDICTED: thioredoxin-like 4, chloroplastic [Nicotiana tomentosiformis]
Length=215

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 96/153 (63%), Gaps = 13/153 (8%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQKLGCLAGSILPIIRKNAI-ESCYIKTRGVFRLG----N  358
            MQRL ++  +    F RS N    G  A ++L  +   +I ES ++K R   +L     N
Sbjct  1    MQRLGIVDWQRYLSF-RSINLLD-GEPAHTLLNSLSCTSINESSHLKARLCSKLRHADLN  58

Query  359  VEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAK  538
            V  Q    + S I S  +DN+          D++D+LCPVECVREF TDEEFS I+EKAK
Sbjct  59   VTLQSLVRQCSEIQSAVHDNI------EELLDEEDDLCPVECVREFKTDEEFSIILEKAK  112

Query  539  QTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            + G+LVVVDFYRT+CGSCKYIEQGF KLC+G+G
Sbjct  113  KAGSLVVVDFYRTACGSCKYIEQGFAKLCRGAG  145



>ref|XP_008220226.1| PREDICTED: thioredoxin-like 4, chloroplastic [Prunus mume]
Length=202

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 87/152 (57%), Gaps = 26/152 (17%)
 Frame = +2

Query  194  MQRLSVL--GCKASFGFGRSFNDQKLGCLAGSILP--IIRKNAIESCYIKTRGVFRLGNV  361
            MQ  ++L    +ASF F       KLG  + S  P  I  +  + SC I+ + + R    
Sbjct  1    MQSHTILYGKARASFNFETKLY-TKLGSTSPSEFPTSIPGRTHVRSCLIRAK-IPRCHAF  58

Query  362  EKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQ  541
            E+   +V  + +   ++D                 LCPVECVREF TDEE  RI+E AK+
Sbjct  59   ER---SVNQAEMTDEDDD-----------------LCPVECVREFKTDEELFRILETAKK  98

Query  542  TGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            TG+LVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  99   TGSLVVVDFYRTSCGSCKYIEQGFSKLCKGAG  130



>ref|XP_007017236.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY14461.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao]
Length=216

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 91/154 (59%), Gaps = 13/154 (8%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQKLGCLAGSILPIIRKN--AIESCYIKTRG---VFRLGN  358
            M + ++L  KASF F ++ + Q L       LP +  N   + SC ++ +        G 
Sbjct  1    MHKQNMLHSKASFIFRKNLDGQ-LNYRIPCSLPSLHNNQSHVNSCLMRVKTPAMTITAGL  59

Query  359  VEKQIC-AVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKA  535
               +I   +    I  V ++N  EL +   D      LCPV+CVREF TDEEF +I++KA
Sbjct  60   DSLEISHTLHPGCIKGVADENQGELSDEDDD------LCPVDCVREFKTDEEFLKILDKA  113

Query  536  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  114  KETNSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>ref|XP_010525983.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X3 [Tarenaya 
hassleriana]
Length=219

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>ref|XP_008777945.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X3 [Phoenix 
dactylifera]
Length=181

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  147



>ref|XP_008444622.1| PREDICTED: thioredoxin-like 4, chloroplastic [Cucumis melo]
Length=206

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 82/147 (56%), Gaps = 13/147 (9%)
 Frame = +2

Query  197  QRLSVLGCKASFGFGRSFNDQKLGCLAGSILPIIRKNAIESCYIKTRGVFRLGNVEKQIC  376
            Q  +VL CK    FG   N++       S +PI+    + S     R       V +   
Sbjct  4    QNQNVLQCKTLISFGLHPNEK-----LESRIPILIPRWLSSEKEPVRLSITRPEVPRHQL  58

Query  377  AVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQTGALV  556
              +S     VN  N  E+ +   D      LCPV+CVREF TDEEF +I++KAK+ G LV
Sbjct  59   LYKSK--MRVNAGNQGEMGDEDDD------LCPVDCVREFKTDEEFIKILDKAKENGGLV  110

Query  557  VVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            VVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  111  VVDFYRTSCGSCKYIEQGFAKLCKGSG  137



>ref|XP_008351997.1| PREDICTED: thioredoxin-like 4, chloroplastic [Malus domestica]
Length=238

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 92/165 (56%), Gaps = 33/165 (20%)
 Frame = +2

Query  179  LQLALMQRLSVL-GCKASFGFGRSFN-DQKLG---------CLAGSILPI-IRKNAIESC  322
            L   LMQR ++L G KA+  F  + N + K G         CL  +  P  I K    S 
Sbjct  22   LAFVLMQRQTILYGSKATASFNFATNPNTKHGSTSPFQVKFCLVKANFPSNIIKGLEASG  81

Query  323  YIKTRGVFRLGNVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNT  502
            Y   R  F  G+V  ++ +     +   ++D+V                CPV CVREF+T
Sbjct  82   Y---RHAF--GHVXVRVASGNLGELAEEDDDDV----------------CPVXCVREFST  120

Query  503  DEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            D EFS+I+E AK+TGALVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  121  DAEFSKILETAKETGALVVVDFYRTSCGSCKYIEQGFSKLCKGAG  165



>ref|XP_006581243.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Glycine max]
Length=222

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEFS+I++KAK+TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG
Sbjct  94   LCPVECVREFTTDEEFSKILDKAKETGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSG  150



>ref|XP_010943061.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X3 [Elaeis 
guineensis]
Length=184

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  94   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  150



>ref|XP_010943060.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=198

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  94   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  150



>ref|XP_008777942.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=213

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  147



>ref|XP_010525984.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X4 [Tarenaya 
hassleriana]
Length=218

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>ref|XP_010525985.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X5 [Tarenaya 
hassleriana]
Length=206

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  53   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  109



>ref|XP_010943054.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010943055.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010943057.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010943058.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010943059.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=216

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  94   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  150



>ref|XP_004150883.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Cucumis sativus]
 ref|XP_004168318.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Cucumis sativus]
 gb|KGN62507.1| hypothetical protein Csa_2G357300 [Cucumis sativus]
Length=206

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 82/147 (56%), Gaps = 13/147 (9%)
 Frame = +2

Query  197  QRLSVLGCKASFGFGRSFNDQKLGCLAGSILPIIRKNAIESCYIKTRGVFRLGNVEKQIC  376
            Q  +VL CK    FG + N++         +PI+    + S     R       V +   
Sbjct  4    QNQNVLQCKTLISFGLNPNEK-----MEPRIPILIPRWLSSEKEPVRLSITRPEVPRNQL  58

Query  377  AVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQTGALV  556
              +S     VN  N  EL +   D      LCPV+CVREF TDEEF +I++KAK+ G LV
Sbjct  59   LYKSK--MRVNAGNQGELSDEDDD------LCPVDCVREFKTDEEFIKILDKAKENGGLV  110

Query  557  VVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            VVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  111  VVDFYRTSCGSCKYIEQGFAKLCKGSG  137



>ref|XP_010525982.1| PREDICTED: uncharacterized protein LOC104803677 isoform X2 [Tarenaya 
hassleriana]
Length=231

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  78   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  134



>ref|XP_010525980.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010525981.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Tarenaya 
hassleriana]
Length=244

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>ref|XP_003523931.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X1 
[Glycine max]
 gb|KHN04499.1| Thioredoxin-like 4, chloroplastic [Glycine soja]
Length=215

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEFS+I++KAK+TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG
Sbjct  87   LCPVECVREFTTDEEFSKILDKAKETGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSG  143



>ref|XP_010108614.1| Thioredoxin-like 4 [Morus notabilis]
 gb|EXC19770.1| Thioredoxin-like 4 [Morus notabilis]
Length=206

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 89/149 (60%), Gaps = 14/149 (9%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQ-KLGCLAGSILPIIRKNAIESCYIKTRGVFRLGNVEKQ  370
            MQR +   CKA F   R  N Q K    +     I+ ++ ++ C   ++   +     + 
Sbjct  1    MQRQNTFYCKAFFSSRRISNRQLKSSSSSIYSSSILGRSHVKLCLKGSKVSLKFS---RT  57

Query  371  ICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQTGA  550
            I  V++   +    + +DE          D++LCPVECVREF TDEEF +I++KAK+T +
Sbjct  58   IELVKTKAAYESREEILDE----------DEDLCPVECVREFKTDEEFLKILDKAKETDS  107

Query  551  LVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LVVVDFYRTSCGSCKYIEQGF KLC+GSG
Sbjct  108  LVVVDFYRTSCGSCKYIEQGFAKLCRGSG  136



>ref|XP_008777943.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=196

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  147



>ref|XP_006578025.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X2 
[Glycine max]
Length=202

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEFS+I++KAK+TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG
Sbjct  87   LCPVECVREFTTDEEFSKILDKAKETGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSG  143



>ref|XP_006434769.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48009.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|KDO84177.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
Length=163

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>gb|KDO84170.1| hypothetical protein CISIN_1g0278901mg, partial [Citrus sinensis]
 gb|KDO84171.1| hypothetical protein CISIN_1g0278901mg, partial [Citrus sinensis]
Length=177

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>gb|KDO84176.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
Length=163

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>ref|XP_006434767.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 ref|XP_006434770.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 ref|XP_006434772.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48007.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48010.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48012.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|KDO84172.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
 gb|KDO84173.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
 gb|KDO84174.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
 gb|KDO84175.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
Length=170

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>gb|KDO84169.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
Length=201

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>ref|XP_006434766.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 ref|XP_006434768.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48006.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48008.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
Length=217

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>ref|XP_006434771.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48011.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
Length=204

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>gb|KJB58475.1| hypothetical protein B456_009G211800 [Gossypium raimondii]
 gb|KJB58476.1| hypothetical protein B456_009G211800 [Gossypium raimondii]
Length=214

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF TDEEF +I+EKAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  89   LCPVDCVREFKTDEEFLKILEKAKETNSLVVVDFYRTSCGSCKYIEQGFSKLCKGAG  145



>ref|XP_006473325.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Citrus sinensis]
Length=217

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  147



>gb|EYU25424.1| hypothetical protein MIMGU_mgv1a013495mg [Erythranthe guttata]
Length=219

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF TDEEF+ IMEKA +  ALV+VDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  89   LCPVDCVREFQTDEEFAGIMEKANEVNALVIVDFYRTSCGSCKYIEQGFAKLCKGSG  145



>ref|XP_007017237.1| Thioredoxin superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY14462.1| Thioredoxin superfamily protein isoform 2 [Theobroma cacao]
Length=194

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF TDEEF +I++KAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  69   LCPVDCVREFKTDEEFLKILDKAKETNSLVVVDFYRTSCGSCKYIEQGFSKLCKGSG  125



>ref|XP_008375989.1| PREDICTED: thioredoxin-like 4, chloroplastic [Malus domestica]
 ref|XP_008356944.1| PREDICTED: thioredoxin-like 4, chloroplastic [Malus domestica]
Length=211

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 87/158 (55%), Gaps = 26/158 (16%)
 Frame = +2

Query  191  LMQRLSVL--GCKASFGFGRSFNDQKLGCLAGS-ILPIIRKNAIESCYIKTRGVF-----  346
            +M R S+L    KA   F    N  KLG  + S +   + +    S  IKT  +      
Sbjct  1    MMHRQSILYGKAKAXXNFVTKPN-TKLGSTSPSQVKSRLLRAXNPSTIIKTTALXVSGFX  59

Query  347  -RLGNVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRI  523
               G+VE ++       +   ++D+V                CPVECVREF TD EFS+I
Sbjct  60   GAFGHVEARVAXGNLGELSEEDDDDV----------------CPVECVREFRTDXEFSKI  103

Query  524  MEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +E A+++GALVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  104  LEXARESGALVVVDFYRTSCGSCKYIEQGFSKLCKGAG  141



>ref|XP_007136685.1| hypothetical protein PHAVU_009G065200g [Phaseolus vulgaris]
 gb|ESW08679.1| hypothetical protein PHAVU_009G065200g [Phaseolus vulgaris]
Length=212

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF +DEEFS+I+EKAK+ G+LVVVDF+RTSCGSCKYIEQGF KLCK SG
Sbjct  84   LCPVECVREFTSDEEFSKILEKAKERGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSG  140



>ref|XP_004501566.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004501567.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=217

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEF RI+EK+K TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG
Sbjct  89   LCPVECVREFKTDEEFFRILEKSKGTGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSG  145



>gb|KCW66422.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
 gb|KCW66423.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
Length=184

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF TDEEF RI+ KAK+T ALVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  94   LCPVDCVREFKTDEEFLRILGKAKETNALVVVDFYRTSCGSCKYIEQGFAKLCKGAG  150



>ref|XP_010059934.1| PREDICTED: thioredoxin-like 4, chloroplastic [Eucalyptus grandis]
 ref|XP_010059935.1| PREDICTED: thioredoxin-like 4, chloroplastic [Eucalyptus grandis]
 gb|KCW66418.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
 gb|KCW66419.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
 gb|KCW66420.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
 gb|KCW66421.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
Length=216

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF TDEEF RI+ KAK+T ALVVVDFYRTSCGSCKYIEQGF KLCKG+G
Sbjct  94   LCPVDCVREFKTDEEFLRILGKAKETNALVVVDFYRTSCGSCKYIEQGFAKLCKGAG  150



>ref|XP_009775491.1| PREDICTED: thioredoxin-like 4, chloroplastic [Nicotiana sylvestris]
 ref|XP_009775492.1| PREDICTED: thioredoxin-like 4, chloroplastic [Nicotiana sylvestris]
Length=215

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  470  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            CPVECVREF TDEEFS I+EKAK+ G+LVVVDFYRT+CGSCKYIEQGF KLC+G+G
Sbjct  90   CPVECVREFKTDEEFSIILEKAKKAGSLVVVDFYRTACGSCKYIEQGFAKLCRGAG  145



>ref|XP_009401435.1| PREDICTED: thioredoxin-like 4, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=209

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CVREF T+EEF+RI++KAK  G+LVVVDFYR SCGSCKYIEQGF KLCKGSG
Sbjct  87   LCPVDCVREFKTEEEFARILDKAKAAGSLVVVDFYRASCGSCKYIEQGFAKLCKGSG  143



>ref|XP_010263549.1| PREDICTED: thioredoxin-like 4, chloroplastic [Nelumbo nucifera]
Length=218

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 83/157 (53%), Gaps = 21/157 (13%)
 Frame = +2

Query  194  MQRLSVLGCKASFGFGRSFNDQKLG---------CLAGSILPIIRKNAIESCYIKTRGVF  346
            MQR S+L  + SF F      QK+          C   S+LP  +         K   + 
Sbjct  1    MQRQSLLYPRVSFNF------QKIPYGLLCSGVLCAFSSLLPYRKYGRFWLVREKFPAIM  54

Query  347  RLGNVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIM  526
                V           I S+ N +  EL +   D      LCPVECVREF TD+EF +I+
Sbjct  55   ETTKVNNLKMGTAFQGIGSMPNKDQGELTDEDDD------LCPVECVREFKTDKEFFKIL  108

Query  527  EKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            EKA++T +LVVVDFYRTSCGSCKYIEQ F KLCKGSG
Sbjct  109  EKARETDSLVVVDFYRTSCGSCKYIEQVFSKLCKGSG  145



>ref|XP_010320331.1| PREDICTED: thioredoxin-like 4, chloroplastic [Solanum lycopersicum]
 ref|XP_010320332.1| PREDICTED: thioredoxin-like 4, chloroplastic [Solanum lycopersicum]
Length=215

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 93/161 (58%), Gaps = 29/161 (18%)
 Frame = +2

Query  194  MQRLSVLGCKASFGF-------GRSFND--QKLGCLAGSILPIIRKNAIESCYIKTR--G  340
            MQRLS+L  + +  F       G S +       C  GS          +S + +TR   
Sbjct  1    MQRLSILDWQCNLSFRCINLLDGESAHTLLHSFSCRRGS----------KSYHPRTRLCS  50

Query  341  VFRLG--NVEKQICAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEF  514
              R G  NV  Q    + S I S  +DN+          D++DELCPVECVREF TDEEF
Sbjct  51   KLRHGDLNVTLQSLLRQCSEIHSTVSDNI------DELLDEEDELCPVECVREFKTDEEF  104

Query  515  SRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            S I+EKAK+ G+LVVVDF+RT+CGSCKYIEQGF KLC+G+G
Sbjct  105  SIILEKAKKAGSLVVVDFFRTACGSCKYIEQGFQKLCRGAG  145



>gb|EMS47929.1| Thioredoxin-like 4, chloroplastic [Triticum urartu]
Length=144

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  470  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            CPVECV EF TDEEFSR +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  64   CPVECVTEFKTDEEFSRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  119



>dbj|BAJ87532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=170

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  470  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            CPVECV EF TDEEFSR +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  76   CPVECVTEFKTDEEFSRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  131



>ref|XP_010235574.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X3 [Brachypodium 
distachyon]
Length=209

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECV EF TDEEF+R +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  81   VCPVECVTEFKTDEEFTRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  137



>dbj|BAJ99374.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=194

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  470  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            CPVECV EF TDEEFSR +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  62   CPVECVTEFKTDEEFSRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  117



>gb|EMT00850.1| Thioredoxin [Aegilops tauschii]
Length=213

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  470  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            CPVECV EF TDEEFSR +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  83   CPVECVTEFKTDEEFSRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  138



>ref|XP_003575193.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=209

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECV EF TDEEF+R +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  81   VCPVECVTEFKTDEEFTRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  137



>ref|XP_010235573.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=216

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECV EF TDEEF+R +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  81   VCPVECVTEFKTDEEFTRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  137



>gb|EPS71637.1| hypothetical protein M569_03123, partial [Genlisea aurea]
Length=133

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CV+EF T+EEFSRI+ KA+ + ALVVVDFYRTSCGSCKYIEQGF K+C+G+G
Sbjct  10   LCPVDCVKEFKTEEEFSRILSKAEASNALVVVDFYRTSCGSCKYIEQGFAKICRGAG  66



>ref|XP_006647405.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Oryza brachyantha]
Length=221

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
             CPVECV EF TDEEF R++E++K TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  86   FCPVECVTEFKTDEEFLRVLERSKATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  142



>ref|XP_010667619.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=219

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECVREF TDEEF +I+EK+K+  +LVVVDFYRTSCGSCKYIEQGF KLCK SG
Sbjct  100  VCPVECVREFKTDEEFLKILEKSKKKNSLVVVDFYRTSCGSCKYIEQGFSKLCKASG  156



>ref|XP_006838053.1| hypothetical protein AMTR_s00091p00126620 [Amborella trichopoda]
 gb|ERN00622.1| hypothetical protein AMTR_s00091p00126620 [Amborella trichopoda]
Length=182

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 77/130 (59%), Gaps = 20/130 (15%)
 Frame = +2

Query  248  FNDQKLGCLAGSILPIIRKNAIESCYIKTRGVFRLGNVEKQICAVRSSRIWSVNNDNVDE  427
            FN  K    + ++ P+I    +++  +K    F+  + +K++     ++      D  DE
Sbjct  3    FNHVKFLLASQNVPPVIEAKKLDT--LKVCHAFQAADSQKKL---DENKKGHCAEDEDDE  57

Query  428  LFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQ  607
            L             CPVECVREF TD EFS+I+EKAK +  LVVVDFYRTSCGSCKYIEQ
Sbjct  58   L-------------CPVECVREFMTDMEFSKILEKAKDS--LVVVDFYRTSCGSCKYIEQ  102

Query  608  GFVKLCKGSG  637
            GF KLCKGSG
Sbjct  103  GFSKLCKGSG  112



>ref|XP_010667621.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=209

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECVREF TDEEF +I+EK+K+  +LVVVDFYRTSCGSCKYIEQGF KLCK SG
Sbjct  90   VCPVECVREFKTDEEFLKILEKSKKKNSLVVVDFYRTSCGSCKYIEQGFSKLCKASG  146



>gb|AGV54863.1| thioredoxin-like 4 chloroplastic-like protein [Phaseolus vulgaris]
Length=215

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF  DEEFS+I+EKAK+ G+LVVVDF+RTSCGSCKYIEQGF KLCK  G
Sbjct  87   LCPVECVREFTCDEEFSKILEKAKERGSLVVVDFFRTSCGSCKYIEQGFAKLCKKFG  143



>gb|AIN39829.1| hypothetical protein [Zoysia matrella]
Length=214

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
             CPV+CV EF TDEEF R +E+AK TGALVVVDFYR SCGSCKYIE+GF++LCKGSG
Sbjct  85   FCPVDCVTEFKTDEEFRRHLERAKATGALVVVDFYRPSCGSCKYIERGFMRLCKGSG  141



>gb|AFK47986.1| unknown [Lotus japonicus]
Length=213

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECVREF TDEEF +I++KAK+ G+LVVVDF+RTSCGSCKYIEQGF KLC+ SG
Sbjct  85   VCPVECVREFKTDEEFCKILDKAKRAGSLVVVDFFRTSCGSCKYIEQGFAKLCRKSG  141



>ref|XP_002889657.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65916.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 6/88 (7%)
 Frame = +2

Query  374  CAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQTGAL  553
            C  +  R  S++ +NV EL +   D      LCPVECV EF TD+E  R++EK+K+T +L
Sbjct  58   CTFQHGRAKSLSQENVVELSDENDD------LCPVECVTEFKTDDELLRVLEKSKETNSL  111

Query  554  VVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            VVVDFYRT+CGSCKYIEQGF KLCK SG
Sbjct  112  VVVDFYRTACGSCKYIEQGFSKLCKQSG  139



>ref|XP_003603045.1| Thioredoxin H-type 3 [Medicago truncatula]
Length=162

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECVREF TD+EF +I++K+K TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG
Sbjct  34   VCPVECVREFKTDDEFLKILDKSKGTGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSG  90



>gb|AES73296.2| thioredoxin [Medicago truncatula]
Length=218

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECVREF TD+EF +I++K+K TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG
Sbjct  90   VCPVECVREFKTDDEFLKILDKSKGTGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSG  146



>emb|CDP01361.1| unnamed protein product [Coffea canephora]
Length=221

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  470  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            CPV+CV+EF T+EEF +I+EKA++  +LVVVDFYRTSCGSCKYIEQGF KLCKGSG
Sbjct  89   CPVDCVKEFQTNEEFFQILEKAEKANSLVVVDFYRTSCGSCKYIEQGFAKLCKGSG  144



>ref|XP_009137448.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Brassica 
rapa]
Length=159

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E  R++EKAK+T  LVVVDFYR SCGSCKYIEQGF KLCK SG
Sbjct  31   LCPVECVTEFKTDDELLRVLEKAKETNTLVVVDFYRPSCGSCKYIEQGFSKLCKQSG  87



>emb|CDX92634.1| BnaC07g38920D [Brassica napus]
Length=159

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E  R++EKAK+T  LVVVDFYR SCGSCKYIEQGF KLCK SG
Sbjct  31   LCPVECVTEFRTDDELLRVLEKAKETNTLVVVDFYRPSCGSCKYIEQGFSKLCKQSG  87



>ref|XP_002454035.1| hypothetical protein SORBIDRAFT_04g023500 [Sorghum bicolor]
 gb|EES07011.1| hypothetical protein SORBIDRAFT_04g023500 [Sorghum bicolor]
Length=216

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
             CPV+CV EF T+EEF R +E++K TGALVVVDFYR SCGSCKYIE+GF++LCKGSG
Sbjct  82   FCPVDCVTEFKTEEEFQRHLERSKATGALVVVDFYRPSCGSCKYIEKGFIRLCKGSG  138



>ref|XP_011458932.1| PREDICTED: thioredoxin-like 4, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=209

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECVREF TDEEF +I++ AK++ +LVVVDFYRTSCGSCKYIEQGF KLCK +G
Sbjct  82   LCPVECVREFYTDEEFFKILDAAKESHSLVVVDFYRTSCGSCKYIEQGFSKLCKRAG  138



>ref|XP_009137446.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009137447.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Brassica 
rapa]
Length=209

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E  R++EKAK+T  LVVVDFYR SCGSCKYIEQGF KLCK SG
Sbjct  81   LCPVECVTEFKTDDELLRVLEKAKETNTLVVVDFYRPSCGSCKYIEQGFSKLCKQSG  137



>emb|CDY11014.1| BnaA03g46730D [Brassica napus]
Length=209

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E  R++EKAK+T  LVVVDFYR SCGSCKYIEQGF KLCK SG
Sbjct  81   LCPVECVTEFKTDDELLRVLEKAKETNTLVVVDFYRPSCGSCKYIEQGFSKLCKQSG  137



>ref|XP_010487849.1| PREDICTED: thioredoxin-like 4, chloroplastic [Camelina sativa]
 ref|XP_010487858.1| PREDICTED: thioredoxin-like 4, chloroplastic [Camelina sativa]
Length=208

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E  R++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SG
Sbjct  85   LCPVECVTEFKTDDELLRVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSG  141



>ref|XP_002879039.1| thioredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55298.1| thioredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=169

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +2

Query  374  CAVRSSRIWSVNNDNVDELFNgggdeddddeLCPVECVREFNTDEEFSRIMEKAKQTGAL  553
            C  +  R  S++ +NV EL +   D      LCPVECV EF TD+E  R++EK+K+T +L
Sbjct  58   CTFQHGRAKSLSQENVVELSDENDD------LCPVECVTEFKTDDELLRVLEKSKETNSL  111

Query  554  VVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            VVVDFYRT+CGSC YIEQGF K+CK SG
Sbjct  112  VVVDFYRTACGSCTYIEQGFSKVCKQSG  139



>ref|XP_006304213.1| hypothetical protein CARUB_v10010324mg [Capsella rubella]
 ref|XP_006304214.1| hypothetical protein CARUB_v10010324mg [Capsella rubella]
 gb|EOA37111.1| hypothetical protein CARUB_v10010324mg [Capsella rubella]
 gb|EOA37112.1| hypothetical protein CARUB_v10010324mg [Capsella rubella]
Length=203

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E  R++EK+K+T  LVVVDFYRT+CGSCKYIEQGF KLCK SG
Sbjct  80   LCPVECVTEFKTDDELLRVLEKSKETNTLVVVDFYRTACGSCKYIEQGFSKLCKQSG  136



>ref|XP_006413424.1| hypothetical protein EUTSA_v10026224mg [Eutrema salsugineum]
 gb|ESQ54877.1| hypothetical protein EUTSA_v10026224mg [Eutrema salsugineum]
Length=168

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECV EF TD+E  R++EKAK+T +LVVVDFYR SCGSCKYIEQGF KLCK SG
Sbjct  86   VCPVECVTEFKTDDELLRVLEKAKETNSLVVVDFYRPSCGSCKYIEQGFSKLCKQSG  142



>ref|XP_006413425.1| hypothetical protein EUTSA_v10026224mg [Eutrema salsugineum]
 gb|ESQ54878.1| hypothetical protein EUTSA_v10026224mg [Eutrema salsugineum]
Length=213

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPVECV EF TD+E  R++EKAK+T +LVVVDFYR SCGSCKYIEQGF KLCK SG
Sbjct  86   VCPVECVTEFKTDDELLRVLEKAKETNSLVVVDFYRPSCGSCKYIEQGFSKLCKQSG  142



>ref|NP_973780.1| thioredoxin family protein [Arabidopsis thaliana]
 gb|AEE28163.1| thioredoxin family protein [Arabidopsis thaliana]
Length=171

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E   ++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SG
Sbjct  81   LCPVECVTEFKTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSG  137



>ref|XP_010475538.1| PREDICTED: thioredoxin-like 4, chloroplastic [Camelina sativa]
 ref|XP_010475539.1| PREDICTED: thioredoxin-like 4, chloroplastic [Camelina sativa]
Length=209

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E  +++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SG
Sbjct  86   LCPVECVTEFKTDDELLKVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSG  142



>gb|AFW71917.1| thioredoxin-like 2 [Zea mays]
Length=213

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CV EF TDEEF R + +++ TGALVVVDFYR SCGSCKYIE+ F +LCKGSG
Sbjct  85   LCPVDCVTEFKTDEEFQRHLNRSRATGALVVVDFYRPSCGSCKYIEKAFTRLCKGSG  141



>ref|NP_001151688.1| thioredoxin-like 2 [Zea mays]
 gb|ACG43905.1| thioredoxin-like 2 [Zea mays]
Length=223

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPV+CV EF TDEEF R + +++ TGALVVVDFYR SCGSCKYIE+ F +LCKGSG
Sbjct  85   LCPVDCVTEFKTDEEFQRHLNRSRATGALVVVDFYRPSCGSCKYIEKAFTRLCKGSG  141



>ref|NP_563794.1| thioredoxin family protein [Arabidopsis thaliana]
 sp|Q9C5C5.1|TRL4_ARATH RecName: Full=Thioredoxin-like 4, chloroplastic; AltName: Full=Lilium-type 
thioredoxin 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK28642.1|AF360345_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93759.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01521.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28164.1| thioredoxin family protein [Arabidopsis thaliana]
Length=204

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E   ++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SG
Sbjct  81   LCPVECVTEFKTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSG  137



>ref|NP_973781.1| thioredoxin family protein [Arabidopsis thaliana]
 gb|AEE28165.1| thioredoxin family protein [Arabidopsis thaliana]
Length=217

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCPVECV EF TD+E   ++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SG
Sbjct  94   LCPVECVTEFKTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSG  150



>ref|XP_004952710.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Setaria italica]
Length=199

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            +CPV+CV EF TDEEF R +E++K TGALVVVDFYR SCGSCKYIE+ F++LCKGS 
Sbjct  67   VCPVDCVTEFKTDEEFVRHLERSKATGALVVVDFYRPSCGSCKYIEKRFMRLCKGSA  123



>gb|EEC73438.1| hypothetical protein OsI_07725 [Oryza sativa Indica Group]
Length=214

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  485  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            V EF T+EE +R++E+AK TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  85   VTEFKTEEELARVLERAKATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  135



>ref|NP_001047177.1| Os02g0567100 [Oryza sativa Japonica Group]
 sp|Q6YTI3.1|TRL4_ORYSJ RecName: Full=Thioredoxin-like 4, chloroplastic; AltName: Full=Lilium-type 
thioredoxin 3; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD17754.1| thioredoxin-like protein [Oryza sativa Japonica Group]
 dbj|BAF09091.1| Os02g0567100 [Oryza sativa Japonica Group]
 dbj|BAG87960.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57221.1| hypothetical protein OsJ_07192 [Oryza sativa Japonica Group]
Length=214

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  485  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            V EF T+EE +R++E+AK TGALVVVDF+R SCGSCKYIEQGF+KLCKGSG
Sbjct  85   VTEFKTEEELARVLERAKATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSG  135



>ref|XP_001764331.1| predicted protein [Physcomitrella patens]
 gb|EDQ70885.1| predicted protein, partial [Physcomitrella patens]
Length=125

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCP+ECVRE NT  E   +++ +K +G+LVVVDF+RTSCGSC+YIE+GF KLCKG+G
Sbjct  7    LCPIECVREINTLNELEHVVQDSKTSGSLVVVDFFRTSCGSCRYIEKGFQKLCKGAG  63



>ref|XP_001780167.1| predicted protein [Physcomitrella patens]
 gb|EDQ55008.1| predicted protein, partial [Physcomitrella patens]
Length=122

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSG  637
            LCP+ECVRE  T  E   I++++K  G LVVVDF+RTSCG+C+YIE+GF KLCKG+G
Sbjct  4    LCPIECVREITTLRELEHIIQESKSAGDLVVVDFFRTSCGTCRYIEKGFQKLCKGAG  60



>ref|XP_005647696.1| hypothetical protein COCSUDRAFT_15621 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23152.1| hypothetical protein COCSUDRAFT_15621 [Coccomyxa subellipsoidea 
C-169]
Length=106

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  554  VVVDFYRTSCGSCKYIEQGFVKLCKGS  634
            VVVDF++T+CGSC+YI+ GF+KLC+ S
Sbjct  8    VVVDFFKTACGSCRYIQPGFIKLCRAS  34



>gb|ACU17167.1| unknown [Glycine max]
Length=70

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -3

Query  628  LAELHESLLDVLAAATRRAVEVHHNQSASLLCLLHYSREFLIRVKFSHAFNRAQL  464
            LA+  ++LL +LAA+TR A E+HHNQ +S   L+    E  I  +FS+ FN  ++
Sbjct  6    LAQFCKTLLYILAASTRGAKEIHHNQRSSFFSLVQNFAELFISGEFSYTFNGTEI  60



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750