BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF037D16

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08711.1|  unnamed protein product                                293   1e-94   Coffea canephora [robusta coffee]
ref|XP_004248074.1|  PREDICTED: mitochondrial adenine nucleotide ...    290   2e-93   Solanum lycopersicum
ref|XP_006358640.1|  PREDICTED: mitochondrial adenine nucleotide ...    286   5e-92   Solanum tuberosum [potatoes]
ref|XP_009626771.1|  PREDICTED: mitochondrial adenine nucleotide ...    286   5e-92   Nicotiana tomentosiformis
ref|XP_009779970.1|  PREDICTED: mitochondrial adenine nucleotide ...    286   5e-92   Nicotiana sylvestris
gb|KDP25326.1|  hypothetical protein JCGZ_20482                         286   7e-92   Jatropha curcas
ref|XP_010326870.1|  PREDICTED: mitochondrial adenine nucleotide ...    285   2e-91   Solanum lycopersicum
ref|XP_002509930.1|  Grave disease carrier protein, putative            285   2e-91   Ricinus communis
gb|EYU38910.1|  hypothetical protein MIMGU_mgv1a009053mg                283   6e-91   Erythranthe guttata [common monkey flower]
ref|XP_002320851.2|  mitochondrial substrate carrier family protein     282   2e-90   Populus trichocarpa [western balsam poplar]
ref|XP_002532663.1|  Grave disease carrier protein, putative            282   3e-90   Ricinus communis
ref|XP_002273414.1|  PREDICTED: mitochondrial adenine nucleotide ...    281   5e-90   Vitis vinifera
ref|XP_010266452.1|  PREDICTED: mitochondrial adenine nucleotide ...    281   6e-90   Nelumbo nucifera [Indian lotus]
gb|KHG26522.1|  Mitochondrial substrate carrier family protein B        281   7e-90   Gossypium arboreum [tree cotton]
ref|NP_001275102.1|  mitochondrial carrier-like protein                 280   8e-90   Solanum tuberosum [potatoes]
gb|KJB41486.1|  hypothetical protein B456_007G106400                    280   9e-90   Gossypium raimondii
gb|KJB21318.1|  hypothetical protein B456_004G043200                    280   9e-90   Gossypium raimondii
gb|KJB41485.1|  hypothetical protein B456_007G106400                    280   2e-89   Gossypium raimondii
ref|XP_007051615.1|  Adenine nucleotide transporter 1                   280   2e-89   Theobroma cacao [chocolate]
gb|KJB24249.1|  hypothetical protein B456_004G135200                    275   3e-89   Gossypium raimondii
ref|XP_010326872.1|  PREDICTED: mitochondrial adenine nucleotide ...    278   7e-89   Solanum lycopersicum
gb|KDP28516.1|  hypothetical protein JCGZ_14287                         278   8e-89   Jatropha curcas
ref|XP_010261496.1|  PREDICTED: mitochondrial adenine nucleotide ...    277   2e-88   Nelumbo nucifera [Indian lotus]
ref|XP_011093457.1|  PREDICTED: mitochondrial adenine nucleotide ...    276   3e-88   Sesamum indicum [beniseed]
ref|XP_010914053.1|  PREDICTED: mitochondrial adenine nucleotide ...    276   3e-88   Elaeis guineensis
ref|XP_010669340.1|  PREDICTED: mitochondrial adenine nucleotide ...    276   3e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004133837.1|  PREDICTED: mitochondrial substrate carrier f...    276   5e-88   Cucumis sativus [cucumbers]
gb|KJB49521.1|  hypothetical protein B456_008G123800                    276   6e-88   Gossypium raimondii
ref|XP_011037758.1|  PREDICTED: mitochondrial adenine nucleotide ...    276   6e-88   Populus euphratica
gb|KJB49524.1|  hypothetical protein B456_008G123800                    276   7e-88   Gossypium raimondii
ref|XP_002280675.1|  PREDICTED: mitochondrial adenine nucleotide ...    276   7e-88   Vitis vinifera
ref|XP_003548513.1|  PREDICTED: mitochondrial adenine nucleotide ...    276   7e-88   Glycine max [soybeans]
gb|KJB24248.1|  hypothetical protein B456_004G135200                    275   8e-88   Gossypium raimondii
ref|XP_011026923.1|  PREDICTED: mitochondrial adenine nucleotide ...    275   8e-88   Populus euphratica
gb|KJB24251.1|  hypothetical protein B456_004G135200                    275   8e-88   Gossypium raimondii
ref|XP_008437971.1|  PREDICTED: mitochondrial adenine nucleotide ...    275   1e-87   Cucumis melo [Oriental melon]
ref|XP_003528803.1|  PREDICTED: mitochondrial adenine nucleotide ...    275   1e-87   Glycine max [soybeans]
gb|EYU32214.1|  hypothetical protein MIMGU_mgv1a009069mg                275   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_010544796.1|  PREDICTED: mitochondrial adenine nucleotide ...    275   1e-87   Tarenaya hassleriana [spider flower]
gb|KJB24246.1|  hypothetical protein B456_004G135200                    275   1e-87   Gossypium raimondii
ref|XP_006444883.1|  hypothetical protein CICLE_v10020846mg             275   2e-87   Citrus clementina [clementine]
ref|XP_009415476.1|  PREDICTED: mitochondrial adenine nucleotide ...    275   2e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB21316.1|  hypothetical protein B456_004G043200                    274   3e-87   Gossypium raimondii
ref|XP_009377876.1|  PREDICTED: mitochondrial adenine nucleotide ...    274   3e-87   Pyrus x bretschneideri [bai li]
ref|XP_011023215.1|  PREDICTED: mitochondrial adenine nucleotide ...    273   4e-87   Populus euphratica
ref|XP_010523787.1|  PREDICTED: mitochondrial adenine nucleotide ...    273   5e-87   Tarenaya hassleriana [spider flower]
ref|XP_002302618.1|  mitochondrial substrate carrier family protein     273   6e-87   Populus trichocarpa [western balsam poplar]
gb|KCW78145.1|  hypothetical protein EUGRSUZ_D02348                     271   6e-87   Eucalyptus grandis [rose gum]
gb|KJB41484.1|  hypothetical protein B456_007G106400                    273   6e-87   Gossypium raimondii
gb|KHG06223.1|  Mitochondrial substrate carrier family protein B        273   6e-87   Gossypium arboreum [tree cotton]
ref|XP_007209295.1|  hypothetical protein PRUPE_ppa007764mg             273   7e-87   Prunus persica
ref|XP_009336243.1|  PREDICTED: mitochondrial adenine nucleotide ...    273   7e-87   Pyrus x bretschneideri [bai li]
ref|XP_008798636.1|  PREDICTED: mitochondrial adenine nucleotide ...    273   9e-87   Phoenix dactylifera
ref|XP_008239064.1|  PREDICTED: mitochondrial adenine nucleotide ...    272   1e-86   Prunus mume [ume]
ref|XP_010053790.1|  PREDICTED: mitochondrial adenine nucleotide ...    272   2e-86   Eucalyptus grandis [rose gum]
ref|XP_008233213.1|  PREDICTED: mitochondrial adenine nucleotide ...    272   2e-86   Prunus mume [ume]
ref|XP_007135224.1|  hypothetical protein PHAVU_010G111300g             271   2e-86   Phaseolus vulgaris [French bean]
ref|XP_009377268.1|  PREDICTED: mitochondrial adenine nucleotide ...    271   2e-86   Pyrus x bretschneideri [bai li]
ref|XP_004306695.1|  PREDICTED: mitochondrial adenine nucleotide ...    271   3e-86   Fragaria vesca subsp. vesca
ref|XP_002304548.1|  hypothetical protein POPTR_0003s13730g             271   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_009410854.1|  PREDICTED: mitochondrial adenine nucleotide ...    271   4e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002297985.1|  hypothetical protein POPTR_0001s10370g             271   5e-86   Populus trichocarpa [western balsam poplar]
ref|XP_008360687.1|  PREDICTED: mitochondrial adenine nucleotide ...    271   5e-86   Malus domestica [apple tree]
gb|KEH18704.1|  grave disease carrier protein                           271   5e-86   Medicago truncatula
ref|XP_011022540.1|  PREDICTED: mitochondrial adenine nucleotide ...    271   5e-86   Populus euphratica
ref|XP_007218199.1|  hypothetical protein PRUPE_ppa007790mg             271   6e-86   Prunus persica
ref|XP_010544425.1|  PREDICTED: mitochondrial adenine nucleotide ...    271   6e-86   Tarenaya hassleriana [spider flower]
gb|ABK96372.1|  unknown                                                 271   7e-86   Populus trichocarpa x Populus deltoides
ref|XP_006654848.1|  PREDICTED: mitochondrial adenine nucleotide ...    270   7e-86   Oryza brachyantha
emb|CAN60251.1|  hypothetical protein VITISV_039402                     270   1e-85   Vitis vinifera
ref|XP_008343426.1|  PREDICTED: mitochondrial adenine nucleotide ...    270   1e-85   
gb|EPS68599.1|  hypothetical protein M569_06168                         270   2e-85   Genlisea aurea
gb|KJB52266.1|  hypothetical protein B456_008G252700                    269   2e-85   Gossypium raimondii
ref|XP_010661886.1|  PREDICTED: mitochondrial adenine nucleotide ...    269   2e-85   Vitis vinifera
ref|XP_009352376.1|  PREDICTED: mitochondrial adenine nucleotide ...    269   3e-85   Pyrus x bretschneideri [bai li]
ref|NP_001130208.1|  uncharacterized protein LOC100191302               268   6e-85   Zea mays [maize]
ref|XP_008791452.1|  PREDICTED: mitochondrial adenine nucleotide ...    268   6e-85   Phoenix dactylifera
gb|KJB49523.1|  hypothetical protein B456_008G123800                    268   6e-85   Gossypium raimondii
ref|XP_010924827.1|  PREDICTED: mitochondrial adenine nucleotide ...    268   9e-85   Elaeis guineensis
emb|CDX74363.1|  BnaA03g26840D                                          267   1e-84   
emb|CDX91877.1|  BnaC03g31790D                                          267   2e-84   
ref|XP_010522928.1|  PREDICTED: mitochondrial adenine nucleotide ...    267   2e-84   Tarenaya hassleriana [spider flower]
ref|XP_009336244.1|  PREDICTED: mitochondrial adenine nucleotide ...    266   3e-84   Pyrus x bretschneideri [bai li]
ref|XP_002441594.1|  hypothetical protein SORBIDRAFT_09g030000          266   3e-84   Sorghum bicolor [broomcorn]
ref|XP_009134513.1|  PREDICTED: mitochondrial adenine nucleotide ...    266   3e-84   Brassica rapa
ref|XP_010427766.1|  PREDICTED: mitochondrial adenine nucleotide ...    266   5e-84   Camelina sativa [gold-of-pleasure]
gb|KCW78146.1|  hypothetical protein EUGRSUZ_D02348                     265   6e-84   Eucalyptus grandis [rose gum]
ref|XP_010422770.1|  PREDICTED: mitochondrial adenine nucleotide ...    265   6e-84   Camelina sativa [gold-of-pleasure]
gb|EAY99214.1|  hypothetical protein OsI_21172                          265   7e-84   Oryza sativa Indica Group [Indian rice]
ref|NP_001056459.1|  Os05g0585900                                       265   7e-84   
ref|XP_009394146.1|  PREDICTED: mitochondrial adenine nucleotide ...    265   8e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676334.1|  PREDICTED: mitochondrial adenine nucleotide ...    265   1e-83   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO76473.1|  hypothetical protein CISIN_1g018449mg                   264   1e-83   Citrus sinensis [apfelsine]
ref|XP_006288044.1|  hypothetical protein CARUB_v10001278mg             265   2e-83   Capsella rubella
ref|XP_004961067.1|  PREDICTED: mitochondrial adenine nucleotide ...    264   2e-83   Setaria italica
ref|XP_006439393.1|  hypothetical protein CICLE_v10020845mg             264   2e-83   Citrus clementina [clementine]
ref|XP_011073667.1|  PREDICTED: mitochondrial adenine nucleotide ...    264   2e-83   Sesamum indicum [beniseed]
ref|XP_009386297.1|  PREDICTED: mitochondrial adenine nucleotide ...    263   7e-83   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK42532.1|  hypothetical protein AALP_AA1G006600                    263   9e-83   Arabis alpina [alpine rockcress]
ref|XP_006476410.1|  PREDICTED: mitochondrial adenine nucleotide ...    262   2e-82   Citrus sinensis [apfelsine]
ref|XP_009617594.1|  PREDICTED: mitochondrial adenine nucleotide ...    261   3e-82   Nicotiana tomentosiformis
ref|XP_009763306.1|  PREDICTED: mitochondrial adenine nucleotide ...    261   4e-82   Nicotiana sylvestris
ref|XP_004298882.1|  PREDICTED: mitochondrial adenine nucleotide ...    261   5e-82   Fragaria vesca subsp. vesca
ref|XP_003567810.1|  PREDICTED: mitochondrial adenine nucleotide ...    259   1e-81   Brachypodium distachyon [annual false brome]
emb|CDP12129.1|  unnamed protein product                                259   2e-81   Coffea canephora [robusta coffee]
ref|XP_006439392.1|  hypothetical protein CICLE_v10020845mg             259   2e-81   
ref|XP_004245537.1|  PREDICTED: mitochondrial adenine nucleotide ...    259   3e-81   Solanum lycopersicum
ref|XP_011093053.1|  PREDICTED: mitochondrial adenine nucleotide ...    258   3e-81   Sesamum indicum [beniseed]
ref|XP_006343883.1|  PREDICTED: mitochondrial adenine nucleotide ...    258   3e-81   Solanum tuberosum [potatoes]
dbj|BAJ94251.1|  predicted protein                                      258   6e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003521800.1|  PREDICTED: mitochondrial adenine nucleotide ...    257   7e-81   Glycine max [soybeans]
dbj|BAJ85614.1|  predicted protein                                      258   7e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010095712.1|  Pentatricopeptide repeat-containing protein        269   7e-81   
ref|XP_006396301.1|  hypothetical protein EUTSA_v10028766mg             257   1e-80   Eutrema salsugineum [saltwater cress]
ref|XP_007147281.1|  hypothetical protein PHAVU_006G110800g             256   2e-80   Phaseolus vulgaris [French bean]
ref|XP_009386307.1|  PREDICTED: mitochondrial adenine nucleotide ...    257   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010104983.1|  Mitochondrial substrate carrier family prote...    256   4e-80   Morus notabilis
ref|XP_010055845.1|  PREDICTED: mitochondrial adenine nucleotide ...    256   4e-80   Eucalyptus grandis [rose gum]
ref|XP_003554758.1|  PREDICTED: mitochondrial adenine nucleotide ...    254   1e-79   Glycine max [soybeans]
gb|KHN43116.1|  Mitochondrial substrate carrier family protein B        254   1e-79   Glycine soja [wild soybean]
gb|KHN35367.1|  Mitochondrial substrate carrier family protein B        254   1e-79   Glycine soja [wild soybean]
ref|XP_004516398.1|  PREDICTED: mitochondrial adenine nucleotide ...    253   6e-79   Cicer arietinum [garbanzo]
gb|KFK30686.1|  hypothetical protein AALP_AA6G014800                    251   2e-78   Arabis alpina [alpine rockcress]
ref|XP_006847299.1|  hypothetical protein AMTR_s00015p00209030          251   2e-78   Amborella trichopoda
ref|XP_009111419.1|  PREDICTED: mitochondrial adenine nucleotide ...    251   4e-78   Brassica rapa
ref|XP_002874996.1|  mitochondrial substrate carrier family protein     248   3e-77   
ref|XP_003521801.1|  PREDICTED: mitochondrial adenine nucleotide ...    248   7e-77   
ref|NP_192019.1|  adenine nucleotide transporter 1                      246   2e-76   Arabidopsis thaliana [mouse-ear cress]
gb|ADE77740.1|  unknown                                                 246   3e-76   Picea sitchensis
ref|XP_010055846.1|  PREDICTED: mitochondrial adenine nucleotide ...    246   6e-76   
emb|CDX71722.1|  BnaC08g31520D                                          238   2e-73   
ref|XP_007158565.1|  hypothetical protein PHAVU_002G163100g             237   3e-73   Phaseolus vulgaris [French bean]
ref|NP_001190650.1|  adenine nucleotide transporter 1                   238   3e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11371.1|  BnaA09g39370D                                          236   1e-72   Brassica napus [oilseed rape]
ref|XP_004511523.1|  PREDICTED: mitochondrial adenine nucleotide ...    235   1e-72   Cicer arietinum [garbanzo]
ref|XP_003516718.1|  PREDICTED: mitochondrial adenine nucleotide ...    234   5e-72   Glycine max [soybeans]
ref|XP_009116833.1|  PREDICTED: mitochondrial adenine nucleotide ...    234   9e-72   Brassica rapa
gb|AES93971.2|  substrate carrier family protein                        231   9e-71   Medicago truncatula
ref|XP_003538203.1|  PREDICTED: mitochondrial adenine nucleotide ...    230   3e-70   Glycine max [soybeans]
ref|XP_007040458.1|  Adenine nucleotide transporter 1 isoform 1         227   6e-69   
ref|XP_001766394.1|  predicted protein                                  227   1e-68   
gb|KJB21317.1|  hypothetical protein B456_004G043200                    225   1e-68   Gossypium raimondii
ref|XP_003611013.1|  Calcium-binding mitochondrial carrier protei...    226   2e-68   
ref|XP_006590494.1|  PREDICTED: mitochondrial adenine nucleotide ...    224   3e-68   
ref|XP_001756133.1|  predicted protein                                  223   3e-67   
gb|KJB49522.1|  hypothetical protein B456_008G123800                    221   3e-67   Gossypium raimondii
gb|KJB21315.1|  hypothetical protein B456_004G043200                    209   1e-62   Gossypium raimondii
gb|KDO76471.1|  hypothetical protein CISIN_1g018449mg                   202   3e-60   Citrus sinensis [apfelsine]
gb|EMT21891.1|  Mitochondrial substrate carrier family protein B        194   3e-57   
emb|CAN60283.1|  hypothetical protein VITISV_011983                     191   3e-55   Vitis vinifera
ref|XP_002979197.1|  hypothetical protein SELMODRAFT_233298             187   2e-53   Selaginella moellendorffii
ref|XP_008376077.1|  PREDICTED: mitochondrial adenine nucleotide ...    177   1e-52   
emb|CDY66909.1|  BnaCnng52820D                                          172   1e-50   Brassica napus [oilseed rape]
gb|AFV46218.1|  hypothetical protein                                    167   3e-46   Scutellaria baicalensis [Baikal skullcap]
gb|KJB24253.1|  hypothetical protein B456_004G135200                    146   5e-39   Gossypium raimondii
ref|XP_007040459.1|  Adenine nucleotide transporter 1 isoform 2         140   8e-37   
ref|XP_002957829.1|  mitochondrial substrate carrier                    142   1e-36   Volvox carteri f. nagariensis
ref|XP_001693350.1|  mitochondrial carrier protein                      139   1e-35   Chlamydomonas reinhardtii
ref|XP_005849239.1|  hypothetical protein CHLNCDRAFT_34838              129   7e-32   Chlorella variabilis
emb|CEF97253.1|  Mitochondrial substrate/solute carrier                 129   1e-31   Ostreococcus tauri
ref|XP_002500487.1|  predicted protein                                  127   4e-31   Micromonas commoda
ref|XP_003055917.1|  predicted protein                                  127   7e-31   Micromonas pusilla CCMP1545
ref|XP_001416737.1|  MC family transporter: aspartate/glutamate (...    126   9e-31   Ostreococcus lucimarinus CCE9901
ref|XP_005643443.1|  mitochondrial carrier protein                      123   1e-29   Coccomyxa subellipsoidea C-169
ref|XP_011399125.1|  Calcium-binding mitochondrial carrier protei...    115   7e-27   Auxenochlorella protothecoides
ref|XP_003078331.1|  putative carrier protein (ISS)                     115   3e-26   
gb|KDD76091.1|  hypothetical protein H632_c360p1                        108   9e-25   Helicosporidium sp. ATCC 50920
emb|CCX16202.1|  Similar to Uncharacterized mitochondrial carrier...    108   4e-24   Pyronema omphalodes CBS 100304
gb|KIM23813.1|  hypothetical protein M408DRAFT_76951                    105   3e-23   Serendipita vermifera MAFF 305830
gb|KIM32048.1|  hypothetical protein M408DRAFT_63862                    105   4e-23   Serendipita vermifera MAFF 305830
gb|EJT97303.1|  mitochondrial carrier                                   103   1e-22   Dacryopinax primogenitus
gb|EPS99909.1|  hypothetical protein FOMPIDRAFT_1041944                 103   2e-22   Fomitopsis pinicola FP-58527 SS1
ref|XP_008034413.1|  mitochondrial carrier                              102   3e-22   Trametes versicolor FP-101664 SS1
gb|EFQ34060.1|  hypothetical protein GLRG_09204                         102   5e-22   Colletotrichum graminicola M1.001
ref|XP_007864537.1|  mitochondrial carrier                              102   6e-22   Gloeophyllum trabeum ATCC 11539
gb|KDN61012.1|  hypothetical protein CSUB01_01149                       102   7e-22   Colletotrichum sublineola
ref|XP_007309764.1|  mitochondrial carrier                              101   1e-21   Stereum hirsutum FP-91666 SS1
ref|XP_007361771.1|  mitochondrial carrier                              101   1e-21   Dichomitus squalens LYAD-421 SS1
gb|EME42258.1|  hypothetical protein DOTSEDRAFT_73171                   100   1e-21   Dothistroma septosporum NZE10
ref|XP_011405585.1|  PREDICTED: mitochondrial adenine nucleotide ...    100   2e-21   
gb|KDQ57586.1|  hypothetical protein JAAARDRAFT_35278                   100   2e-21   Jaapia argillacea MUCL 33604
gb|EQB48539.1|  hypothetical protein CGLO_12225                         100   3e-21   Colletotrichum gloeosporioides Cg-14
ref|XP_007284603.1|  mitochondrial carrier                              100   3e-21   
gb|EZF22229.1|  hypothetical protein H100_04887                       99.4    3e-21   Trichophyton rubrum MR850
ref|XP_007511830.1|  predicted protein                                  100   3e-21   Bathycoccus prasinos
ref|XP_003851503.1|  hypothetical protein MYCGRDRAFT_100510           99.8    3e-21   Zymoseptoria tritici IPO323
gb|KEZ40628.1|  hypothetical protein SAPIO_CDS8549                    99.8    4e-21   Scedosporium apiospermum
ref|XP_002837709.1|  hypothetical protein                             99.8    4e-21   Tuber melanosporum Mel28
gb|KIZ03643.1|  putative calcium-binding carrier                      99.4    4e-21   Monoraphidium neglectum
gb|EZF33664.1|  hypothetical protein H101_02759                       99.8    4e-21   Trichophyton interdigitale H6
gb|EGE08862.1|  mitochondrial carrier protein                         99.8    4e-21   Trichophyton equinum CBS 127.97
gb|EMD37486.1|  hypothetical protein CERSUDRAFT_114129                99.8    4e-21   Gelatoporia subvermispora B
gb|EFA80605.1|  transmembrane protein                                 99.4    4e-21   Heterostelium album PN500
gb|EGD98731.1|  mitochondrial carrier protein                         99.8    5e-21   Trichophyton tonsurans CBS 112818
ref|XP_003022834.1|  hypothetical protein TRV_03058                   99.8    5e-21   Trichophyton verrucosum HKI 0517
ref|XP_003011121.1|  hypothetical protein ARB_02643                   99.4    5e-21   Trichophyton benhamiae CBS 112371
ref|XP_003235588.1|  mitochondrial carrier protein                    99.4    5e-21   Trichophyton rubrum CBS 118892
ref|XP_003177849.1|  solute carrier family 25 member 42               99.4    5e-21   Nannizzia gypsea CBS 118893
ref|XP_007397036.1|  hypothetical protein PHACADRAFT_258126           99.4    5e-21   Phanerochaete carnosa HHB-10118-sp
emb|CBQ71101.1|  related to mitochondrial carrier protein               100   6e-21   Sporisorium reilianum SRZ2
gb|EST05863.1|  hypothetical protein PSEUBRA_SCAF4g05013                100   6e-21   Kalmanozyma brasiliensis GHG001
gb|KIO19166.1|  hypothetical protein M407DRAFT_150116                 99.4    6e-21   Tulasnella calospora MUT 4182
ref|XP_001903889.1|  hypothetical protein                             98.6    7e-21   Podospora anserina S mat+
gb|KIK67484.1|  hypothetical protein GYMLUDRAFT_37615                 99.0    8e-21   Gymnopus luxurians FD-317 M1
gb|KFH46822.1|  putative mitochondrial carrier-like protein           98.6    9e-21   Acremonium chrysogenum ATCC 11550
gb|KJF61631.1|  mitochondrial carrier protein, variant                98.2    9e-21   Coccidioides immitis RS
emb|CEI95370.1|  hypothetical protein RMCBS344292_09559               98.6    1e-20   Rhizopus microsporus
ref|XP_007339346.1|  mitochondrial carrier                            98.6    1e-20   
dbj|GAA99260.1|  hypothetical protein E5Q_05954                       98.6    1e-20   Mixia osmundae IAM 14324
ref|XP_007843299.1|  mitochondrial carrier                            98.6    1e-20   
gb|KID61571.1|  Mitochondrial carrier domain protein                  98.6    1e-20   Metarhizium anisopliae ARSEF 549
ref|XP_007600382.1|  hypothetical protein CFIO01_00423                98.6    1e-20   
gb|EQK99301.1|  Mitochondrial carrier domain protein                  98.2    1e-20   Ophiocordyceps sinensis CO18
gb|KIY44486.1|  mitochondrial carrier                                 98.6    1e-20   Fistulina hepatica ATCC 64428
gb|KIL62548.1|  hypothetical protein M378DRAFT_12756                  98.6    1e-20   Amanita muscaria Koide BX008
gb|ERZ99393.1|  hypothetical protein GLOINDRAFT_329195                98.2    1e-20   
gb|KHN96172.1|  Mitochondrial carrier domain protein                  98.2    1e-20   Metarhizium album ARSEF 1941
gb|EXX70128.1|  hypothetical protein RirG_090420                      98.2    1e-20   Rhizophagus irregularis DAOM 197198w
gb|KFG77864.1|  putative mitochondrial carrier protein                98.6    1e-20   Metarhizium anisopliae
ref|XP_002851261.1|  Lpz11p                                           98.2    1e-20   Microsporum canis CBS 113480
tpe|CBF70821.1|  TPA: mitochondrial carrier protein, putative (AF...  98.2    1e-20   Aspergillus nidulans FGSC A4
ref|XP_003321187.2|  hypothetical protein PGTG_02229                  98.2    1e-20   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_007807139.1|  mitochondrial carrier protein, putative          98.2    1e-20   Metarhizium acridum CQMa 102
gb|KIM78890.1|  hypothetical protein PILCRDRAFT_824006                98.2    1e-20   Piloderma croceum F 1598
ref|XP_001244797.1|  hypothetical protein CIMG_04238                  98.2    1e-20   
gb|EJT46041.1|  hypothetical protein A1Q1_05423                       98.2    1e-20   Trichosporon asahii var. asahii CBS 2479
ref|XP_663405.1|  hypothetical protein AN5801.2                       98.2    1e-20   Aspergillus nidulans FGSC A4
gb|KJA27564.1|  hypothetical protein HYPSUDRAFT_34657                 98.2    2e-20   Hypholoma sublateritium FD-334 SS-4
emb|CEG72434.1|  hypothetical protein RMATCC62417_07994               98.6    2e-20   Rhizopus microsporus
ref|XP_007824422.2|  mitochondrial carrier                            98.2    2e-20   Metarhizium robertsii ARSEF 23
ref|XP_009494162.1|  hypothetical protein H696_01987                  97.8    2e-20   Fonticula alba
emb|CEI95369.1|  hypothetical protein RMCBS344292_09558               98.2    2e-20   Rhizopus microsporus
emb|CCA67191.1|  related to mitochondrial carrier protein               100   2e-20   Serendipita indica DSM 11827
gb|KIM45458.1|  hypothetical protein M413DRAFT_442127                 97.8    2e-20   Hebeloma cylindrosporum h7
emb|CDM26906.1|  Mitochondrial carrier protein                        97.8    2e-20   Penicillium roqueforti FM164
gb|EXU98601.1|  mitochondrial carrier protein                         97.8    2e-20   Metarhizium robertsii
gb|KID97211.1|  Mitochondrial carrier domain protein                  97.8    2e-20   Metarhizium majus ARSEF 297
gb|KID83402.1|  Mitochondrial carrier domain protein                  97.8    2e-20   Metarhizium guizhouense ARSEF 977
gb|KFA70740.1|  hypothetical protein S40288_08885                     97.4    2e-20   Stachybotrys chartarum IBT 40288
gb|KEY66716.1|  hypothetical protein S7711_06764                      97.4    2e-20   Stachybotrys chartarum IBT 7711
gb|EPS29110.1|  hypothetical protein PDE_04059                        97.4    2e-20   Penicillium oxalicum 114-2
gb|EMS24452.1|  mitochondrial carrier protein                         97.4    2e-20   Rhodotorula toruloides NP11
gb|KFA60747.1|  hypothetical protein S40285_04748                     97.4    2e-20   Stachybotrys chlorohalonata IBT 40285
ref|XP_008714823.1|  hypothetical protein HMPREF1541_02245            97.4    2e-20   Cyphellophora europaea CBS 101466
ref|XP_007804599.1|  hypothetical protein EPUS_07572                  98.6    3e-20   Endocarpon pusillum Z07020
ref|XP_011318767.1|  hypothetical protein FGSG_09865                  96.7    4e-20   Fusarium graminearum PH-1
gb|EUC54737.1|  carrier protein                                       94.7    4e-20   Rhizoctonia solani AG-3 Rhs1AP
gb|ENH83702.1|  mitochondrial carrier                                 96.7    4e-20   
ref|XP_003068173.1|  Mitochondrial carrier protein                    97.1    4e-20   Coccidioides posadasii C735 delta SOWgp
gb|ELQ33051.1|  solute carrier family 25 member 42                    97.1    4e-20   Magnaporthe oryzae Y34
emb|CCE31762.1|  related to mitochondrial carrier protein             96.7    4e-20   Claviceps purpurea 20.1
ref|XP_003664532.1|  hypothetical protein MYCTH_2063420               96.7    4e-20   Thermothelomyces thermophila ATCC 42464
gb|KID66919.1|  Mitochondrial carrier domain protein                  96.7    4e-20   Metarhizium brunneum ARSEF 3297
ref|XP_003710974.1|  mitochondrial carrier protein                    96.7    4e-20   Magnaporthe oryzae 70-15
gb|KDR75001.1|  hypothetical protein GALMADRAFT_248838                96.7    5e-20   Galerina marginata CBS 339.88
gb|KIY69538.1|  mitochondrial carrier                                 96.7    5e-20   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_007409754.1|  hypothetical protein MELLADRAFT_48294            96.7    5e-20   Melampsora larici-populina 98AG31
ref|XP_003050698.1|  predicted protein                                96.3    5e-20   [Nectria] haematococca mpVI 77-13-4
gb|KIK93055.1|  hypothetical protein PAXRUDRAFT_829390                96.7    5e-20   Paxillus rubicundulus Ve08.2h10
ref|XP_003002470.1|  solute carrier family 25 member 42               96.3    5e-20   Verticillium alfalfae VaMs.102
emb|CCM00417.1|  predicted protein                                    96.3    5e-20   Fibroporia radiculosa
gb|KIK09736.1|  hypothetical protein K443DRAFT_671057                 96.7    5e-20   Laccaria amethystina LaAM-08-1
gb|EHK40525.1|  hypothetical protein TRIATDRAFT_29217                 96.3    6e-20   Trichoderma atroviride IMI 206040
ref|XP_001877859.1|  predicted protein                                96.7    6e-20   Laccaria bicolor S238N-H82
emb|CCT69368.1|  related to mitochondrial carrier protein             95.9    7e-20   Fusarium fujikuroi IMI 58289
ref|XP_009657680.1|  solute carrier family 25 member 42               95.9    7e-20   Verticillium dahliae VdLs.17
gb|EWG39971.1|  hypothetical protein FVEG_02577                       95.9    7e-20   Fusarium verticillioides 7600
gb|KIN06518.1|  hypothetical protein OIDMADRAFT_38782                 95.9    8e-20   Oidiodendron maius Zn
ref|XP_002558987.1|  Pc13g05530                                       95.9    8e-20   Penicillium rubens Wisconsin 54-1255
gb|AFR97734.1|  solute carrier family 25 (mitochondrial phosphate...  96.3    8e-20   Cryptococcus neoformans var. grubii H99
gb|KIJ18852.1|  hypothetical protein PAXINDRAFT_166807                95.9    8e-20   Paxillus involutus ATCC 200175
gb|KIK45086.1|  hypothetical protein CY34DRAFT_801941                 95.9    9e-20   Suillus luteus UH-Slu-Lm8-n1
ref|XP_001830770.1|  hypothetical protein CC1G_03307                  95.9    9e-20   Coprinopsis cinerea okayama7#130
emb|CDI56480.1|  related to mitochondrial carrier protein             97.4    1e-19   Melanopsichium pennsylvanicum 4
gb|KIP06606.1|  hypothetical protein PHLGIDRAFT_72460                 95.5    1e-19   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_002584975.1|  conserved hypothetical protein                   95.5    1e-19   Uncinocarpus reesii 1704
ref|XP_007928091.1|  hypothetical protein MYCFIDRAFT_77064            95.5    1e-19   Pseudocercospora fijiensis CIRAD86
gb|KIL96122.1|  mitochondrial carrier protein                         95.1    1e-19   Fusarium avenaceum
dbj|GAM85743.1|  hypothetical protein ANO11243_037510                 95.1    1e-19   fungal sp. No.11243
gb|EWY91223.1|  hypothetical protein FOYG_08401                       95.1    1e-19   
gb|KDN42528.1|  hypothetical protein RSAG8_06671                      95.1    1e-19   
gb|EMT63789.1|  hypothetical protein FOC4_g10014038                   95.1    1e-19   
ref|XP_007913528.1|  putative solute carrier family 25 member 42 ...  95.1    1e-19   
gb|EWZ37831.1|  hypothetical protein FOZG_09687                       95.1    1e-19   
gb|EWY91224.1|  hypothetical protein FOYG_08401                       95.1    2e-19   
ref|XP_009225815.1|  mitochondrial carrier protein                    95.1    2e-19   
ref|XP_956574.1|  ADP,ATP carrier protein                             95.1    2e-19   
ref|XP_009854455.1|  hypothetical protein NEUTE1DRAFT_148817          95.1    2e-19   
gb|EHK21485.1|  hypothetical protein TRIVIDRAFT_70416                 94.7    2e-19   
ref|XP_004338112.1|  Mitochondrial carrier protein                    94.4    2e-19   
ref|XP_007677313.1|  hypothetical protein BAUCODRAFT_123373           94.4    2e-19   
ref|XP_007766885.1|  mitochondrial carrier                            94.7    2e-19   
gb|KIM61595.1|  hypothetical protein SCLCIDRAFT_16095                 94.7    2e-19   
emb|CEJ92205.1|  Putative Mitochondrial carrier domain protein        94.4    2e-19   
ref|XP_504860.1|  YALI0F01430p                                        94.4    2e-19   
gb|KDQ27512.1|  hypothetical protein PLEOSDRAFT_1089367               94.7    2e-19   
ref|XP_001384382.1|  mitochondrial ADP/ATP carrier protein            94.4    3e-19   
ref|XP_006694912.1|  hypothetical protein CTHT_0045240                94.4    3e-19   
ref|XP_011272454.1|  putative mitochondrial carrier                   94.4    3e-19   
gb|ERT01871.1|  hypothetical protein HMPREF1624_00165                 94.4    3e-19   
gb|KDB16183.1|  putative mitochondrial carrier protein                94.4    3e-19   
gb|KIH88156.1|  solute carrier family 25 (mitochondrial phosphate...  94.0    3e-19   
emb|CEL54090.1|  putative mitochondrial carrier YPR011C OS=Saccha...  94.4    3e-19   
ref|XP_008600269.1|  solute carrier family 25 member 42               95.9    3e-19   
ref|XP_003650916.1|  hypothetical protein THITE_2110866               94.0    4e-19   
ref|XP_006962809.1|  predicted protein                                94.0    4e-19   
gb|EPE10007.1|  mitochondrial carrier                                 94.0    4e-19   
ref|XP_007797809.1|  putative solute carrier family 25 member 42 ...  94.0    4e-19   
gb|KGO65023.1|  Mitochondrial carrier protein                         95.9    4e-19   
ref|XP_002674890.1|  predicted protein                                94.0    4e-19   
gb|ETS04289.1|  mitochondrial carrier                                 94.0    4e-19   
ref|XP_001826510.1|  hypothetical protein AOR_1_1616054               94.0    4e-19   
gb|KIK27092.1|  hypothetical protein PISMIDRAFT_93791                 92.4    4e-19   
gb|EIE81090.1|  hypothetical protein RO3G_05795                       93.6    4e-19   
ref|XP_008085191.1|  Mitochondrial carrier                            93.6    4e-19   
gb|EYE97299.1|  mitochondrial carrier                                 94.0    4e-19   
gb|KIJ49521.1|  hypothetical protein M422DRAFT_225317                 94.0    5e-19   
gb|KDE06052.1|  hypothetical protein MVLG_03606                       94.4    5e-19   
gb|KEQ71757.1|  mitochondrial carrier                                 93.6    5e-19   
gb|KIV96157.1|  hypothetical protein PV10_00059                       93.6    6e-19   
ref|XP_001625886.1|  predicted protein                                93.2    6e-19   
gb|KEQ99811.1|  hypothetical protein AUEXF2481DRAFT_35743             93.2    6e-19   
ref|XP_007266851.1|  mitochondrial carrier                            94.0    7e-19   
ref|XP_007317922.1|  hypothetical protein SERLADRAFT_466441           93.2    7e-19   
dbj|GAN02053.1|  mitochondrial carrier protein                        93.6    8e-19   
ref|XP_001626526.1|  predicted protein                                92.8    8e-19   
dbj|GAM25727.1|  hypothetical protein SAMD00019534_089020             92.8    8e-19   
gb|EWC46474.1|  hypothetical protein DRE_04197                        92.8    9e-19   
emb|CEP16032.1|  hypothetical protein                                 93.6    9e-19   
gb|EUC54746.1|  solute carrier family 25 protein                      92.8    1e-18   
gb|KDQ21403.1|  hypothetical protein BOTBODRAFT_50047                 92.8    1e-18   
emb|CDH16584.1|  probable Member of the mitochondrial carrier (MC...  92.4    1e-18   
gb|KEP48314.1|  solute carrier family 25 protein                      92.8    1e-18   
ref|XP_002478727.1|  mitochondrial carrier protein, putative          92.4    1e-18   
gb|KIW03146.1|  hypothetical protein PV09_05789                       92.4    1e-18   
ref|XP_638149.1|  EF-hand domain-containing protein                   93.6    1e-18   
gb|EPB87258.1|  hypothetical protein HMPREF1544_05980                 92.4    1e-18   
ref|XP_001588140.1|  hypothetical protein SS1G_10586                  92.4    1e-18   
gb|KEQ82011.1|  mitochondrial carrier                                 92.0    1e-18   
emb|CEJ92206.1|  Putative 60S ribosomal protein L18                   91.7    1e-18   
gb|EMF12919.1|  mitochondrial carrier protein                         92.4    1e-18   
emb|CDF90195.1|  ZYBA0S06-02894g1_1                                   92.0    2e-18   
gb|ESZ97528.1|  solute carrier family 25 member 42                    92.0    2e-18   
ref|XP_002499062.1|  ZYRO0E02728p                                     92.0    2e-18   
ref|XP_006956181.1|  mitochondrial carrier                            92.0    2e-18   
ref|XP_001538040.1|  hypothetical protein HCAG_07462                  92.0    2e-18   
gb|EER36461.1|  mitochondrial carrier protein                         92.0    2e-18   
ref|XP_001260261.1|  mitochondrial carrier protein, putative          91.7    2e-18   
gb|EEH07806.1|  conserved hypothetical protein                        92.0    2e-18   
gb|EEQ83494.1|  mitochondrial carrier protein                         92.0    2e-18   
dbj|GAK64035.1|  mitochondrial carrier                                94.0    2e-18   
ref|XP_002624957.1|  mitochondrial carrier protein                    92.0    2e-18   
gb|KCW64286.1|  hypothetical protein EUGRSUZ_G01923                   92.8    2e-18   
ref|XP_001550923.1|  hypothetical protein BC1G_10647                  91.7    2e-18   
ref|XP_009547735.1|  mitochondrial carrier protein                    91.7    2e-18   
ref|XP_002114403.1|  hypothetical protein TRIADDRAFT_58172            91.7    2e-18   
gb|ESW97830.1|  putative mitochondrial carrier                        91.3    3e-18   
emb|CCK69980.1|  hypothetical protein KNAG_0D02300                    91.3    3e-18   
ref|XP_004339053.1|  mitochondrial adp/atp carrier proteins (iss)...  91.3    3e-18   
ref|XP_007295857.1|  solute carrier family 25 member 42               91.3    3e-18   
ref|XP_011114137.1|  hypothetical protein H072_8431                   91.7    3e-18   
ref|XP_010066396.1|  PREDICTED: calcium-binding mitochondrial car...  93.2    3e-18   
ref|XP_002146427.1|  mitochondrial carrier protein, putative          90.9    3e-18   
gb|EHM99786.1|  YPR011C-like protein                                  91.3    3e-18   
ref|XP_002146428.1|  mitochondrial carrier protein, putative          90.9    3e-18   
ref|XP_001267683.1|  mitochondrial carrier protein, putative          91.3    3e-18   
ref|XP_755075.1|  mitochondrial carrier protein                       91.3    4e-18   
gb|KIO10056.1|  hypothetical protein M404DRAFT_996042                 90.9    4e-18   
emb|CDO78167.1|  hypothetical protein BN946_scf184467.g6              94.4    4e-18   
gb|KEF62682.1|  hypothetical protein A1O9_00655                       91.3    4e-18   
dbj|GAM17017.1|  hypothetical protein SAMD00019534_001920             91.7    4e-18   
gb|KFX47528.1|  putative mitochondrial carrier                        91.3    4e-18   
gb|KFY12569.1|  hypothetical protein V491_06733                       90.9    4e-18   
ref|XP_002146426.1|  mitochondrial carrier protein, putative          90.9    4e-18   
ref|XP_002790070.1|  mitochondrial carrier protein                    90.9    4e-18   
ref|XP_007731349.1|  hypothetical protein A1O3_03019                  90.5    5e-18   
gb|EEH22503.1|  hypothetical protein PABG_04714                       90.5    5e-18   
ref|XP_001642759.1|  hypothetical protein Kpol_348p5                  90.9    6e-18   
ref|XP_007779083.1|  hypothetical protein W97_02994                   90.5    6e-18   
emb|CCU77887.1|  mitochondrial carrier protein/putative mitochond...  90.5    6e-18   
ref|XP_010760967.1|  hypothetical protein PADG_05339                  90.5    6e-18   
emb|CCF51827.1|  related to mitochondrial carrier protein             92.0    6e-18   
ref|XP_011125417.1|  hypothetical protein AOL_s00112g85               90.1    7e-18   
dbj|BAO41629.1|  mitochondrial carrier protein LEU5                   90.5    7e-18   
gb|KEQ59376.1|  mitochondrial carrier                                 90.1    7e-18   
ref|XP_007877397.1|  hypothetical protein PFL1_01696                  92.0    8e-18   
gb|KIW89280.1|  hypothetical protein Z519_10133                       89.7    8e-18   
gb|KIW61528.1|  hypothetical protein PV05_01639                       90.1    8e-18   
gb|KFY69906.1|  hypothetical protein V499_09630                       89.7    9e-18   
ref|XP_009158974.1|  solute carrier family 25                         90.1    9e-18   
dbj|GAC72468.1|  mitochondrial solute carrier protein                 91.3    9e-18   
ref|XP_009843699.1|  hypothetical protein H257_16824                  89.7    9e-18   
ref|XP_003679890.1|  hypothetical protein TDEL_0B05500                89.7    9e-18   
ref|XP_007833555.1|  hypothetical protein PFICI_06783                 89.7    9e-18   
gb|AJP42150.1|  hypothetical protein F842_YJM1078P00290               89.7    1e-17   
gb|ELR09674.1|  hypothetical protein GMDG_04160                       89.7    1e-17   
gb|KFY03771.1|  hypothetical protein O988_01224                       89.7    1e-17   
gb|ETS60858.1|  hypothetical protein PaG_04775                        91.7    1e-17   
dbj|GAM35534.1|  hypothetical protein TCE0_017r03949                  91.3    1e-17   
gb|KFX47529.1|  60S ribosomal protein L18-B                           91.7    1e-17   
ref|XP_007742087.1|  hypothetical protein A1O5_03285                  89.7    1e-17   
ref|XP_007722188.1|  hypothetical protein A1O1_03091                  89.7    1e-17   
gb|KFX94798.1|  hypothetical protein V490_04155                       89.4    1e-17   
ref|XP_003866862.1|  hypothetical protein CORT_0A10380                89.4    1e-17   
gb|EHA25081.1|  hypothetical protein ASPNIDRAFT_211749                89.4    1e-17   
ref|XP_007381399.1|  mitochondrial carrier                            89.0    2e-17   
dbj|BAP73070.1|  mitochondrial carrier protein LEU5                   89.4    2e-17   
gb|KIW43485.1|  hypothetical protein PV06_04584                       89.0    2e-17   
ref|XP_010423228.1|  PREDICTED: calcium-binding mitochondrial car...  89.0    2e-17   
emb|CCE43459.1|  hypothetical protein CPAR2_211030                    89.0    2e-17   
ref|XP_008727055.1|  hypothetical protein G647_04491                  88.6    2e-17   
ref|XP_003955631.1|  hypothetical protein KAFR_0B01980                88.6    2e-17   
emb|CCG84836.1|  protein of unknown function                          88.6    2e-17   
emb|CCK69684.1|  hypothetical protein KNAG_0C05860                    89.0    2e-17   
gb|KIW28109.1|  hypothetical protein PV07_07793                       89.0    2e-17   
ref|XP_010452693.1|  PREDICTED: calcium-binding mitochondrial car...  88.6    3e-17   
gb|KIW69268.1|  hypothetical protein PV04_05152                       88.6    3e-17   
emb|CDO92964.1|  unnamed protein product                              88.2    3e-17   
ref|XP_002547264.1|  hypothetical protein CTRG_01570                  88.2    3e-17   
gb|KIW75161.1|  hypothetical protein Z517_11933                       88.6    3e-17   
ref|XP_005830658.1|  hypothetical protein GUITHDRAFT_158030           87.8    3e-17   
ref|XP_002864093.1|  mitochondrial substrate carrier family protein   90.1    3e-17   
dbj|GAD98620.1|  mitochondrial carrier protein, putative              88.6    3e-17   
gb|KIY03023.1|  hypothetical protein Z520_01489                       88.6    3e-17   
ref|XP_007756405.1|  hypothetical protein A1O7_04201                  88.2    3e-17   
gb|KIW11506.1|  hypothetical protein PV08_10807                       88.2    3e-17   
ref|XP_008866918.1|  hypothetical protein H310_04369                  88.2    3e-17   
ref|XP_011105879.1|  YPR011C                                          88.2    3e-17   
ref|XP_448351.1|  hypothetical protein                                88.2    4e-17   
ref|XP_011388660.1|  hypothetical protein UMAG_02351                  89.7    4e-17   
gb|KFY89224.1|  hypothetical protein V500_05886                       90.1    4e-17   
dbj|GAC98700.1|  hypothetical protein PHSY_006294                     89.7    4e-17   
gb|KFZ07357.1|  hypothetical protein V501_06543                       90.1    4e-17   
gb|KFY54291.1|  hypothetical protein V496_07299                       90.1    4e-17   
ref|XP_010442585.1|  PREDICTED: calcium-binding mitochondrial car...  87.8    4e-17   
ref|XP_007374908.1|  hypothetical protein SPAPADRAFT_50276            87.8    4e-17   
ref|XP_010423227.1|  PREDICTED: calcium-binding mitochondrial car...  89.0    4e-17   
gb|KFZ15448.1|  hypothetical protein V502_05612                       89.7    4e-17   
gb|EEU05341.1|  YPR011C-like protein                                  87.8    4e-17   
ref|NP_015336.1|  hypothetical protein YPR011C                        87.8    4e-17   
gb|KFY39663.1|  hypothetical protein V494_03902                       89.7    5e-17   
gb|KFY14169.1|  hypothetical protein V492_02802                       89.7    5e-17   
ref|XP_003845492.1|  similar to mitochondrial carrier protein         87.8    5e-17   
gb|KFY21789.1|  hypothetical protein V493_07112                       89.7    5e-17   
ref|XP_010452692.1|  PREDICTED: calcium-binding mitochondrial car...  88.6    5e-17   
ref|XP_010452691.1|  PREDICTED: calcium-binding mitochondrial car...  88.6    6e-17   
gb|KFY46288.1|  hypothetical protein V495_02580                       89.4    6e-17   
gb|EJT43347.1|  YPR011C-like protein                                  87.4    6e-17   
gb|KGR13098.1|  solute carrier family 25 (mitochondrial carrier p...  88.2    6e-17   
gb|KGQ89847.1|  solute carrier family 25 (mitochondrial carrier p...  88.2    6e-17   
gb|KHC59152.1|  solute carrier family 25 (mitochondrial carrier p...  88.2    6e-17   
gb|KIX00905.1|  hypothetical protein Z518_09970                       87.4    6e-17   
ref|XP_010423224.1|  PREDICTED: calcium-binding mitochondrial car...  89.0    6e-17   
ref|XP_007697984.1|  hypothetical protein COCSADRAFT_188829           87.8    6e-17   
ref|XP_004365395.2|  solute carrier family 25                         87.4    6e-17   
ref|XP_007682068.1|  hypothetical protein COCMIDRAFT_165              87.4    7e-17   
emb|CDS13058.1|  hypothetical protein LRAMOSA05242                    88.2    7e-17   
ref|XP_005793477.1|  mitochondrial solute carrier protein             87.0    8e-17   
ref|XP_010491336.1|  PREDICTED: calcium-binding mitochondrial car...  88.6    8e-17   
gb|AFJ66222.1|  hypothetical protein 34G24.27                         88.2    8e-17   
ref|XP_010452689.1|  PREDICTED: calcium-binding mitochondrial car...  88.6    9e-17   
gb|EDN61148.1|  conserved protein                                     87.0    9e-17   
dbj|GAA26984.1|  K7_Ypr011cp                                          87.0    9e-17   
emb|CCU74349.1|  ADP,ATP carrier protein                              87.0    1e-16   
ref|XP_458396.1|  DEHA2C16302p                                        86.7    1e-16   
ref|XP_007292200.1|  hypothetical protein MBM_04311                   87.4    1e-16   
gb|KIV82135.1|  hypothetical protein PV11_04264                       87.0    1e-16   
ref|XP_006281426.1|  hypothetical protein CARUB_v10027500mg           88.2    1e-16   
ref|XP_008026893.1|  hypothetical protein SETTUDRAFT_20444            86.3    2e-16   
ref|XP_002417992.1|  mitochondrial carrier protein, putative          87.0    2e-16   
ref|XP_010442584.1|  PREDICTED: calcium-binding mitochondrial car...  88.2    2e-16   
ref|XP_003287896.1|  hypothetical protein DICPUDRAFT_152069           87.4    2e-16   
ref|XP_454796.1|  hypothetical protein                                86.7    2e-16   
emb|CDH50878.1|  mitochondrial carrier protein                        87.0    2e-16   
gb|AFJ66167.1|  hypothetical protein 11M19.11                         87.8    2e-16   
ref|XP_010482432.1|  PREDICTED: calcium-binding mitochondrial car...  87.8    2e-16   
ref|XP_003676933.1|  hypothetical protein NCAS_0F00940                86.3    2e-16   
gb|KHJ32459.1|  putative solute carrier family 25 member 42           85.9    2e-16   
gb|EUN26329.1|  hypothetical protein COCVIDRAFT_27321                 86.3    2e-16   
ref|XP_007715574.1|  hypothetical protein COCCADRAFT_39593            86.3    2e-16   
ref|XP_003743297.1|  PREDICTED: graves disease carrier protein-like   85.9    2e-16   
gb|EWZ89506.1|  hypothetical protein FOWG_07540                       86.3    2e-16   
gb|EGA56616.1|  YPR011C-like protein                                  85.9    2e-16   
ref|XP_003647937.1|  hypothetical protein Ecym_7278                   85.5    3e-16   
emb|CDO94909.1|  unnamed protein product                              86.3    3e-16   
ref|XP_007586341.1|  putative mitochondrial carrier protein           85.5    3e-16   
ref|XP_010770369.1|  PREDICTED: graves disease carrier protein        85.5    3e-16   
ref|XP_003647923.1|  hypothetical protein Ecym_7262                   85.9    3e-16   
ref|XP_002494109.1|  Putative transporter, member of the mitochon...  85.5    3e-16   
ref|XP_001275955.1|  mitochondrial carrier protein (Leu5), putative   86.7    3e-16   
dbj|BAO38918.1|  uncharacterized mitochondrial carrier YPR011C        85.5    3e-16   
gb|EMG50031.1|  Mitochondrial carrier protein LEU5                    86.7    3e-16   
ref|NP_199918.1|  mitochondrial substrate carrier family protein      87.0    3e-16   
ref|XP_002495033.1|  ZYRO0B01826p                                     85.9    3e-16   
gb|KGU15896.1|  solute carrier family 25 (mitochondrial carrier p...  86.3    3e-16   
ref|XP_719688.1|  potential mitochondrial coenzyme A transporter      86.3    3e-16   
gb|EMD97091.1|  hypothetical protein COCHEDRAFT_1087455               85.1    3e-16   
gb|EEQ45467.1|  mitochondrial carrier protein LEU5                    86.3    3e-16   
ref|XP_003297519.1|  hypothetical protein PTT_07945                   85.5    3e-16   
ref|XP_447781.1|  hypothetical protein                                85.1    4e-16   



>emb|CDP08711.1| unnamed protein product [Coffea canephora]
Length=354

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK+ E AV KIVN AEEAKLAR+EIKPTSHA+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKSSESAVSKIVNFAEEAKLAREEIKPTSHAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKY+GTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYSGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGILWLYRE+TGNEDA+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILWLYREKTGNEDAELTPVLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPYQYRGMFHALATVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L  + RL  GA AG +  +  YP D++R
Sbjct  223  YESLKD---WLVKAKPFGLVEDSELGVITRLACGAAAGTVGQTVAYPFDVMR  271



>ref|XP_004248074.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Solanum lycopersicum]
 ref|XP_010327001.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Solanum lycopersicum]
Length=355

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 165/169 (98%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTG-ELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK   + AVEKIVNLAEEAKLAR+EIKPTSHA+LSICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKAARDSAVEKIVNLAEEAKLAREEIKPTSHAVLSICKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGF+GLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL+LYR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYLYRQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  164  PMDMVRGRLTVQTENSPYQYRGMFHALSTVLREEGPRALYKGWTPSVIGVIPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ++++L  + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKTKPFGLVDNSELGVVTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_006358640.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Solanum tuberosum]
Length=355

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTG-ELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK   + AVEKIVNLAEEAKLAR+EIKPTSHA+LSICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKAARDSAVEKIVNLAEEAKLAREEIKPTSHAVLSICKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGF+GLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL+LYR+QTG EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYLYRQQTGIEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  164  PMDMVRGRLTVQTENSPYQYRGMFHALSTVLREEGPRALYKGWTPSVIGVIPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ++++L  + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKTKPFGLVDNSELGVVTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_009626771.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana tomentosiformis]
 ref|XP_009763324.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana sylvestris]
Length=354

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 165/169 (98%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTG-ELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK   + AVEKIVNLAEEAKLAR+EIKPTSHA+LSICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKAARDSAVEKIVNLAEEAKLAREEIKPTSHAVLSICKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGF+GLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL+LYR+QTGNEDA+LTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYLYRQQTGNEDAELTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 54/111 (49%), Gaps = 5/111 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  164  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWTPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQT-GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +  G  D +L  + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLIKTKPFGLVDDELGVVTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_009779970.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Nicotiana sylvestris]
Length=355

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AVEKIVNLAEEAKLAR EI+PTSHA++SICKSLVAGGVAGG+SRTAVAP
Sbjct  1    MASEDVKASESAVEKIVNLAEEAKLARQEIRPTSHAVISICKSLVAGGVAGGLSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+ GLKYIW+TEGF+GLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTISGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPILRLGAGACAGIIAMSATYPMDMVR  168


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 56/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G V  L  I + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQT---GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ++ A+L  + RL  GA AG +  +  YP+D+VR
Sbjct  223  YESLKD---WLVKTKPLGLVDDSAELGVVTRLACGAVAGTVGQTVAYPLDVVR  272



>gb|KDP25326.1| hypothetical protein JCGZ_20482 [Jatropha curcas]
Length=354

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKTGE AV  IVNLAEEAKLAR+ +K  SHA LSICKSL+AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTGESAVSTIVNLAEEAKLAREGVKAPSHAFLSICKSLIAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIWKTEGFRGLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILW+YR+QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWVYRQQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 51/108 (47%), Gaps = 6/108 (6%)
 Frame = +3

Query  375  RLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQA  554
            R ++ +Q QN    +Y G    L  + K EG R L+KG   +   +VP   + F  YE  
Sbjct  168  RGRLTVQTQNSPR-QYRGIYHALSTVLKEEGPRALYKGWLPSVIGVVPYVGLNFAVYESL  226

Query  555  SKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
                 WL +       +D +L+   RL  GA AG +  +  YP+D++R
Sbjct  227  KD---WLLKTNPFGLVQDNELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_010326870.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
isoform X1 [Solanum lycopersicum]
Length=355

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AVEKIVNLAEEAKLAR EI+PTSHA++SICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASESAVEKIVNLAEEAKLARQEIRPTSHAVISICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQN H+IKYNGT+ GLKYIW+TEGF+GLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNSHSIKYNGTISGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G V  L  I + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQT---GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE   +   WL + +     ++  +L  + RL  GA AG +  +  YP+D+VR
Sbjct  223  YESLKE---WLVKTKPLGLVDDSTELGVVTRLACGAVAGTMGQTVAYPLDVVR  272



>ref|XP_002509930.1| Grave disease carrier protein, putative [Ricinus communis]
 gb|EEF51317.1| Grave disease carrier protein, putative [Ricinus communis]
Length=355

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 162/169 (96%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKT-GELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VKT  E AV KIVNLAEEAKLAR+EIK  SHAL SICKSL+AGGVAGGVSRTAVA
Sbjct  1    MASEDVKTRSEAAVSKIVNLAEEAKLAREEIKAPSHALFSICKSLIAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E+ASKGILW+YR+QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EEASKGILWMYRQQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + K EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTEASPRQYKGIFHALSTVLKEEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D +L    RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLLKSKPFGLVQDNELGVATRLACGAAAGTVGQTVAYPLDVIR  272



>gb|EYU38910.1| hypothetical protein MIMGU_mgv1a009053mg [Erythranthe guttata]
Length=354

 Score =   283 bits (725),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV KIVN AEEAKLA++EIKPT H + SICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSKIVNFAEEAKLAKEEIKPTKHQVYSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGTVQGLKYI++TEG RGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTVQGLKYIYRTEGLRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL++YR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYMYRQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 56/110 (51%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EGFR L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPYQYRGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE + K  L   +     ED +L  + RLG GA AG +  +  YP+D++R
Sbjct  223  YE-SLKDYLIKSKPYGIVEDNELGVVTRLGCGAAAGTVGQTIAYPLDVIR  271



>ref|XP_002320851.2| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE99166.2| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=354

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  SHA+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVTTIVNLAEEAKLAREGVKAPSHAILSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILSLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG I  +  YP+D++R
Sbjct  223  YESLKD---WLVKARPFGLVEDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  271



>ref|XP_002532663.1| Grave disease carrier protein, putative [Ricinus communis]
 gb|EEF29736.1| Grave disease carrier protein, putative [Ricinus communis]
Length=354

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTTESAVTTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGT+QGL+YIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTIQGLRYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGIL+LYR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILYLYRQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE   +   WL + +     +D+ L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKE---WLIKAKPFGLVQDSDLSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_002273414.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Vitis vinifera]
 emb|CBI34457.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV +IVNLAEEAKLAR+ +K  SHALLS+CKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSEAAVSRIVNLAEEAKLAREGVKAPSHALLSVCKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH IKYNGT+QGLKYIWK+EGFRGLFKGNGTNCARIVPNSAVKF+SYE
Sbjct  61   LERLKILLQVQNPHTIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIVPNSAVKFYSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGILWLYR+Q GNE+A+LTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILWLYRQQPGNENAELTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPRQYRGIFHALSTVLREEGARALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L    RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLMKAKPFGLVEDSELGVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_010266452.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nelumbo nucifera]
Length=356

 Score =   281 bits (719),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 2/170 (1%)
 Frame = +3

Query  189  MASEEV--KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtav  362
            MASE+V  KT + AV  IVNLAEEAKLAR+ +K  SHA+LSICKSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVVGKTSKSAVSTIVNLAEEAKLAREGVKAPSHAILSICKSLVAGGVAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPHNIKYNGT+QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHNIKYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQASKGILW+Y++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  YEQASKGILWIYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  170


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  165  PMDMVRGRLTVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  224

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  225  YESLKD---WLIKTRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  273



>gb|KHG26522.1| Mitochondrial substrate carrier family protein B [Gossypium arboreum]
Length=354

 Score =   281 bits (718),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAILSICKSLAAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|NP_001275102.1| mitochondrial carrier-like protein [Solanum tuberosum]
 gb|ABC01898.1| mitochondrial carrier-like protein [Solanum tuberosum]
Length=355

 Score =   280 bits (717),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AVEKIV+LAEEA LAR EI+PTSHA++SICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASESAVEKIVSLAEEANLARQEIRPTSHAVISICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQN H+IKYNGT+ GLKYIW+TEGF+GLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNSHSIKYNGTISGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 55/113 (49%), Gaps = 7/113 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G V  L  I + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQT-GNEDAQLTP--LLRLGAGACAGIIAMSATYPMDMVR  692
            YE   +   WL + +  G  D    P  + RL  GA AG +  +  YP+D+VR
Sbjct  223  YESLKE---WLVKTKPLGLVDDSTEPGVVTRLACGAVAGTLGQTVAYPLDVVR  272



>gb|KJB41486.1| hypothetical protein B456_007G106400 [Gossypium raimondii]
Length=331

 Score =   280 bits (715),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAILSICKSLAAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY+ QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQRQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>gb|KJB21318.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=354

 Score =   280 bits (717),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGG+SRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAILSICKSLVAGGVAGGLSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYR-EQTG-NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +Q G  ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>gb|KJB41485.1| hypothetical protein B456_007G106400 [Gossypium raimondii]
Length=354

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAILSICKSLAAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY+ QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQRQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_007051615.1| Adenine nucleotide transporter 1 [Theobroma cacao]
 gb|EOX95772.1| Adenine nucleotide transporter 1 [Theobroma cacao]
Length=354

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G +  L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTERSPYQYRGMIHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKSKPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>gb|KJB24249.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
 gb|KJB24250.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=242

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAK+A + +K  SHALLSICKSLVAGGVAGGVSR+AVAP
Sbjct  1    MASEDVKRSESAVSTIVNLAEEAKIASEGVKAPSHALLSICKSLVAGGVAGGVSRSAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRG+FKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGMFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGIL+LYR+Q+GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILYLYRQQSGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168



>ref|XP_010326872.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
isoform X2 [Solanum lycopersicum]
Length=354

 Score =   278 bits (711),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AVEKIVNLAEEAKLAR EI+PTSHA++SICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASESAVEKIVNLAEEAKLARQEIRPTSHAVISICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQN H+IKYNGT+ GLKYIW+TEGF+GLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNSHSIKYNGTISGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGN DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGN-DAQLTPLLRLGAGACAGIIAMSATYPMDMVR  167


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G V  L  I + EG R L+KG   +   ++P   + F  
Sbjct  162  PMDMVRGRITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAV  221

Query  543  YEQASKGILWLYREQT---GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE   +   WL + +     ++  +L  + RL  GA AG +  +  YP+D+VR
Sbjct  222  YESLKE---WLVKTKPLGLVDDSTELGVVTRLACGAVAGTMGQTVAYPLDVVR  271



>gb|KDP28516.1| hypothetical protein JCGZ_14287 [Jatropha curcas]
Length=354

 Score =   278 bits (711),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT + AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRT VAP
Sbjct  1    MASEDVKTSKSAVTTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTTVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGL+YIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLRYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILWLY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWLYQKQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED+ L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKAKPFGLVEDSDLSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_010261496.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Nelumbo nucifera]
Length=356

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  189  MASEEV--KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtav  362
            MASE+V  KT E AV  IVNLAEEAKLA + +K  SHA+LSICKSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVVGKTSESAVSTIVNLAEEAKLASEGVKAPSHAILSICKSLVAGGVAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPHNIKYNGT+QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHNIKYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQAS GILW YR+QTGNEDA LTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  YEQASNGILWFYRQQTGNEDAGLTPLLRLGAGACAGIIAMSATYPMDMVR  170


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  165  PMDMVRGRLTVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  224

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  225  YESLKD---WLVKAKPFGLVEDSELSVTTRLACGAVAGTVGQTVAYPLDVIR  273



>ref|XP_011093457.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Sesamum indicum]
Length=354

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+V   E AV KIVN AEEAKLA++EIKP+ + + SICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVNARESAVSKIVNFAEEAKLAKEEIKPSKYQVYSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILHLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EGFR L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPYQYRGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED  L  + RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKSKPFGLVEDNDLGVVTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_010914053.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Elaeis guineensis]
Length=355

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK T E AV+ IVNLAEEAKLAR+ ++   HALLSICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKSTSESAVKTIVNLAEEAKLAREGVRAPGHALLSICKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQAS GILWLYR Q+GNEDA+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASSGILWLYRRQSGNEDAKLTPVLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L+KG   +   ++P   + F  
Sbjct  164  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+ + +L  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLIKSRPLGLVEDSELSVVTKLACGAVAGTVGQTVAYPLDVIR  272



>ref|XP_010669340.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Beta vulgaris subsp. vulgaris]
Length=354

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAK+AR+ +K  SHA+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTTESAVSTIVNLAEEAKIAREGVKAPSHAILSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYI++TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIYQTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGILWLY+ QTGNE+AQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILWLYQRQTGNENAQLTPVLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G V  L  I + EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRITVQTEKSPFQYRGMVHALSTILREEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D +L+   RL  GA AG I  +  YP+D++R
Sbjct  223  YESLKD---WLAKARPFGLIQDGELSVTTRLACGAVAGTIGQTVAYPLDVIR  271



>ref|XP_004133837.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
[Cucumis sativus]
 ref|XP_004155845.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
[Cucumis sativus]
 gb|KGN56467.1| hypothetical protein Csa_3G120460 [Cucumis sativus]
Length=354

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKRSESAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QAS+GIL+ YREQTG++DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASRGILYFYREQTGDQDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPYQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKNKPFGLVDDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>gb|KJB49521.1| hypothetical protein B456_008G123800 [Gossypium raimondii]
Length=354

 Score =   276 bits (705),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH++KYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSVKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTG++DAQLTPLLRLGAGACAGIIAMS TYPMDMVR
Sbjct  121  QASKGILYLYQQQTGDDDAQLTPLLRLGAGACAGIIAMSTTYPMDMVR  168


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTDSSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE   K  L   +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESL-KDRLIKSKAFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_011037758.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Populus euphratica]
Length=354

 Score =   276 bits (705),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IV LAEEAKLAR+ +K  SHA+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASESAVTTIVTLAEEAKLAREGVKAPSHAILSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASK IL LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKAILSLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG I  +  YP+D++R
Sbjct  223  YESLKD---WLVKARPFGLVEDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  271



>gb|KJB49524.1| hypothetical protein B456_008G123800 [Gossypium raimondii]
Length=359

 Score =   276 bits (705),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH++KYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSVKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTG++DAQLTPLLRLGAGACAGIIAMS TYPMDMVR
Sbjct  121  QASKGILYLYQQQTGDDDAQLTPLLRLGAGACAGIIAMSTTYPMDMVR  168



>ref|XP_002280675.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
isoform X1 [Vitis vinifera]
 emb|CBI40481.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   276 bits (705),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S+A+LS+ KSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKPSESAVTTIVNLAEEAKLAREGVKAPSYAILSVAKSLTAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGT+QGLKYIWKTEGFRGLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTENSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +      D +L    RL  GA AG I  +  YP+D++R
Sbjct  223  YESLKD---WLIKSKAFGLVHDNELGVTTRLACGAAAGTIGQTVAYPLDVIR  271



>ref|XP_003548513.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Glycine max]
 gb|KHN15957.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=355

 Score =   276 bits (705),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE VKTG+ AV  IVNLAEEAKLAR+ + K  S+AL SICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASENVKTGDSAVTTIVNLAEEAKLAREGVVKAPSYALASICKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILHLYKQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169



>gb|KJB24248.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=332

 Score =   275 bits (702),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAK+A + +K  SHALLSICKSLVAGGVAGGVSR+AVAP
Sbjct  1    MASEDVKRSESAVSTIVNLAEEAKIASEGVKAPSHALLSICKSLVAGGVAGGVSRSAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRG+FKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGMFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGIL+LYR+Q+GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILYLYRQQSGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 56/114 (49%), Gaps = 10/114 (9%)
 Frame = +3

Query  366  PLERLKILLQVQ---NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            P++ ++  L VQ   +PH  +Y G    L  + + EG R L+KG   +   +VP   + F
Sbjct  163  PMDMVRGRLTVQTEKSPH--QYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNF  220

Query  537  FSYEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              YE       WL + +     ED++L    RL  GA AG I  +  YP+D++R
Sbjct  221  AVYESLKD---WLIKRKPLGLVEDSELGVTTRLACGAAAGTIGQTVAYPLDVIR  271



>ref|XP_011026923.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Populus euphratica]
Length=354

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K    ALLSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPGPALLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEG RG+FKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILW YR+QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWFYRQQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + K EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED +L    RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLLKTNPFGLVEDNELGVTTRLACGAAAGTVGQTVAYPLDVIR  271



>gb|KJB24251.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=335

 Score =   275 bits (703),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAK+A + +K  SHALLSICKSLVAGGVAGGVSR+AVAP
Sbjct  1    MASEDVKRSESAVSTIVNLAEEAKIASEGVKAPSHALLSICKSLVAGGVAGGVSRSAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRG+FKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGMFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGIL+LYR+Q+GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILYLYRQQSGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 56/114 (49%), Gaps = 10/114 (9%)
 Frame = +3

Query  366  PLERLKILLQVQ---NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            P++ ++  L VQ   +PH  +Y G    L  + + EG R L+KG   +   +VP   + F
Sbjct  163  PMDMVRGRLTVQTEKSPH--QYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNF  220

Query  537  FSYEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              YE       WL + +     ED++L    RL  GA AG I  +  YP+D++R
Sbjct  221  AVYESLKD---WLIKRKPLGLVEDSELGVTTRLACGAAAGTIGQTVAYPLDVIR  271



>ref|XP_008437971.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Cucumis melo]
Length=354

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKRSESAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QAS+GIL+ YREQTG+ DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASRGILYFYREQTGDHDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPYQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKNKPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_003528803.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Glycine max]
 gb|KHN06287.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=355

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE VKTG+ AV  IVNLAEEAKLAR+ + K  S+AL SICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASENVKTGDSAVTTIVNLAEEAKLAREGVVKAPSYALASICKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILHLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169



>gb|EYU32214.1| hypothetical protein MIMGU_mgv1a009069mg [Erythranthe guttata]
Length=354

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  + AV KIVNLAEEAKLA++EIKPT   + S+CKSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASDSAVSKIVNLAEEAKLAKEEIKPTRFQVYSVCKSLFAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKY+GTVQGLKYI++TEGF+GLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYSGTVQGLKYIYRTEGFKGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LYR+QTG+EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYRQQTGDEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EGFR L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPYQYRGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED +L  + RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKSKQFGLVEDNELGVITRLACGAAAGTVGQTIAYPLDVIR  271



>ref|XP_010544796.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Tarenaya hassleriana]
Length=354

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGN++A+LTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNDEAELTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G V  L  + + EG R L++G   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPYQYRGMVHALSTVLREEGPRALYRGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ++++LT   RL  GA AG I  +  YP+D+VR
Sbjct  223  YESLKD---WLVKARPFGIADNSELTVTTRLACGAVAGTIGQTVAYPLDVVR  271



>gb|KJB24246.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
 gb|KJB24247.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
 gb|KJB24252.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=354

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAK+A + +K  SHALLSICKSLVAGGVAGGVSR+AVAP
Sbjct  1    MASEDVKRSESAVSTIVNLAEEAKIASEGVKAPSHALLSICKSLVAGGVAGGVSRSAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRG+FKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGMFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGIL+LYR+Q+GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILYLYRQQSGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 56/114 (49%), Gaps = 10/114 (9%)
 Frame = +3

Query  366  PLERLKILLQVQ---NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            P++ ++  L VQ   +PH  +Y G    L  + + EG R L+KG   +   +VP   + F
Sbjct  163  PMDMVRGRLTVQTEKSPH--QYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNF  220

Query  537  FSYEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              YE       WL + +     ED++L    RL  GA AG I  +  YP+D++R
Sbjct  221  AVYESLKD---WLIKRKPLGLVEDSELGVTTRLACGAAAGTIGQTVAYPLDVIR  271



>ref|XP_006444883.1| hypothetical protein CICLE_v10020846mg [Citrus clementina]
 ref|XP_006444884.1| hypothetical protein CICLE_v10020846mg [Citrus clementina]
 ref|XP_006491236.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Citrus sinensis]
 gb|ESR58123.1| hypothetical protein CICLE_v10020846mg [Citrus clementina]
 gb|ESR58124.1| hypothetical protein CICLE_v10020846mg [Citrus clementina]
 gb|KDO86405.1| hypothetical protein CISIN_1g038121mg [Citrus sinensis]
Length=354

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV KIVNLAEEAKLA + +K  S+A+LSICKSLVAGGVAG VSRTAVAP
Sbjct  1    MASEDVKTSESAVSKIVNLAEEAKLAGEGVKAPSYAVLSICKSLVAGGVAGAVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY+  TGNEDA+LTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQHHTGNEDAELTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPYRYRGIFHALSTVLREEGPRALYRGWFPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE      +WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLK---VWLIKTKPLGLAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_009415476.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 159/171 (93%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V    TGE AV +IVNLAEEAKLAR+ +K   HA+LSICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSTGESAVTRIVNLAEEAKLAREGVKAPGHAILSICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+I+YNGT+QGLKYIWK+EGFRGLF+GNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIQYNGTIQGLKYIWKSEGFRGLFRGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS GILWLYR Q+GNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASSGILWLYRRQSGNEDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L+KG   +   ++P   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED++L+ + RL  GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLIKSNPYGLVEDSELSVVTRLACGAVAGTIGQTVAYPLDVIR  274



>gb|KJB21316.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=353

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGG+SRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAILSICKSLVAGGVAGGLSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGN DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGN-DAQLTPLLRLGAGACAGIIAMSATYPMDMVR  167


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  162  PMDMVRGRLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAV  221

Query  543  YEQASKGILWLYR-EQTG-NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +Q G  ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  222  YESLKD---WLIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  270



>ref|XP_009377876.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Pyrus x bretschneideri]
Length=355

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E AV  IVNLAEEAK+AR+ + K  + ALLS+CKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKPSESAVSTIVNLAEEAKMAREGVVKAPNLALLSVCKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGT+QGLKYIW++EGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTIQGLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGILWLYR+QTGNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILWLYRDQTGNEDAQLTPILRLGAGACAGIIAMSATYPMDMVR  169


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 51/108 (47%), Gaps = 6/108 (6%)
 Frame = +3

Query  375  RLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQA  554
            R +I +Q +N    +Y G    L  + + EG R L+KG   +   +VP   + F  YE  
Sbjct  169  RGRITVQTEN-SPFQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESL  227

Query  555  SKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
                 WL + +     +D  L+   RL  GA AG +  +  YP+D++R
Sbjct  228  KD---WLIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_011023215.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Populus euphratica]
Length=354

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IV+LAEEAKLAR+ +K  S A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASESAVTTIVSLAEEAKLAREGVKAPSLAILSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGF GLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGFHGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPYQYRGMFHALATVLRQEGPRALYKGWLPSVIGVIPYVGLNFSV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L    RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLVKARPSGLVEDSELNVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_010523787.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Tarenaya hassleriana]
Length=354

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+V T E AV  IVNLAEEAKL ++ +K  SHA+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVNTSESAVSTIVNLAEEAKLTKEGVKAPSHAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTG+++A+LTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGDDEAELTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G V  L  + + EG R L++G   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPYQYRGMVHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ++++LT   RL  GA AG I  +  YP+D+VR
Sbjct  223  YESLKD---WLVKSRPFGIVDNSELTVTTRLACGAVAGTIGQTVAYPLDVVR  271



>ref|XP_002302618.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE81891.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=354

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASESAVTTIVNLAEEAKLAREGVKAPSLAILSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LER+KILLQVQNPHNIKYNGT+QGLKYIW+TEGF GLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERMKILLQVQNPHNIKYNGTIQGLKYIWRTEGFHGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYP+DMVR
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPLDMVR  168


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 56/114 (49%), Gaps = 10/114 (9%)
 Frame = +3

Query  366  PLERLKILLQVQ---NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            PL+ ++  L VQ   +PH  +Y G    L  + + EG R L+KG   +   ++P   + F
Sbjct  163  PLDMVRGRLTVQTEKSPH--QYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNF  220

Query  537  FSYEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              YE       WL + +     ED++L    RL  GA AG +  +  YP+D++R
Sbjct  221  SVYESLKD---WLVKARPSGLVEDSELNVTTRLACGAAAGTVGQTVAYPLDVIR  271



>gb|KCW78145.1| hypothetical protein EUGRSUZ_D02348 [Eucalyptus grandis]
Length=309

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASEKAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL LY++QTGNEDAQLTP LRLGAGACAGIIAMSATYPMD+VR
Sbjct  121  QASKGILLLYQQQTGNEDAQLTPPLRLGAGACAGIIAMSATYPMDLVR  168


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDLVRGRLTVQTENSPYQYRGMFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE   +   WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKE---WLIKNRPFGLMEDSELSVTTRLACGAVAGTVGQTVAYPLDVIR  271



>gb|KJB41484.1| hypothetical protein B456_007G106400 [Gossypium raimondii]
Length=353

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAILSICKSLAAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY+ QTGN DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQRQTGN-DAQLTPLLRLGAGACAGIIAMSATYPMDMVR  167


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  162  PMDMVRGRITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSV  221

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  222  YESLKD---WLIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  270



>gb|KHG06223.1| Mitochondrial substrate carrier family protein B [Gossypium arboreum]
Length=354

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAK A++ ++  SHA LSICKSL AGGVAGGVSR+AVAP
Sbjct  1    MASEDVKRSESAVTTIVNLAEEAKFAKEGVQAPSHAFLSICKSLFAGGVAGGVSRSAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH IKYNGT+QGLKYIWKTEGFRG+FKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHGIKYNGTIQGLKYIWKTEGFRGMFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGIL+LYR+Q+GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILYLYRQQSGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTEMSPRHYRGIFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L    +L  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKIRPFGLVEDSELGVTTKLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_007209295.1| hypothetical protein PRUPE_ppa007764mg [Prunus persica]
 gb|EMJ10494.1| hypothetical protein PRUPE_ppa007764mg [Prunus persica]
Length=356

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrtav  362
            MASE+VK T E AV  IVNLAEEAKLA + +K PTSHALLSI KSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVKRTSETAVSTIVNLAEEAKLASEGVKAPTSHALLSIAKSLVAGGVAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKY+GT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHSIKYSGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE+ASKGILW YR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  YEEASKGILWFYRQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  170


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L++G   +   +VP   + F  
Sbjct  165  PMDMVRGRLTVQTERSPRQYRGIAHALSTVFREEGPRALYRGWLPSVIGVVPYVGLNFAV  224

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  225  YESLKD---WLIKTRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  273



>ref|XP_009336243.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Pyrus x bretschneideri]
Length=356

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrtav  362
            MASE+VK T + AV  IVNLAEEAKLA + +K PT HALLSI KSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVKRTSDSAVSTIVNLAEEAKLASEGVKAPTGHALLSIAKSLVAGGVAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y++ASKGILW YR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  YDEASKGILWFYRQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  170


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L++G   +   +VP   + F  
Sbjct  165  PMDMVRGRLTVQTDMSPQQYRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAV  224

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  225  YESLKD---WLIKSRPFGLVQDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  273



>ref|XP_008798636.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Phoenix dactylifera]
Length=355

 Score =   273 bits (697),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK T E AV+ IVNLAEEAKLAR+ ++   HA+L ICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKSTSESAVKTIVNLAEEAKLAREGVRAPGHAILGICKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGVRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQAS GILWLYR Q+GNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASSGILWLYRRQSGNEDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   ++P   + F  
Sbjct  164  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVIPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+ + +L  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLIKSRPLGLIEDSELSVVTKLACGAVAGTVGQTVAYPLDVIR  272



>ref|XP_008239064.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Prunus mume]
Length=356

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 158/170 (93%), Gaps = 2/170 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrtav  362
            MASE+VK T E AV  IVNLAEEAKLA + +K PTSHALLSI KSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVKRTSETAVSTIVNLAEEAKLASEGVKAPTSHALLSIAKSLVAGGVAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKY+GT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHSIKYSGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE+ASKGILW YR QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  YEEASKGILWFYRRQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  170


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L++G   +   +VP   + F  
Sbjct  165  PMDMVRGRLTVQTERSPRQYRGIAHALSTVFREEGPRALYRGWLPSVIGVVPYVGLNFAV  224

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  225  YESLKD---WLIKTRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  273



>ref|XP_010053790.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Eucalyptus grandis]
 gb|KCW78147.1| hypothetical protein EUGRSUZ_D02348 [Eucalyptus grandis]
Length=354

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASEKAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL LY++QTGNEDAQLTP LRLGAGACAGIIAMSATYPMD+VR
Sbjct  121  QASKGILLLYQQQTGNEDAQLTPPLRLGAGACAGIIAMSATYPMDLVR  168


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  163  PMDLVRGRLTVQTENSPYQYRGMFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE   +   WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKE---WLIKNRPFGLMEDSELSVTTRLACGAVAGTVGQTVAYPLDVIR  271



>ref|XP_008233213.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Prunus mume]
Length=355

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E AV  IVNLAEEAK+AR+ + K  S A+LS+CKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKPSESAVSTIVNLAEEAKMAREGVVKAPSLAVLSVCKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL LYR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILLLYRDQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTENSPFQYRGMFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED  L+   RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLIKSRPFGLVEDTDLSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_007135224.1| hypothetical protein PHAVU_010G111300g [Phaseolus vulgaris]
 gb|ESW07218.1| hypothetical protein PHAVU_010G111300g [Phaseolus vulgaris]
Length=355

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE VKTGE AV  IVNLAEEAKLAR+ + K  S+A  +ICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASENVKTGESAVTTIVNLAEEAKLAREGVVKAPSYAFATICKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++Y++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYMYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  164  PMDMVRGRITVQTEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ++++L+   RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKSNAFGLADNSELSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_009377268.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Pyrus x bretschneideri]
Length=355

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E AV  IV+LAEEAK+AR+ + K  S ALLS+CKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKPSESAVTTIVSLAEEAKMAREGVVKAPSLALLSVCKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKYNGT+QGLK+IW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYNGTIQGLKHIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGILWLYR+QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILWLYRDQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 6/110 (5%)
 Frame = +3

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            + R +I +Q +N    +Y G    L  + + EG R L+KG   +   +VP   + F  YE
Sbjct  167  MVRGRITVQTEN-SPFQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYE  225

Query  549  QASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
                   WL + +     +D  L+   RL  GA AG +  +  YP+D++R
Sbjct  226  SLKD---WLIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_004306695.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Fragaria vesca subsp. vesca]
Length=355

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E AV  IVNLAEEAKLAR+ + K  S A+LS+CKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKRSERAVSTIVNLAEEAKLAREGVVKAPSLAVLSVCKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEGFRGLF GNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGFRGLFIGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGILW+YRE+TGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILWMYREKTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  164  PMDMVRGRITVQTEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D  L+   RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_002304548.1| hypothetical protein POPTR_0003s13730g [Populus trichocarpa]
 gb|EEE79527.1| hypothetical protein POPTR_0003s13730g [Populus trichocarpa]
Length=354

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K    ALL+ICKSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASESAVSTIVNLAEEAKLAREGVKAPGTALLNICKSLFAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEG RG+FKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILW YR QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWFYRRQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + K EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED +L    RL  GA AG    +  YP+D++R
Sbjct  223  YESLKD---WLLKTKPFGLVEDNELGVATRLACGAAAGTFGQTVAYPLDVIR  271



>ref|XP_009410854.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 158/171 (92%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V    TG+ AV  IVNLAEEAKLAR+ +K   HA+LSICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSTGDSAVTTIVNLAEEAKLAREGVKAPGHAILSICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+I+YNGT+QGLKYIWK+EGFRGLF+GNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIQYNGTIQGLKYIWKSEGFRGLFRGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS GILWLYR Q+GNEDAQ+TP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASSGILWLYRRQSGNEDAQITPVLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L+KG   +   ++P   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFNALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+ + RL  GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLVKSKPYGLVEDSELSVVTRLACGAVAGTIGQTVAYPLDVIR  274



>ref|XP_002297985.1| hypothetical protein POPTR_0001s10370g [Populus trichocarpa]
 gb|EEE82790.1| hypothetical protein POPTR_0001s10370g [Populus trichocarpa]
Length=354

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVN AEEAKLAR+ +K    ALLSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNFAEEAKLAREGVKAPGPALLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEG RG+FKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASK ILW YR+QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKRILWFYRQQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + K EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED +L    RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLLKTNPFGLVEDNELGVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_008360687.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Malus domestica]
Length=356

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 158/170 (93%), Gaps = 2/170 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrtav  362
            MASE+VK T + AV  IVNLAEEAKLA + +K PT H LLSI KSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVKRTSDSAVSTIVNLAEEAKLASEGVKAPTGHVLLSIAKSLVAGGVAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE+ASKGILW YR+QTGNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  YEEASKGILWFYRQQTGNEDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  170


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L++G   +   +VP   + F  
Sbjct  165  PMDMVRGRLTVQTDMSPRQYRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAV  224

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  225  YESLKD---WLIKSRPFGLVQDSELSVPTRLACGAAAGTVGQTVAYPLDVIR  273



>gb|KEH18704.1| grave disease carrier protein [Medicago truncatula]
Length=361

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 161/171 (94%), Gaps = 4/171 (2%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI---KPTSHALLSICKSLvaggvaggvsrta  359
            MASE+VK+GE AV KIVNLAEEAKLAR+ +   KP ++A  SICKSLVAGGVAGGVSRTA
Sbjct  6    MASEDVKSGESAVTKIVNLAEEAKLAREGVVKAKP-NYAFGSICKSLVAGGVAGGVSRTA  64

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLER+KILLQVQNPHNIKY+GT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFF
Sbjct  65   VAPLERMKILLQVQNPHNIKYSGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFF  124

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQASKGIL LYR+QTGNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  125  SYEQASKGILHLYRQQTGNEDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  175


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  170  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  229

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE + K  L   +     +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  230  YE-SLKDYLIKTKPFGLAQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  278



>ref|XP_011022540.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Populus euphratica]
Length=354

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MA E+VKT E AV  IVNLAEEAKLAR+ +K    ALL+ICKSL AGGVAGGVSRTAVAP
Sbjct  1    MAPEDVKTSESAVSTIVNLAEEAKLAREGVKAPGTALLNICKSLFAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEG RG+FKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILW YR QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWFYRRQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 52/112 (46%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + K EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     E+ +L    RL  GA AG    +  YP+D++R
Sbjct  223  YESLKD---WLLKTKPFGLVEENELGVATRLACGAAAGTFGQTVAYPLDVIR  271



>ref|XP_007218199.1| hypothetical protein PRUPE_ppa007790mg [Prunus persica]
 gb|EMJ19398.1| hypothetical protein PRUPE_ppa007790mg [Prunus persica]
Length=355

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E AV  IVNLAEEAK+AR+ + K  S A+LS+CKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKPSESAVSTIVNLAEEAKMAREGVVKAPSLAVLSVCKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPHNIKYNGT+QGLKYIW++EGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHNIKYNGTIQGLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL LYR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILLLYRDQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTENSPFQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED  L+   RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLIKSRPFGLVEDTDLSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_010544425.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Tarenaya hassleriana]
Length=355

 Score =   271 bits (692),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 160/169 (95%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VKT E  AV  IVNLAEEAKLAR+ +K  S+A+LS+CKSLVAGGVAGG+SRTAVA
Sbjct  1    MASEDVKTSESAAVSTIVNLAEEAKLAREGVKAPSYAVLSVCKSLVAGGVAGGLSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPH+IKYNGT+QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHSIKYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++YR+QTGNE+AQLTP+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYMYRQQTGNENAQLTPVLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGIFHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKANPYGLAQDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>gb|ABK96372.1| unknown [Populus trichocarpa x Populus deltoides]
Length=354

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVN AEEAKLAR+ +K    ALLSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNFAEEAKLAREGVKAPGPALLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIW+TEG RG+FKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASK ILW YR+QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKRILWFYRQQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + K EG R L+KG   +   ++P   + F  
Sbjct  163  PMDMVRGRLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED +L    RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLLKTNPFGLVEDNELGVTTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_006654848.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Oryza brachyantha]
Length=355

 Score =   270 bits (691),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 156/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K  SH LLSICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSRGDTAVTTIVNLAEEAKLAREGVKAPSHQLLSICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS GILWLYR QTG+EDAQL+PLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASSGILWLYRRQTGDEDAQLSPLLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +    +  +D +L  + RLG GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLLKTNPLDLAKDNELHVVTRLGCGAVAGTIGQTVAYPLDVIR  274



>emb|CAN60251.1| hypothetical protein VITISV_039402 [Vitis vinifera]
Length=350

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S+A+LS+ KSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKPSESAVTTIVNLAEEAKLAREGVKAPSYAILSVAKSLTAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGT+QGLKYIWKTEGFRGLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDM  686
            QASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMD+
Sbjct  121  QASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDI  166



>ref|XP_008343426.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Malus domestica]
Length=355

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E AV  IV+LAEEAK+AR+ + K    ALLS+CKSLVAGGVAGGVSRTAVA
Sbjct  1    MASEDVKPSESAVTTIVSLAEEAKMAREGVVKAPXLALLSVCKSLVAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKYNGT+QGLK+IW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYNGTIQGLKHIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGILWLYR+QTGN+DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EQASKGILWLYRDQTGNDDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 6/110 (5%)
 Frame = +3

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            + R +I +Q +N    +Y G    L  + + EG R L+KG   +   +VP   + F  YE
Sbjct  167  MVRGRITVQTEN-SPFQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYE  225

Query  549  QASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
                   WL + +     +D  L+   RL  GA AG +  +  YP+D++R
Sbjct  226  SLKD---WLIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>gb|EPS68599.1| hypothetical protein M569_06168 [Genlisea aurea]
Length=352

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+V TGE AV  IVN AEEAKLA++EIKP      SICKSL+AGGVAGGVSRTAVAP
Sbjct  1    MASEDVNTGESAVSTIVNFAEEAKLAKEEIKPLKPQFYSICKSLIAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+I+YNGT+QGLKYIW+TEGF+GLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIRYNGTIQGLKYIWRTEGFKGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LYR+QTGNEDAQ  P+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYRQQTGNEDAQHNPVLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 1/110 (1%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EGFR L++G   +   +VP   + F  
Sbjct  163  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGFRALYRGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE     I+        NE+ +L  + RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKDVIVASKPLGLVNENDELGVVTRLACGAAAGTVGQTVAYPLDVIR  272



>gb|KJB52266.1| hypothetical protein B456_008G252700 [Gossypium raimondii]
Length=354

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAK A++ ++  SHA LSICKSLVAGGVAGGVSR+AVAP
Sbjct  1    MASEDVKRSESAVTTIVNLAEEAKFAKEGVQAPSHAFLSICKSLVAGGVAGGVSRSAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH IKYNGT+QGLKYIWKTEGFRG+FKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHGIKYNGTIQGLKYIWKTEGFRGMFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGIL+LYR+Q+G EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILYLYRQQSGIEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +   EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTEMSPRHYRGIFHALTTVLWEEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L    +L  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLIKRRPFGLVEDSELGVTTKLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_010661886.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
isoform X2 [Vitis vinifera]
Length=353

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S+A+LS+ KSL AGGVAGGVSRTAVAP
Sbjct  1    MASEDVKPSESAVTTIVNLAEEAKLAREGVKAPSYAILSVAKSLTAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGT+QGLKYIWKTEGFRGLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QTGN DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYLYQQQTGN-DAQLTPLLRLGAGACAGIIAMSATYPMDMVR  167


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  162  PMDMVRGRLTVQTENSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAV  221

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +      D +L    RL  GA AG I  +  YP+D++R
Sbjct  222  YESLKD---WLIKSKAFGLVHDNELGVTTRLACGAAAGTIGQTVAYPLDVIR  270



>ref|XP_009352376.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Pyrus x bretschneideri]
Length=356

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrtav  362
            MASE+VK T + AV  IVNLAEEAKLA + +K PT H LLSI KSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVKRTSDSAVSTIVNLAEEAKLASEGVKAPTGHVLLSIAKSLVAGGVAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKY GT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHSIKYKGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE+ASKGILW YR+QTGNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  YEEASKGILWFYRQQTGNEDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  170


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L++G   +   +VP   + F  
Sbjct  165  PMDMVRGRLTVQTDMSPRQYRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAV  224

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+ L RL  GA AG +  +  YP+D++R
Sbjct  225  YESLKD---WLIKSRPFGLVQDSELSVLTRLACGAAAGTVGQTVAYPLDVIR  273



>ref|NP_001130208.1| uncharacterized protein LOC100191302 [Zea mays]
 gb|ACF78358.1| unknown [Zea mays]
 gb|ACF84841.1| unknown [Zea mays]
 gb|ACF86208.1| unknown [Zea mays]
 gb|ACF88271.1| unknown [Zea mays]
 gb|ACG35197.1| Grave disease carrier protein [Zea mays]
 gb|ACL52670.1| unknown [Zea mays]
 gb|AFW79416.1| grave disease carrier protein isoform 1 [Zea mays]
 gb|AFW79417.1| grave disease carrier protein isoform 2 [Zea mays]
Length=355

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K   H +L+ICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSRGDTAVTTIVNLAEEAKLAREGVKAPGHQILTICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQASKGILW YR+QTG EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASKGILWAYRQQTGEEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L+KG   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTDKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +  +     D +L  + RLG GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLLQTNSFGLANDNELHVVTRLGCGAVAGTIGQTVAYPLDVIR  274



>ref|XP_008791452.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Phoenix dactylifera]
Length=357

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V    T E AV  IVNLAEEAKLAR+ +K   H LLSICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSTSESAVTTIVNLAEEAKLAREGVKAPGHELLSICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPHNIKYNGT+QGLKYIW++EGFRGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHNIKYNGTIQGLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQA+ GILW YR Q+GNE+AQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQAASGILWFYRRQSGNENAQLTPVLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L+KG   +   ++P   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+ + RL  GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLVKSKPLGLVEDSELSVVTRLACGAVAGTIGQTVAYPLDVIR  274



>gb|KJB49523.1| hypothetical protein B456_008G123800 [Gossypium raimondii]
Length=352

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 158/168 (94%), Gaps = 2/168 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH++KYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSVKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL+LY++QT  +DAQLTPLLRLGAGACAGIIAMS TYPMDMVR
Sbjct  121  QASKGILYLYQQQT--DDAQLTPLLRLGAGACAGIIAMSTTYPMDMVR  166


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  161  PMDMVRGRLTVQTDSSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  220

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE   K  L   +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  221  YESL-KDRLIKSKAFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  269



>ref|XP_010924827.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Elaeis guineensis]
Length=357

 Score =   268 bits (684),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V    T E AV  IVNLAEEAKLAR+ +K   H LLSICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSTSESAVTTIVNLAEEAKLAREGVKAPGHELLSICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPHNIKYNGT+QGLKYIW++EG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHNIKYNGTMQGLKYIWRSEGVRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQA+ GILWLYR Q+GNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQAASGILWLYRRQSGNEDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L+KG   +   ++P   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED++L+ + RL  GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLVKSNPLGLVEDSELSVVTRLACGAVAGTIGQTVAYPLDVIR  274



>emb|CDX74363.1| BnaA03g26840D [Brassica napus]
Length=353

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK+ E  AV  IVNLAEEAKLAR+ +K  SHA+LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKSTESAAVSTIVNLAEEAKLAREGVKAPSHAVLSICKSLFAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGVRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++YR+QTGNE+AQLTP+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYMYRQQTGNENAQLTPVLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIR  272



>emb|CDX91877.1| BnaC03g31790D [Brassica napus]
Length=353

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK+ E  AV  IVNLAEEAKLAR+ +K  SHA+LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKSTESAAVSTIVNLAEEAKLAREGVKAPSHAVLSICKSLFAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGVRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++YR+QTGNE+AQLTP+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYMYRQQTGNENAQLTPVLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIR  272



>ref|XP_010522928.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Tarenaya hassleriana]
Length=355

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VKT E  AV  IVNLAEEAKLAR+ +K   +A+L +CKSL+AGGVAGGVSRTAVA
Sbjct  1    MASEDVKTSESAAVSTIVNLAEEAKLAREGVKAPGYAVLGVCKSLIAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL+LYR+QTGNE+AQLTP+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYLYRQQTGNENAQLTPVLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTLNSPYQYRGMFHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKANPYGLVQDSELSVTTRLACGAAAGTVGQTIAYPLDVIR  272



>ref|XP_009336244.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 158/170 (93%), Gaps = 3/170 (2%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrtav  362
            MASE+VK T + AV  IVNLAEEAKLA + +K PT HALLSI KSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVKRTSDSAVSTIVNLAEEAKLASEGVKAPTGHALLSIAKSLVAGGVAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y++ASKGILW YR+QTGN DAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  YDEASKGILWFYRQQTGN-DAQLTPLLRLGAGACAGIIAMSATYPMDMVR  169


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTDMSPQQYRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLIKSRPFGLVQDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  272



>ref|XP_002441594.1| hypothetical protein SORBIDRAFT_09g030000 [Sorghum bicolor]
 gb|EES20024.1| hypothetical protein SORBIDRAFT_09g030000 [Sorghum bicolor]
Length=355

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K   H +L+ICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSRGDTAVTTIVNLAEEAKLAREGVKAPGHQILTICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQA+KGILW YR+QTG EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQAAKGILWAYRQQTGEEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTDKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +        D +L  + RLG GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLLQTNPFGLANDNELHVVTRLGCGAVAGTIGQTVAYPLDVIR  274



>ref|XP_009134513.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Brassica rapa]
Length=353

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK+ E  AV  IVNLAEEAKLAR+ +K  SHA+LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKSTESAAVSTIVNLAEEAKLAREGVKAPSHAVLSICKSLFAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGVRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQAS+GIL++YR+QTGNE+AQLTP+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASRGILYMYRQQTGNENAQLTPVLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIR  272



>ref|XP_010427766.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Camelina sativa]
Length=355

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E  AV  IVNLAEEAKLAR+ +K  S+A+LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRSESAAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLFAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGIRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++YR+QTGNE+AQLTPLLRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYMYRQQTGNENAQLTPLLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKDNPFGLVENNELTIVTRLTCGAIAGTVGQTIAYPLDVIR  272



>gb|KCW78146.1| hypothetical protein EUGRSUZ_D02348 [Eucalyptus grandis]
Length=353

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVNLAEEAKLAR+ +K  S+A+LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKASEKAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL LY++QTGN DAQLTP LRLGAGACAGIIAMSATYPMD+VR
Sbjct  121  QASKGILLLYQQQTGN-DAQLTPPLRLGAGACAGIIAMSATYPMDLVR  167


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  162  PMDLVRGRLTVQTENSPYQYRGMFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  221

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE   +   WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  222  YESLKE---WLIKNRPFGLMEDSELSVTTRLACGAVAGTVGQTVAYPLDVIR  270



>ref|XP_010422770.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Camelina sativa]
Length=355

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK T   AV  IVNLAEEAKLAR+ +K  S+A+LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRTESAAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLFAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++YR+QTGNE+AQLTPLLRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYMYRQQTGNENAQLTPLLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKDNPFGLVENNELTIVTRLTCGAIAGTVGQTIAYPLDVIR  272



>gb|EAY99214.1| hypothetical protein OsI_21172 [Oryza sativa Indica Group]
Length=355

 Score =   265 bits (678),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K   + +LSICKSL AGGVAGGVSRTA
Sbjct  1    MASEDVVGKSRGDTAVTTIVNLAEEAKLAREGVKGPGYQVLSICKSLFAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLER+KILLQVQNPH+IKYNGT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERMKILLQVQNPHSIKYNGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS GILWLYR+QTGNEDAQL+PLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASSGILWLYRQQTGNEDAQLSPLLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (51%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGSVYREEGFRALYRGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE     +L       G +D +L  + RLG GA AG I  +  YP+D++R
Sbjct  226  YESLKDWLLQTNPYDLG-KDNELHVVTRLGCGAVAGTIGQTVAYPLDVIR  274



>ref|NP_001056459.1| Os05g0585900 [Oryza sativa Japonica Group]
 gb|AAT47068.1| putative peroxisomal Ca-dependent solute carrier [Oryza sativa 
Japonica Group]
 dbj|BAF18373.1| Os05g0585900 [Oryza sativa Japonica Group]
 dbj|BAG93774.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64855.1| hypothetical protein OsJ_19712 [Oryza sativa Japonica Group]
Length=355

 Score =   265 bits (678),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K   + +LSICKSL AGGVAGGVSRTA
Sbjct  1    MASEDVVGKSRGDTAVTTIVNLAEEAKLAREGVKGPGYQVLSICKSLFAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLER+KILLQVQNPH+IKYNGT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERMKILLQVQNPHSIKYNGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS GILWLYR+QTGNEDAQL+PLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASSGILWLYRQQTGNEDAQLSPLLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (51%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGSVYREEGFRALYRGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE     +L       G +D +L  + RLG GA AG I  +  YP+D++R
Sbjct  226  YESLKDWLLQTNPYDLG-KDNELHVVTRLGCGAVAGTIGQTVAYPLDVIR  274



>ref|XP_009394146.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   265 bits (678),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 158/171 (92%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V    TGE AV  IVNLAEEAKLAR+ +K   +A++SICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSTGESAVTTIVNLAEEAKLAREGVKAPGYAVVSICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+I+YNGT+QGLKYIWK+EG RGLF+GNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIQYNGTIQGLKYIWKSEGLRGLFRGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS GILWLYR+Q+GNE+AQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASSGILWLYRQQSGNEEAQLTPVLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L+KG   +   ++P   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED++L+ + RLG GA AG +  +  YP+D++R
Sbjct  226  YESLKD---WLIKSNPYGLVEDSELSVVTRLGCGAVAGTVGQTVAYPLDVIR  274



>ref|XP_010676334.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Beta vulgaris subsp. vulgaris]
Length=355

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  189  MASEEVKT-GELA-VEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtav  362
            MASE+VK  GE A V  IVNLAEEAK A + +K  SHAL+SI KSL AGG+AGGVSRTAV
Sbjct  1    MASEDVKQRGEAAAVSTIVNLAEEAKAATEGVKSPSHALISISKSLAAGGIAGGVSRTAV  60

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFS
Sbjct  61   APLERLKILLQVQNPHSIKYNGTVQGLKYIWQTEGLRGLFKGNGTNCARIVPNSAVKFFS  120

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQASKGILWLYR+QTGNEDA+LTP+LRLGAGACAGIIAMSATYPMD+VR
Sbjct  121  YEQASKGILWLYRQQTGNEDAELTPVLRLGAGACAGIIAMSATYPMDLVR  170


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L+KG   +   ++P   + F  
Sbjct  165  PMDLVRGRLTVQTDKSPQQYRGIYHALTTVFREEGARALYKGWLPSVIGVIPYVGLNFAV  224

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       +L +E      +D +L+   RL  GA AG I  +  YP+D+VR
Sbjct  225  YESLKD---YLVKENPFGLVQDKELSVTTRLACGAVAGTIGQTVAYPLDVVR  273



>gb|KDO76473.1| hypothetical protein CISIN_1g018449mg [Citrus sinensis]
Length=333

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MAS E    E AV  IVNLAEEAKLAR+ +K  SHALLS+ KSLVAGGVAGGVSRTAVAP
Sbjct  1    MASTEDVKSESAVTTIVNLAEEAKLAREGVKAPSHALLSVTKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIWK+EGFRGLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILWLYR QT NE+A+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVR  168



>ref|XP_006288044.1| hypothetical protein CARUB_v10001278mg [Capsella rubella]
 gb|EOA20942.1| hypothetical protein CARUB_v10001278mg [Capsella rubella]
Length=355

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK T   AV  IVNLAEEAKLAR+ +K  S+A+LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRTESAAVSTIVNLAEEAKLAREGVKAPSYAVLSICKSLFAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++YR+QTGNE+AQLTP+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYMYRQQTGNENAQLTPVLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKDNPFGLVENNELTIVTRLTCGAVAGTVGQTIAYPLDVIR  272



>ref|XP_004961067.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Setaria italica]
Length=355

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 156/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K   H +L+ICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVVGKSRGDTAVTTIVNLAEEAKLAREGVKGPGHQVLTICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQASKGILW YR++TG+EDAQL+PLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASKGILWAYRQRTGDEDAQLSPLLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 56/115 (49%), Gaps = 12/115 (10%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTDKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQ-----TGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +        GNE   L  + RLG GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLLQTNPFGLANGNE---LHVVTRLGCGAVAGTIGQTVAYPLDVIR  274



>ref|XP_006439393.1| hypothetical protein CICLE_v10020845mg [Citrus clementina]
 gb|ESR52633.1| hypothetical protein CICLE_v10020845mg [Citrus clementina]
 gb|KDO76470.1| hypothetical protein CISIN_1g018449mg [Citrus sinensis]
Length=355

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MAS E    E AV  IVNLAEEAKLAR+ +K  SHALLS+ KSLVAGGVAGGVSRTAVAP
Sbjct  1    MASTEDVKSESAVTTIVNLAEEAKLAREGVKAPSHALLSVTKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIWK+EGFRGLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILWLYR QT NE+A+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVR  168



>ref|XP_011073667.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Sesamum indicum]
 ref|XP_011073676.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Sesamum indicum]
Length=357

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 152/171 (89%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV--KTGEL-AVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            M SE+   KTGE  AV  IVNLAEEAK  R+ + P S    SICKSL AGGVAGGVSRTA
Sbjct  1    MGSEDTVGKTGETEAVSTIVNLAEEAKDYREGVTPPSRTFRSICKSLFAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPHNIKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHNIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYE+ASKGILWLYR+QTG EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEEASKGILWLYRQQTGTEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  171



>ref|XP_009386297.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=358

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 155/172 (90%), Gaps = 4/172 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLA-EEAKLARDEIKPTSHALLSICKSLvaggvaggvsrt  356
            MASE V    TGE AV  IVNLA EEAKLAR+ +K   HA+LSICKSLVAGGVAGGVSRT
Sbjct  1    MASENVVGKNTGESAVTTIVNLAAEEAKLAREGVKAPGHAILSICKSLVAGGVAGGVSRT  60

Query  357  avaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            AVAPLERLKILLQVQNPH+I+YNGT+QGLKYIWK+EGFRGLFKGNGTNCARI+PNSAVKF
Sbjct  61   AVAPLERLKILLQVQNPHSIQYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKF  120

Query  537  FSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            FSYEQAS GILWLYR  +G EDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  FSYEQASSGILWLYRRHSGKEDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  172


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L+ ++  EGFR L+KG   +   ++P   + F  
Sbjct  167  PMDMVRGRITVQTEKSPYQYRGMFHALRTVYCEEGFRALYKGWLPSVIGVIPYVGLNFAV  226

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED++L+ + RLG GA AG +  +  YP+D++R
Sbjct  227  YESLKD---WLIKTNPYGLVEDSELSIVTRLGCGAVAGTVGQTVAYPLDVIR  275



>gb|KFK42532.1| hypothetical protein AALP_AA1G006600 [Arabis alpina]
Length=354

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E  AV  IVNLAEEAKLAR+ +K  SHA++S+CKSL+AGGVAGGVSRTAVA
Sbjct  1    MASEDVKATESAAVSTIVNLAEEAKLAREGVKAPSHAIISVCKSLIAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKYNGTVQGLKYIW++EG RGLFKGNGTNCARIVPNSAVKF+SY
Sbjct  61   PLERMKILLQVQNPHNIKYNGTVQGLKYIWRSEGLRGLFKGNGTNCARIVPNSAVKFYSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++YR+QTGNE+AQLTP+LRL AGA AGIIAMSATYPMDMVR
Sbjct  121  EQASKGILYMYRQQTGNENAQLTPVLRLMAGATAGIIAMSATYPMDMVR  169


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTSNSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      +D++LT   RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKDNPFGLVQDSELTVTTRLACGAAAGTVGQTIAYPLDVIR  272



>ref|XP_006476410.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Citrus sinensis]
Length=355

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MAS E    E AV  IVNLAEEAKLAR+ +K  SHAL S+ KSLVAGGVAGGVSRTAVAP
Sbjct  1    MASTEDVKSESAVTTIVNLAEEAKLAREGVKAPSHALRSVTKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIWK+EGFRGLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILWLYR QT NE+A+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVR  168



>ref|XP_009617594.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana tomentosiformis]
Length=355

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV--KTGELAVEKIVNLAEEAKLARDEIKPTSHA-LLSICKSLvaggvaggvsrta  359
            MASE+V  K  E AV  IVNLAEEAK+A + +K  SHA + SI KSL AGG+AGGVSRTA
Sbjct  1    MASEDVVGKRSESAVTTIVNLAEEAKIASEGVKAPSHAAIFSIAKSLAAGGIAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYE+AS+GILW YR+QTGNEDA+LTPLLRLGAGACAGIIAMSATYPMD+VR
Sbjct  121  SYEEASRGILWFYRQQTGNEDAELTPLLRLGAGACAGIIAMSATYPMDLVR  171


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L+ ++  EG R L+KG   +   ++P   + F  
Sbjct  166  PMDLVRGRITVQTDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+   +LG GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLVKTRPFGLAQDSELSVTTKLGCGAVAGTIGQTVAYPLDVIR  274



>ref|XP_009763306.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana sylvestris]
Length=355

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV--KTGELAVEKIVNLAEEAKLARDEIKPTSHA-LLSICKSLvaggvaggvsrta  359
            MASE+V  K  E AV  IVNLAEEAK+A + +K  SHA + SI KSL AGG+AGGVSRTA
Sbjct  1    MASEDVVGKRSESAVTTIVNLAEEAKIASEGVKAPSHAAIFSIIKSLAAGGIAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYE+AS+GILW YR+QTGNEDA+LTPLLRLGAGACAGIIAMSATYPMD+VR
Sbjct  121  SYEEASRGILWFYRQQTGNEDAELTPLLRLGAGACAGIIAMSATYPMDLVR  171


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L+ ++  EG R L+KG   +   ++P   + F  
Sbjct  166  PMDLVRGRITVQTDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+   +LG GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLVKTRPLGLAQDSELSVTTKLGCGAVAGTIGQTVAYPLDVIR  274



>ref|XP_004298882.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Fragaria vesca subsp. vesca]
Length=358

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 158/172 (92%), Gaps = 4/172 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrt  356
            M+SE+V   +T E AV  IVNLAEEAKLA + +K PT  ALLSI KSLVAGGVAGGVSRT
Sbjct  1    MSSEDVAGKRTSETAVSTIVNLAEEAKLASEGVKAPTQAALLSIAKSLVAGGVAGGVSRT  60

Query  357  avaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            AVAPLERLKILLQVQNPH+IKYNGTVQGLKYIW++EGFRGLFKGNGTNCARIVPNSAVKF
Sbjct  61   AVAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKF  120

Query  537  FSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            FSYE+AS+GILW YR+QTG+E+AQLTPLLRLGAGACAGIIAMSATYP+D+VR
Sbjct  121  FSYEEASRGILWFYRQQTGDENAQLTPLLRLGAGACAGIIAMSATYPLDLVR  172


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PL+ ++  L VQ  ++ + Y G    L  +++ EG R L+KG   +   ++P   + F  
Sbjct  167  PLDLVRGRLTVQTENSPRQYRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFAV  226

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D+ L+   RL  GA AG +  +  YP+D+VR
Sbjct  227  YESLKD---WLIKTRPFGLVQDSDLSITTRLACGAAAGTVGQTVAYPLDVVR  275



>ref|XP_003567810.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Brachypodium distachyon]
Length=354

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K   H +L+ICKSL AGGVAGG+SRTA
Sbjct  1    MASEDVVGKSRGDTAVNTIVNLAEEAKLAREGVKGPGHQVLTICKSLFAGGVAGGLSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW TEGFRGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWGTEGFRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS+GIL+LYR+Q+G+EDAQL+P+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  SYEQASRGILYLYRQQSGDEDAQLSPVLRLGAGATAGIIAMSATYPMDMVR  171


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTEQSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +  T    +D +L  + RLG GA AG I  +  YP+D+VR
Sbjct  226  YESLKD---WLLQTNTLGLAKDNELHIVTRLGCGAVAGTIGQTVAYPLDVVR  274



>emb|CDP12129.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 154/171 (90%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV--KTGELAVEKIVNLAEEAKLARDEIKPTS-HALLSICKSLvaggvaggvsrta  359
            MASE+V  K  E AV  IVNLAEEAK+AR+ +K  S HALLSICKSL AGG+AGGVSRTA
Sbjct  1    MASEDVVGKRSESAVTTIVNLAEEAKIAREGVKAHSRHALLSICKSLAAGGIAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGF GLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFMGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS+ ILW YR+QTG  DA+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASRQILWFYRKQTGRGDAELTPVLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L+ ++  EG R L+KG   +   ++P   + F  
Sbjct  166  PMDMVRGRLTVQTEKSPTQYRGIFHALRTVFIEEGPRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ++++L+   +L  GA AG +  +  YP+D++R
Sbjct  226  YESLKD---WLVKSRPLGLIQESELSITTKLACGAVAGTVGQTVAYPLDVIR  274



>ref|XP_006439392.1| hypothetical protein CICLE_v10020845mg [Citrus clementina]
 gb|ESR52632.1| hypothetical protein CICLE_v10020845mg [Citrus clementina]
Length=354

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MAS E    E AV  IVNLAEEAKLAR+ +K  SHALLS+ KSLVAGGVAGGVSRTAVAP
Sbjct  1    MASTEDVKSESAVTTIVNLAEEAKLAREGVKAPSHALLSVTKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH+IKYNGT+QGLKYIWK+EGFRGLFKGNGTNCARI+PNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +ASKGILWLYR QT NE A+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  EASKGILWLYRRQTRNE-AELTPVLRLGAGACAGIIAMSATYPMDMVR  167



>ref|XP_004245537.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Solanum lycopersicum]
Length=357

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 154/171 (90%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV--KTGELAVEKIVNLAEEAKLARDEIKPTSHA-LLSICKSLvaggvaggvsrta  359
            MASE+V  K  E AV  IVNLAEEAK+A + +K  SHA + S+CKSL AGG+AGGVSRTA
Sbjct  1    MASEDVVGKRSESAVTTIVNLAEEAKMASEGVKAPSHAAIFSVCKSLAAGGIAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQN H+IKYNGTVQGLKYIW+TEG RG+FKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNSHSIKYNGTVQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYE+ASKGILW YR+QTGNEDA+LTPLLRLGAGACAGIIAMSATYPMD+VR
Sbjct  121  SYEEASKGILWFYRQQTGNEDAELTPLLRLGAGACAGIIAMSATYPMDLVR  171


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L+ ++  EG R L+KG   +   ++P   + F  
Sbjct  166  PMDLVRGRITVQTDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D +L+ + +LG GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLVKTRPFGLAQDTELSVMTKLGCGAVAGTIGQTVAYPLDVIR  274



>ref|XP_011093053.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Sesamum indicum]
Length=354

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV KIVN AEEAKLA++EIKPT + + SICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSESAVSKIVNFAEEAKLAKEEIKPTKYQVYSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPHNIKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYE
Sbjct  61   LERLKILLQVQNPHNIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  120

Query  549  QASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QASKGIL++Y++QTGNEDAQLTP+LRL AGACAGIIAMSATYPMDMVR
Sbjct  121  QASKGILYMYQQQTGNEDAQLTPVLRLAAGACAGIIAMSATYPMDMVR  168


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EGFR L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRLTVQTEKSPYQYRGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED +L  + RL  GA AG +  +  YP+D++R
Sbjct  223  YESLKD---WLLKSNPYGLVEDNELGVVTRLACGAAAGTVGQTVAYPLDVIR  271



>ref|XP_006343883.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Solanum tuberosum]
Length=357

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 154/171 (90%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV--KTGELAVEKIVNLAEEAKLARDEIKPTSHA-LLSICKSLvaggvaggvsrta  359
            MASE+V  K  E AV  IVNLAEEAK+A + +K  SHA + S+CKSL AGG+AGGVSRTA
Sbjct  1    MASEDVVGKRSESAVTTIVNLAEEAKMASEGVKAPSHAAIFSVCKSLAAGGIAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQN H+IKYNGTVQGLKYIW+TEG RG+FKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNSHSIKYNGTVQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYE+ASKGILW YR+QTGNEDA+LTPLLRLGAGACAGIIAMSATYPMD+VR
Sbjct  121  SYEEASKGILWFYRQQTGNEDAELTPLLRLGAGACAGIIAMSATYPMDLVR  171


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L+ ++  EG R L+KG   +   ++P   + F  
Sbjct  166  PMDLVRGRITVQTDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D +L+ + +LG GA AG I  +  YP+D++R
Sbjct  226  YESLKD---WLVKTRPFGLAQDTELSVMTKLGCGAVAGTIGQTVAYPLDVIR  274



>dbj|BAJ94251.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K   H +L+ICKSL AGGVAGG+SRTA
Sbjct  1    MASEDVVGKSRGDTAVNTIVNLAEEAKLAREGVKGPGHQVLTICKSLFAGGVAGGLSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS+GIL+LYR+QTG+E+AQL+P+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  SYEQASRGILYLYRQQTGDENAQLSPILRLGAGATAGIIAMSATYPMDMVR  171


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +    +  +D +L  + RLG GA AG I  +  YP+D+VR
Sbjct  226  YESLKD---WLLQSNAFDLAKDNELHVVTRLGCGAVAGTIGQTVAYPLDVVR  274



>ref|XP_003521800.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform 1 [Glycine max]
Length=345

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  231  KIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPH  410
            K+VNLAEEAKLAR+ +   S+A  +ICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH
Sbjct  6    KVVNLAEEAKLAREGVTTPSYAFTTICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH  65

Query  411  NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQT  590
            +IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL LYR+QT
Sbjct  66   SIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYRKQT  125

Query  591  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  126  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  159


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  154  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  213

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  214  YESLKD---WLIKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  262



>dbj|BAJ85614.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V     G+ AV  IVNLAEEAKLAR+ +K   H +L+ICKSL AGGVAGG+SRTA
Sbjct  1    MASEDVVGKSRGDTAVNTIVNLAEEAKLAREGVKGPGHQVLTICKSLFAGGVAGGLSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS+GIL+LYR+QTG+E+AQL+P+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  SYEQASRGILYLYRQQTGDENAQLSPILRLGAGATAGIIAMSATYPMDMVR  171


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  ++  EGFR L++G   +   +VP   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALGTVYCEEGFRALYRGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +    +  +D +L  + RLG GA AG I  +  YP+D+VR
Sbjct  226  YESLKD---WLLQSNAFDLAKDNELHVVTRLGCGAVAGTIGQTVAYPLDVVR  274



>ref|XP_010095712.1| Pentatricopeptide repeat-containing protein [Morus notabilis]
 gb|EXB61982.1| Pentatricopeptide repeat-containing protein [Morus notabilis]
Length=811

 Score =   269 bits (688),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 157/171 (92%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDE---IKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+VK  E AV  IVNLAEEAKLAR     +K  ++A+LSICKSLVAGGVAGGVSRTA
Sbjct  1    MASEDVKQSESAVSTIVNLAEEAKLARARETVVKAPNYAVLSICKSLVAGGVAGGVSRTA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFF
Sbjct  61   VAPLERLKILLQVQNPHNIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFF  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQAS GIL LYR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASNGILLLYRQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  171



>ref|XP_006396301.1| hypothetical protein EUTSA_v10028766mg [Eutrema salsugineum]
 gb|ESQ37754.1| hypothetical protein EUTSA_v10028766mg [Eutrema salsugineum]
Length=355

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK T   AV  IVNLAEEAKLAR+ +K  S+A+LS+CKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRTESAAVSTIVNLAEEAKLAREGVKAPSYAILSVCKSLFAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQAS+G+L+LYR +T NE+AQLTPLLRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  EQASEGLLYLYRRRTKNENAQLTPLLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EGFR L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGFRALYRGWLPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+  LT + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLVKDNPFGLVENNDLTIITRLSCGAIAGTVGQTIAYPLDVIR  272



>ref|XP_007147281.1| hypothetical protein PHAVU_006G110800g [Phaseolus vulgaris]
 gb|ESW19275.1| hypothetical protein PHAVU_006G110800g [Phaseolus vulgaris]
Length=345

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  231  KIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPH  410
            KIVNL EE  LAR+ +KP S+A  +ICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH
Sbjct  6    KIVNLTEEPNLAREGVKPPSYAFTTICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH  65

Query  411  NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQT  590
            NIKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL LY++QT
Sbjct  66   NIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILQLYQKQT  125

Query  591  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            GNEDAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  126  GNEDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  159


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + K EG R L+KG   +   ++P   + F  
Sbjct  154  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAV  213

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  214  YESLKD---WLVKSNPFGIVQDSELSVTTRLACGAAAGTMGQTVAYPLDVIR  262



>ref|XP_009386307.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=357

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 155/172 (90%), Gaps = 5/172 (3%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLA-EEAKLARDEIKPTSHALLSICKSLvaggvaggvsrt  356
            MASE V    TGE AV  IVNLA EEAKLAR+ +K   HA+LSICKSLVAGGVAGGVSRT
Sbjct  1    MASENVVGKNTGESAVTTIVNLAAEEAKLAREGVKAPGHAILSICKSLVAGGVAGGVSRT  60

Query  357  avaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            AVAPLERLKILLQVQNPH+I+YNGT+QGLKYIWK+EGFRGLFKGNGTNCARI+PNSAVKF
Sbjct  61   AVAPLERLKILLQVQNPHSIQYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKF  120

Query  537  FSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            FSYEQAS GILWLYR  +G +DAQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  FSYEQASSGILWLYRRHSG-KDAQLTPVLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L+ ++  EGFR L+KG   +   ++P   + F  
Sbjct  166  PMDMVRGRITVQTEKSPYQYRGMFHALRTVYCEEGFRALYKGWLPSVIGVIPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       ED++L+ + RLG GA AG +  +  YP+D++R
Sbjct  226  YESLKD---WLIKTNPYGLVEDSELSIVTRLGCGAVAGTVGQTVAYPLDVIR  274



>ref|XP_010104983.1| Mitochondrial substrate carrier family protein B [Morus notabilis]
 gb|EXC02940.1| Mitochondrial substrate carrier family protein B [Morus notabilis]
Length=357

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 153/171 (89%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  MASEEV---KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrta  359
            MASE+V    T E AV  IVNLAEEAK A + +K  SH  LS+CKSLVAGGVAGGVSR+A
Sbjct  1    MASEDVVGKTTSESAVTTIVNLAEEAKHASEGVKAPSHVFLSVCKSLVAGGVAGGVSRSA  60

Query  360  vaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            VAPLERLKILLQVQNPH+I+Y+GT+QGLKYIWKTEG RG+FKGNGTNCARIVPNSAVKF+
Sbjct  61   VAPLERLKILLQVQNPHSIRYSGTIQGLKYIWKTEGVRGMFKGNGTNCARIVPNSAVKFY  120

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYEQASKGIL LYR+QTG E+AQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  SYEQASKGILCLYRQQTGEEEAQLTPLLRLGAGACAGIIAMSATYPMDMVR  171


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  166  PMDMVRGRLTVQTEKSPRQYRGIFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  225

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  226  YESLKD---WLIKARPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  274



>ref|XP_010055845.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW72394.1| hypothetical protein EUGRSUZ_E00845 [Eucalyptus grandis]
Length=353

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 152/170 (89%), Gaps = 5/170 (3%)
 Frame = +3

Query  189  MASEEV--KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtav  362
            MASE+V  +  E AV  IVNLAEEA    + +K  SHALLSICKSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVVSERRESAVSTIVNLAEEAS---EGVKAPSHALLSICKSLVAGGVAGGVSRTAV  57

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFS
Sbjct  58   APLERLKILLQVQNPHSIKYNGTMQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFS  117

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQAS GILWLYR+Q G EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  118  YEQASHGILWLYRQQPGKEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  167


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 55/114 (48%), Gaps = 10/114 (9%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  ++K EG R L++G   +   +VP   + F  
Sbjct  162  PMDMVRGRLTVQTEKSPRQYRGIYHALSTVFKEEGPRALYRGWLPSVIGVVPYVGLNFAV  221

Query  543  YEQASKGILWLYREQTGN----EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE     +L     QT      ED +L+   RL  GA AG I  +  YP+D++R
Sbjct  222  YESLKDYLL-----QTNPFGLVEDNELSVTTRLACGAAAGTIGQTVAYPLDVIR  270



>ref|XP_003554758.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Glycine max]
Length=345

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  231  KIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPH  410
            K+VNLAEEAKLAR+ +   S+A  +ICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH
Sbjct  6    KVVNLAEEAKLAREGVTAPSYAFTTICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH  65

Query  411  NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQT  590
            +IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL LY++QT
Sbjct  66   SIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYQKQT  125

Query  591  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            GNEDAQLTPL RLGAGACAGIIAMSATYPMDMVR
Sbjct  126  GNEDAQLTPLFRLGAGACAGIIAMSATYPMDMVR  159


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  154  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  213

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  214  YESLKD---WLVKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  262



>gb|KHN43116.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=345

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  231  KIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPH  410
            K+VNLAEEAKLAR+ +   S+A  +ICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH
Sbjct  6    KVVNLAEEAKLAREGVTAPSYAFTTICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH  65

Query  411  NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQT  590
            +IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL LY++QT
Sbjct  66   SIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYQKQT  125

Query  591  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            GNEDAQLTPL RLGAGACAGIIAMSATYPMDMVR
Sbjct  126  GNEDAQLTPLFRLGAGACAGIIAMSATYPMDMVR  159


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  154  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  213

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  214  YESLKD---WLVKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  262



>gb|KHN35367.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=345

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  231  KIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPH  410
            K+VNLAEEAKLA + +   S+A  +ICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH
Sbjct  6    KVVNLAEEAKLAGEGVTTPSYAFTTICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH  65

Query  411  NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQT  590
            +IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL LYR+QT
Sbjct  66   SIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYRKQT  125

Query  591  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  126  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  159


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  154  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  213

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  214  YESLKD---WLIKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  262



>ref|XP_004516398.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Cicer arietinum]
Length=354

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 157/169 (93%), Gaps = 2/169 (1%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEI-KPTSHALLSICKSLvaggvaggvsrtava  365
            MAS +VKTGE AV KIVNL EEAKLAR+ + K  ++A+ SICKSLVAGGVAGGVSRTAVA
Sbjct  1    MASVDVKTGESAVTKIVNL-EEAKLAREGVVKSPNYAIGSICKSLVAGGVAGGVSRTAVA  59

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQN  ++KYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  60   PLERMKILLQVQNHQSVKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  119

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL LY++QTGNE+AQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  120  EQASKGILHLYQQQTGNENAQLTPVLRLGAGACAGIIAMSATYPMDMVR  168


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  163  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  222

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  223  YESLKD---WLIKSRPFGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  271



>gb|KFK30686.1| hypothetical protein AALP_AA6G014800 [Arabis alpina]
Length=355

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E  AV  IV +AEEAKLA + +K  S   LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRSESAAVSTIVKMAEEAKLATEGVKAPSLGFLSICKSLFAGGVAGGVSRTAVA  60

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPH+IKYNGTVQGLKYIW+TEG RGLFKGNGTNCARI+PNSAVKFFSY
Sbjct  61   PLERMKILLQVQNPHSIKYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIIPNSAVKFFSY  120

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E+AS+GIL++YR QTGNE+AQLTPLLRLGAGA AGIIAMSATYPMDMVR
Sbjct  121  ERASEGILYMYRRQTGNENAQLTPLLRLGAGATAGIIAMSATYPMDMVR  169


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  164  PMDMVRGRLTVQTANSPYQYRGITHALVTVLRQEGPRALYRGWVPSVIGVVPYVGLNFAV  223

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+++L  + RL  GA AG +  +  YP+D++R
Sbjct  224  YESLKD---WLIKDNPFGLAENSELGIVTRLSCGAVAGTLGQTVAYPLDVIR  272



>ref|XP_006847299.1| hypothetical protein AMTR_s00015p00209030 [Amborella trichopoda]
 gb|ERN08880.1| hypothetical protein AMTR_s00015p00209030 [Amborella trichopoda]
Length=365

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 152/180 (84%), Gaps = 15/180 (8%)
 Frame = +3

Query  189  MASEEV------------KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvagg  332
            MASE+V            ++ E AV   VNLAEEA    + +K   HA+LSICKSLVAGG
Sbjct  1    MASEDVVGRSGSNTTVGFQSKESAVTTFVNLAEEAS---EGVKAPGHAILSICKSLVAGG  57

Query  333  vaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARI  512
            VAGGVSRTAVAPLERLKILLQVQNPHNIKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARI
Sbjct  58   VAGGVSRTAVAPLERLKILLQVQNPHNIKYNGTIQGLKYIWQTEGFRGLFKGNGTNCARI  117

Query  513  VPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            VPNSAVKFFSYEQAS  ILWLYR+Q GNEDAQLTP+LRLGAGACAGIIAMSATYP+DMVR
Sbjct  118  VPNSAVKFFSYEQASSAILWLYRQQPGNEDAQLTPVLRLGAGACAGIIAMSATYPLDMVR  177


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PL+ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  172  PLDMVRGRLTVQTEKSPYRYRGMFDALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  231

Query  543  YEQASKGILWLYREQ----TGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +       +  +L+ L RLG GA AG +  +  YP+D++R
Sbjct  232  YESLKD---WLIKTKALGLVDPDSEELSVLTRLGCGAAAGTVGQTVAYPLDVIR  282



>ref|XP_009111419.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Brassica rapa]
 emb|CDY48505.1| BnaA09g00180D [Brassica napus]
 emb|CDY07175.1| BnaCnng01900D [Brassica napus]
Length=350

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 152/169 (90%), Gaps = 4/169 (2%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK  E  AV  IVNLAEEA   R+ +K   +A+LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRSESAAVSTIVNLAEEA---REGVKAPGYAVLSICKSLFAGGVAGGVSRTAVA  57

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  58   PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  117

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL+LYR+Q GNE+AQLTP+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  118  EQASKGILYLYRQQPGNENAQLTPVLRLGAGATAGIIAMSATYPMDMVR  166


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  161  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  220

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  221  YESLKD---WLVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIR  269



>ref|XP_002874996.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51255.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=352

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 152/169 (90%), Gaps = 4/169 (2%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK T   AV  IVNLAEEA   R+ +K  S+A  SICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRTESAAVSTIVNLAEEA---REGVKAPSYAFKSICKSLFAGGVAGGVSRTAVA  57

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPH+IKY+GTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  58   PLERMKILLQVQNPHSIKYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  117

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL++YR++TGNE+AQLTPLLRLGAGA AGIIAMSATYPMDMVR
Sbjct  118  EQASKGILYMYRQRTGNENAQLTPLLRLGAGATAGIIAMSATYPMDMVR  166


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  161  PMDMVRGRLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAV  220

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL ++      ++  LT + RL  GA AG +  S  YP+D++R
Sbjct  221  YETLKD---WLLKDNPFGLVQNNDLTIVTRLTCGAIAGTVGQSIAYPLDVIR  269



>ref|XP_003521801.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform 2 [Glycine max]
Length=359

 Score =   248 bits (632),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 14/168 (8%)
 Frame = +3

Query  231  KIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPH  410
            K+VNLAEEAKLAR+ +   S+A  +ICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH
Sbjct  6    KVVNLAEEAKLAREGVTTPSYAFTTICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPH  65

Query  411  NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASK----------  560
            +IKYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASK          
Sbjct  66   SIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKSLSPLFTDCS  125

Query  561  ----GILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
                GIL LYR+QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  126  FSGRGILHLYRKQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  173


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  168  PMDMVRGRITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  227

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +       +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  228  YESLKD---WLIKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  276



>ref|NP_192019.1| adenine nucleotide transporter 1 [Arabidopsis thaliana]
 sp|O04619.1|ADNT1_ARATH RecName: Full=Mitochondrial adenine nucleotide transporter ADNT1; 
AltName: Full=Adenine nucleotide transporter 1 [Arabidopsis 
thaliana]
 gb|AAK25878.1|AF360168_1 putative carrier protein [Arabidopsis thaliana]
 gb|AAL06538.1|AF412085_1 AT4g01100/F2N1_16 [Arabidopsis thaliana]
 gb|AAB61037.1| similar to mitochondrial carrier family [Arabidopsis thaliana]
 emb|CAB80919.1| putative carrier protein [Arabidopsis thaliana]
 gb|AAL07192.1| putative carrier protein [Arabidopsis thaliana]
 emb|CAP64296.1| adenine nucleotide transporter, ADNT1 [Arabidopsis thaliana]
 gb|AEE81981.1| adenine nucleotide transporter 1 [Arabidopsis thaliana]
Length=352

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 151/169 (89%), Gaps = 4/169 (2%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK T   AV  IVNLAEEA   R+ +K  S+A  SICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRTESAAVSTIVNLAEEA---REGVKAPSYAFKSICKSLFAGGVAGGVSRTAVA  57

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLK+IW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  58   PLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  117

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQAS GIL++YR++TGNE+AQLTPLLRLGAGA AGIIAMSATYPMDMVR
Sbjct  118  EQASNGILYMYRQRTGNENAQLTPLLRLGAGATAGIIAMSATYPMDMVR  166


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  161  PMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLNFSV  220

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +E      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  221  YESLKD---WLVKENPYGLVENNELTVVTRLTCGAIAGTVGQTIAYPLDVIR  269



>gb|ADE77740.1| unknown [Picea sitchensis]
Length=371

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  216  ELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQ  395
            E AV   VNLAEEAKLA + +K   HA+L+ICKSL AGGVAGGVSR+AVAPLERLKILLQ
Sbjct  27   EAAVSTFVNLAEEAKLASEGVKAPGHAVLTICKSLFAGGVAGGVSRSAVAPLERLKILLQ  86

Query  396  VQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWL  575
            VQNP + KYNGT+QGL+YIW TEG RGLFKGNGTNCARIVPNSAVKF+SYEQAS+ ILW 
Sbjct  87   VQNPLHRKYNGTIQGLRYIWNTEGLRGLFKGNGTNCARIVPNSAVKFYSYEQASRAILWF  146

Query  576  YREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YR+QTGNEDA+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  147  YRQQTGNEDAELTPVLRLGAGACAGIIAMSATYPMDMVR  185


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  180  PMDMVRGRLTVQTENSPYQYRGMFHALSTVLREEGPRALYKGWFPSVIGVVPYVGLNFAV  239

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     E   L+ + +L  GA AG +  +  YP+D++R
Sbjct  240  YESLKD---WLVKSRPFGLVEGEDLSMVTKLACGAAAGTVGQTVAYPLDVIR  288



>ref|XP_010055846.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Eucalyptus grandis]
Length=370

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 153/187 (82%), Gaps = 22/187 (12%)
 Frame = +3

Query  189  MASEEVKT--GELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtav  362
            MASE+V +   E AV  IVNLAEEA    + +K  SHALLSICKSLVAGGVAGGVSRTAV
Sbjct  1    MASEDVVSERRESAVSTIVNLAEEAS---EGVKAPSHALLSICKSLVAGGVAGGVSRTAV  57

Query  363  aPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            APLERLKILLQVQNPH+IKYNGT+QGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFS
Sbjct  58   APLERLKILLQVQNPHSIKYNGTMQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFS  117

Query  543  YEQASK-----------------GILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSAT  671
            YEQAS+                 GILWLYR+Q G EDAQLTPLLRLGAGACAGIIAMSAT
Sbjct  118  YEQASQYAKLFSFHHIFIYFVHSGILWLYRQQPGKEDAQLTPLLRLGAGACAGIIAMSAT  177

Query  672  YPMDMVR  692
            YPMDMVR
Sbjct  178  YPMDMVR  184


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 55/114 (48%), Gaps = 10/114 (9%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  ++K EG R L++G   +   +VP   + F  
Sbjct  179  PMDMVRGRLTVQTEKSPRQYRGIYHALSTVFKEEGPRALYRGWLPSVIGVVPYVGLNFAV  238

Query  543  YEQASKGILWLYREQTGN----EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE     +L     QT      ED +L+   RL  GA AG I  +  YP+D++R
Sbjct  239  YESLKDYLL-----QTNPFGLVEDNELSVTTRLACGAAAGTIGQTVAYPLDVIR  287



>emb|CDX71722.1| BnaC08g31520D [Brassica napus]
Length=338

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 142/149 (95%), Gaps = 1/149 (1%)
 Frame = +3

Query  246  AEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYN  425
            +E+AK + + +K  S+A++ ICKSL+AGGVAGGVSRTAVAPLERLKILLQVQNPH+IKYN
Sbjct  3    SEDAKRS-EGVKAPSNAVIGICKSLIAGGVAGGVSRTAVAPLERLKILLQVQNPHSIKYN  61

Query  426  GTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDA  605
            GTVQGLKYIW+TEGFRGLFKGNG NCARIVPNSAVKFFSYEQASKGIL+LYR+QTGN+DA
Sbjct  62   GTVQGLKYIWRTEGFRGLFKGNGANCARIVPNSAVKFFSYEQASKGILYLYRQQTGNDDA  121

Query  606  QLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  122  QLTPLLRLGAGACAGIIAMSATYPMDMVR  150


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 8/114 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G V  L  + + EG R L++G   +   +VP   + F  
Sbjct  145  PMDMVRGRLTVQTDKSPYQYRGMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAV  204

Query  543  YEQASKGILWLYREQ----TGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +      N +++LT   RL  GA AG +  +  YP+D+VR
Sbjct  205  YESLKD---WLVKSKPFGIIDNNNSELTVTTRLACGAIAGTMGQTVAYPLDVVR  255



>ref|XP_007158565.1| hypothetical protein PHAVU_002G163100g [Phaseolus vulgaris]
 gb|ESW30559.1| hypothetical protein PHAVU_002G163100g [Phaseolus vulgaris]
Length=334

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  243  LAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKY  422
            +A EAK A +  KP +H  LSICKSLVAGGVAGGVSR+AVAPLERLKILLQVQN  NIKY
Sbjct  1    MASEAKPAGEAAKPRTHEFLSICKSLVAGGVAGGVSRSAVAPLERLKILLQVQNSQNIKY  60

Query  423  NGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNED  602
            NGT QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQA KGILW Y++Q GNE+
Sbjct  61   NGTSQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQALKGILWFYQQQPGNEE  120

Query  603  AQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            AQLTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  121  AQLTPILRLGAGACAGIIAMSATYPMDMVR  150


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L+KG   +   ++P   + F  
Sbjct  145  PMDMVRGRLTVQTEASPRQYRGIYHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFAL  204

Query  543  YEQASKGILWLYREQT--GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL R +     +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  205  YESLKD---WLIRSKPFGMGQDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  253



>ref|NP_001190650.1| adenine nucleotide transporter 1 [Arabidopsis thaliana]
 gb|AEE81982.1| adenine nucleotide transporter 1 [Arabidopsis thaliana]
Length=366

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 152/183 (83%), Gaps = 18/183 (10%)
 Frame = +3

Query  189  MASEEVK-TGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MASE+VK T   AV  IVNLAEEA   R+ +K  S+A  SICKSL AGGVAGGVSRTAVA
Sbjct  1    MASEDVKRTESAAVSTIVNLAEEA---REGVKAPSYAFKSICKSLFAGGVAGGVSRTAVA  57

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKY+GTVQGLK+IW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  58   PLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  117

Query  546  EQASK--------------GILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMD  683
            EQASK              GIL++YR++TGNE+AQLTPLLRLGAGA AGIIAMSATYPMD
Sbjct  118  EQASKSFSNLCFFSFFSHSGILYMYRQRTGNENAQLTPLLRLGAGATAGIIAMSATYPMD  177

Query  684  MVR  692
            MVR
Sbjct  178  MVR  180


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ  ++  +Y G    L  + + EG R L++G   +   +VP   + F  
Sbjct  175  PMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLNFSV  234

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +E      E+ +LT + RL  GA AG +  +  YP+D++R
Sbjct  235  YESLKD---WLVKENPYGLVENNELTVVTRLTCGAIAGTVGQTIAYPLDVIR  283



>emb|CDY11371.1| BnaA09g39370D [Brassica napus]
Length=339

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +3

Query  246  AEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYN  425
            +E+ K      K  S+A++ ICKSL+AGGVAGGVSRTAVAPLERLKILLQVQNPH+IKYN
Sbjct  3    SEDVKRREGVNKAPSNAVIGICKSLIAGGVAGGVSRTAVAPLERLKILLQVQNPHSIKYN  62

Query  426  GTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDA  605
            GTVQGLKYIW+TEGFRGLFKGNG NCARIVPNSAVKFFSYEQASKGIL+LYR+QTGN+DA
Sbjct  63   GTVQGLKYIWRTEGFRGLFKGNGANCARIVPNSAVKFFSYEQASKGILYLYRQQTGNDDA  122

Query  606  QLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  123  QLTPLLRLGAGACAGIIAMSATYPMDMVR  151


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G V  L  + + EG R L++G   +   +VP   + F  
Sbjct  146  PMDMVRGRLTVQTDKSPYQYRGMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAV  205

Query  543  YEQASKGILWLYREQ----TGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +      N  ++LT   RL  GA AG +  +  YP+D+VR
Sbjct  206  YESLKD---WLVKSKPFGIIDNNTSELTVTTRLACGAIAGTMGQTVAYPLDVVR  256



>ref|XP_004511523.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Cicer arietinum]
Length=330

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  279  KPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWK  458
            KP SHA LSICKSLVAGGVAGGVSRTAVAPLERLKILLQVQN HN+KYNGTVQGLKYIWK
Sbjct  9    KPPSHAFLSICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNRHNVKYNGTVQGLKYIWK  68

Query  459  TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAG  638
            TEGFRG+FKGNGTNCARI+PNSAVKFFSYEQASKGIL LYR QTGNE+AQL+PLLRLGAG
Sbjct  69   TEGFRGMFKGNGTNCARIIPNSAVKFFSYEQASKGILNLYRLQTGNEEAQLSPLLRLGAG  128

Query  639  ACAGIIAMSATYPMDMVR  692
            ACAGIIAMSATYPMD+VR
Sbjct  129  ACAGIIAMSATYPMDLVR  146


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L+KG   +   ++P   + F  
Sbjct  141  PMDLVRGRLTVQTEASPRQYRGIFNALSTVFREEGARALYKGWLPSVIGVIPYVGLNFSV  200

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  201  YESLKD---WLIKTKPLGIAKDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  249



>ref|XP_003516718.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Glycine max]
 gb|KHN25655.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=330

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +3

Query  270  DEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKY  449
            D +KP +H LLSICKSLVAGGVAGGVSRTAVAPLERLKILLQVQN  +IKYNGT+QGLKY
Sbjct  5    DGVKPPTHELLSICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNRQDIKYNGTIQGLKY  64

Query  450  IWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRL  629
            IWKTEGFRG+FKGNGTNCARIVPNSAVKFFSYEQAS GILWLY+ Q GNE+AQLTP+LRL
Sbjct  65   IWKTEGFRGMFKGNGTNCARIVPNSAVKFFSYEQASLGILWLYQRQPGNEEAQLTPILRL  124

Query  630  GAGACAGIIAMSATYPMDMVR  692
            GAGACAGIIAMSATYPMDMVR
Sbjct  125  GAGACAGIIAMSATYPMDMVR  145


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  +++ EG R L+KG   +   ++P   + F  
Sbjct  140  PMDMVRGRLTVQTEASPRQYRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSV  199

Query  543  YEQASKGILWLYREQTGN---EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL R +      +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  200  YESLKD---WLIRSKPFGMKAQDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  249



>ref|XP_009116833.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Brassica rapa]
Length=339

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +3

Query  246  AEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYN  425
            +E+ K      K  S+A++ ICKSL+AGGVAGGVSRTAVAPLERLKILLQVQNPH+IKYN
Sbjct  3    SEDVKRREGVNKAPSNAVIGICKSLIAGGVAGGVSRTAVAPLERLKILLQVQNPHSIKYN  62

Query  426  GTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDA  605
            GTVQGLKYIW+TEGFRGLFKGNG NCARIVPNSAVKFFSYEQASKGIL+LYR+QTGN++A
Sbjct  63   GTVQGLKYIWRTEGFRGLFKGNGANCARIVPNSAVKFFSYEQASKGILYLYRQQTGNDEA  122

Query  606  QLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            QLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  123  QLTPLLRLGAGACAGIIAMSATYPMDMVR  151


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 8/114 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G V  L  + + EG R L++G   +   +VP   + F  
Sbjct  146  PMDMVRGRLTVQTDKSPYQYRGMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAV  205

Query  543  YEQASKGILWLYREQ----TGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +      N +++LT   RL  GA AG +  +  YP+D+VR
Sbjct  206  YESLKD---WLVKSKPFGIIDNNNSELTVTTRLACGAIAGTMGQTVAYPLDVVR  256



>gb|AES93971.2| substrate carrier family protein [Medicago truncatula]
Length=346

 Score =   231 bits (590),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  279  KPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWK  458
            KP +HA L+ICKSLVAGGVAGGVSRTAVAPLERLKILLQVQN HN+KYNGTVQGLKYIWK
Sbjct  25   KPPNHAFLTICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNRHNVKYNGTVQGLKYIWK  84

Query  459  TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAG  638
            TEGFRG+FKGNGTNCARI+PNSAVKFFSYEQAS GIL LYR QTGNE+A LTPLLRLGAG
Sbjct  85   TEGFRGMFKGNGTNCARIIPNSAVKFFSYEQASNGILSLYRLQTGNEEAHLTPLLRLGAG  144

Query  639  ACAGIIAMSATYPMDMVR  692
            ACAGIIAMSATYPMD+VR
Sbjct  145  ACAGIIAMSATYPMDLVR  162


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 58/114 (51%), Gaps = 10/114 (9%)
 Frame = +3

Query  366  PLERLKILLQVQ---NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            P++ ++  L VQ   +PH  +Y G    L  +++ EG R L+KG   +   ++P   + F
Sbjct  157  PMDLVRGRLTVQTEASPH--QYRGIFNALSTVFREEGARALYKGWLPSVIGVIPYVGLNF  214

Query  537  FSYEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              YE       WL + +     +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  215  SVYESLKD---WLIQTKPLGIAQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  265



>ref|XP_003538203.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Glycine max]
 gb|KHN35068.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=330

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  264  ARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGL  443
            A D +KP +   LSICKSL+AGGVAGGVSRTAVAPLERLKILLQVQN  +IKYNGT+QGL
Sbjct  3    ADDGVKPPTLEFLSICKSLLAGGVAGGVSRTAVAPLERLKILLQVQNRQDIKYNGTIQGL  62

Query  444  KYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLL  623
            KYIWKTEGFRG+FKGNGTNCARIVPNSAVKFFSYEQAS GILWLY+ Q GNE+AQLTP+L
Sbjct  63   KYIWKTEGFRGMFKGNGTNCARIVPNSAVKFFSYEQASMGILWLYQRQPGNEEAQLTPIL  122

Query  624  RLGAGACAGIIAMSATYPMDMVR  692
            RLGAGACAGIIAMSATYPMDMVR
Sbjct  123  RLGAGACAGIIAMSATYPMDMVR  145


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  +++ EG R L+KG   +   ++P   + F  
Sbjct  140  PMDMVRGRLTVQTEASPCQYRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSV  199

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL R +     +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  200  YESLKD---WLIRSKPFGIAQDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  248



>ref|XP_007040458.1| Adenine nucleotide transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY24959.1| Adenine nucleotide transporter 1 isoform 1 [Theobroma cacao]
Length=368

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 149/182 (82%), Gaps = 14/182 (8%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VK  E AV  IVN+AEEAKLA + +K  S A LSICKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKRSESAVTTIVNIAEEAKLASEGVKAPSRAFLSICKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQ------NPHNIKYNGT--------VQGLKYIWKTEGFRGLFKGNGTNCA  506
            LERLKILLQV        P++++ +          + GLKYIWKTEGFRG+FKGNGTNCA
Sbjct  61   LERLKILLQVVYLSLSFGPYSLRSHFICMLLGYIPILGLKYIWKTEGFRGMFKGNGTNCA  120

Query  507  RIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDM  686
            RI+PNSAVKFFSYE+ASK IL+LYR+ +GNEDAQLTP+LRLGAGACAGIIAMSATYPMDM
Sbjct  121  RIIPNSAVKFFSYEEASKQILYLYRQHSGNEDAQLTPVLRLGAGACAGIIAMSATYPMDM  180

Query  687  VR  692
            VR
Sbjct  181  VR  182


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  177  PMDMVRGRLTVQTEKSPRQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  236

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L  + RL  GA AG +  +  YP+D++R
Sbjct  237  YESLKD---WLIKSKPFGLVEDSELGVMTRLACGAAAGTVGQTVAYPLDVIR  285



>ref|XP_001766394.1| predicted protein [Physcomitrella patens]
 gb|EDQ68722.1| predicted protein [Physcomitrella patens]
Length=365

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +3

Query  222  AVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQV  398
            A   +V LA+EAKLA +E+K P+S+A+LSICKSL+AGGVAGGVSRTAVAPLER+KILLQV
Sbjct  22   AAATLVTLAQEAKLATEEVKVPSSNAILSICKSLIAGGVAGGVSRTAVAPLERMKILLQV  81

Query  399  QNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLY  578
            QNP N KY+GT+QGLK IW +EG RG FKGNGTNCARI+PNSAVKFF+YE+ASK ILW Y
Sbjct  82   QNPFNPKYSGTIQGLKSIWGSEGIRGFFKGNGTNCARIIPNSAVKFFAYEEASKSILWAY  141

Query  579  REQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            R+++G  DA+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  142  RKESGQPDAELTPVLRLGAGACAGIIAMSATYPMDMVR  179


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 54/110 (49%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G     + I + EG R L+KG   +   +VP   + F  
Sbjct  174  PMDMVRGRLTVQTQDSPYRYKGMYHAFRTIIQEEGARALYKGWLPSVIGVVPYVGLNFAV  233

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE     IL     Q  ++ A L  L +LG GA AG +  +  YP+D++R
Sbjct  234  YESLKDWILKHPHWQP-DDGADLAVLTKLGCGAAAGTVGQTVAYPLDVIR  282



>gb|KJB21317.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=310

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 109/109 (100%), Gaps = 0/109 (0%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  16   PLERLKILLQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  75

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL+LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  76   EQASKGILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  124


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  119  PMDMVRGRLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAV  178

Query  543  YEQASKGILWLYR-EQTG-NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +Q G  ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  179  YESLKD---WLIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  227



>ref|XP_003611013.1| Calcium-binding mitochondrial carrier protein SCaMC-1-B [Medicago 
truncatula]
Length=388

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 132/141 (94%), Gaps = 3/141 (2%)
 Frame = +3

Query  279  KPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWK  458
            KP +HA L+ICKSLVAGGVAGGVSRTAVAPLERLKILLQVQN HN+KYNGTVQGLKYIWK
Sbjct  25   KPPNHAFLTICKSLVAGGVAGGVSRTAVAPLERLKILLQVQNRHNVKYNGTVQGLKYIWK  84

Query  459  TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASK---GILWLYREQTGNEDAQLTPLLRL  629
            TEGFRG+FKGNGTNCARI+PNSAVKFFSYEQASK   GIL LYR QTGNE+A LTPLLRL
Sbjct  85   TEGFRGMFKGNGTNCARIIPNSAVKFFSYEQASKYALGILSLYRLQTGNEEAHLTPLLRL  144

Query  630  GAGACAGIIAMSATYPMDMVR  692
            GAGACAGIIAMSATYPMD+VR
Sbjct  145  GAGACAGIIAMSATYPMDLVR  165


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = +3

Query  384  ILLQVQ-NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASK  560
            ++LQ + +PH  +Y G    L  +++ EG R L+KG   +   ++P   + F  YE    
Sbjct  207  LILQTEASPH--QYRGIFNALSTVFREEGARALYKGWLPSVIGVIPYVGLNFSVYESLKD  264

Query  561  GILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
               WL + +     +D++L+   RL  GA AG I  +  YP+D++R
Sbjct  265  ---WLIQTKPLGIAQDSELSVTTRLACGAAAGTIGQTVAYPLDVIR  307



>ref|XP_006590494.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Glycine max]
Length=329

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 1/143 (1%)
 Frame = +3

Query  264  ARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGL  443
            A D +KP +   LSICKSL+AGGVAGGVSRTAVAPLERLKILLQVQN  +IKYNGT+QGL
Sbjct  3    ADDGVKPPTLEFLSICKSLLAGGVAGGVSRTAVAPLERLKILLQVQNRQDIKYNGTIQGL  62

Query  444  KYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLL  623
            KYIWKTEGFRG+FKGNGTNCARIVPNSAVKFFSYEQAS GILWLY+ Q GNE AQLTP+L
Sbjct  63   KYIWKTEGFRGMFKGNGTNCARIVPNSAVKFFSYEQASMGILWLYQRQPGNE-AQLTPIL  121

Query  624  RLGAGACAGIIAMSATYPMDMVR  692
            RLGAGACAGIIAMSATYPMDMVR
Sbjct  122  RLGAGACAGIIAMSATYPMDMVR  144


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  +++ EG R L+KG   +   ++P   + F  
Sbjct  139  PMDMVRGRLTVQTEASPCQYRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSV  198

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL R +     +D++L+   RL  GA AG +  +  YP+D++R
Sbjct  199  YESLKD---WLIRSKPFGIAQDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  247



>ref|XP_001756133.1| predicted protein [Physcomitrella patens]
 gb|EDQ78999.1| predicted protein [Physcomitrella patens]
Length=365

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = +3

Query  222  AVEKIVNLAEEAKLARDEIK-PTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQV  398
            A    V LA+EAK+A +E+K PTS+A+LSICKSL+AGGVAGGVSRTAVAPLER+KILLQV
Sbjct  22   AAATFVTLAQEAKVATEEVKVPTSNAILSICKSLIAGGVAGGVSRTAVAPLERMKILLQV  81

Query  399  QNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLY  578
            QNP N KY+GT+QGLK IW +EG RG FKGNGTNCARI+PNSAVKFF+YE+AS+ ILW Y
Sbjct  82   QNPFNPKYSGTIQGLKSIWGSEGLRGFFKGNGTNCARIIPNSAVKFFAYEEASRSILWAY  141

Query  579  REQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            R+++   DA+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  142  RKESDQPDAELTPVLRLGAGACAGIIAMSATYPMDMVR  179


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ     + Y G     + I   EG R L+KG   +   +VP   + F  
Sbjct  174  PMDMVRGRLTVQTQDGPLHYKGMYHAFRTIIHEEGARALYKGWLPSVIGVVPYVGLNFAV  233

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE     IL  + +   ++ A L  L +LG GA AG +  +  YP+D++R
Sbjct  234  YESLKDWIL-KHPQWQPDDGADLAVLTKLGCGAAAGTVGQTVAYPLDVIR  282



>gb|KJB49522.1| hypothetical protein B456_008G123800 [Gossypium raimondii]
Length=319

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQNPH++KYNGT+QGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  25   PLERLKILLQVQNPHSVKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY  84

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQASKGIL+LY++QTG++DAQLTPLLRLGAGACAGIIAMS TYPMDMVR
Sbjct  85   EQASKGILYLYQQQTGDDDAQLTPLLRLGAGACAGIIAMSTTYPMDMVR  133


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 2/110 (2%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  128  PMDMVRGRLTVQTDSSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAV  187

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE + K  L   +     ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  188  YE-SLKDRLIKSKAFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  236



>gb|KJB21315.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=287

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +3

Query  390  LQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL  569
            +QVQNPH+IKYNGTVQGLKYIW+TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL
Sbjct  1    MQVQNPHSIKYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL  60

Query  570  WLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +LY++QTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR
Sbjct  61   YLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  101


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G    L  + + EG R L+KG   +   ++P   + F  
Sbjct  96   PMDMVRGRLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAV  155

Query  543  YEQASKGILWLYR-EQTG-NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +Q G  ED++L+   RL  GA AG +  +  YP+D++R
Sbjct  156  YESLKD---WLIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIR  204



>gb|KDO76471.1| hypothetical protein CISIN_1g018449mg [Citrus sinensis]
Length=288

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +3

Query  390  LQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL  569
            +QVQNPH+IKYNGT+QGLKYIWK+EGFRGLFKGNGTNCARI+PNSAVKFFSYE+ASKGIL
Sbjct  1    MQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGIL  60

Query  570  WLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            WLYR QT NE+A+LTP+LRLGAGACAGIIAMSATYPMDMVR
Sbjct  61   WLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVR  101



>gb|EMT21891.1| Mitochondrial substrate carrier family protein B [Aegilops tauschii]
Length=283

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  396  VQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWL  575
            VQNPH+IKYNGTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSYEQAS+GIL+L
Sbjct  2    VQNPHSIKYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASRGILYL  61

Query  576  YREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YR+QTG+E+AQL+P+LRLGAGA AGIIAMSATYPMDMVR
Sbjct  62   YRQQTGDENAQLSPILRLGAGATAGIIAMSATYPMDMVR  100


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  + VQ   +  +Y G    L  +++ EGFR L++G   +   +VP   + F  
Sbjct  95   PMDMVRGRITVQTEKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAV  154

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL +    +  +D +L  + RLG GA AG I  +  YP+D+VR
Sbjct  155  YESLKD---WLLQSNAFDLAKDNELHVVTRLGCGAVAGTIGQTVAYPLDVVR  203



>emb|CAN60283.1| hypothetical protein VITISV_011983 [Vitis vinifera]
Length=340

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  189  MASEEVKTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaP  368
            MASE+VKT E AV +IVNLAEEAKLAR+ +   SHALLS+CKSLVAGGVAGGVSRTAVAP
Sbjct  1    MASEDVKTSEAAVSRIVNLAEEAKLAREGVXAPSHALLSVCKSLVAGGVAGGVSRTAVAP  60

Query  369  LERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYE  548
            LERLKILLQVQNPH IKYNGT+QGLKYIWK+EGFRGLFKGNGTNCARIVPNSAVKF+SYE
Sbjct  61   LERLKILLQVQNPHTIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIVPNSAVKFYSYE  120

Query  549  QASK  560
            QAS+
Sbjct  121  QASQ  124


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 45/94 (48%), Gaps = 5/94 (5%)
 Frame = +3

Query  417  KYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGN  596
            +Y G    L  + + EG R L+KG   +   ++P   + F  YE       WL + +   
Sbjct  167  QYRGIFHALSTVLREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKD---WLMKAKPFG  223

Query  597  --EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              ED++L    RL  GA AG +  +  YP+D++R
Sbjct  224  LVEDSELGVTTRLACGAAAGTVGQTVAYPLDVIR  257



>ref|XP_002979197.1| hypothetical protein SELMODRAFT_233298 [Selaginella moellendorffii]
 ref|XP_002992318.1| hypothetical protein SELMODRAFT_186674 [Selaginella moellendorffii]
 gb|EFJ06594.1| hypothetical protein SELMODRAFT_186674 [Selaginella moellendorffii]
 gb|EFJ19605.1| hypothetical protein SELMODRAFT_233298 [Selaginella moellendorffii]
Length=361

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = +3

Query  234  IVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHN  413
            I +L +  KL   ++K  +   LSI KSL+AGGVAGGVSRTAVAPLERLKILLQVQN  N
Sbjct  31   IASLVDNTKL---DVKSPTDVFLSITKSLIAGGVAGGVSRTAVAPLERLKILLQVQNSQN  87

Query  414  IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTG  593
             +Y G  QGL+ IW TEG +G F GNG NCARIVPNSAVKF SYE A+  ILW YR +TG
Sbjct  88   ARYKGMFQGLRTIWNTEGVKGFFIGNGVNCARIVPNSAVKFLSYEHAANAILWAYRRETG  147

Query  594  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            + +A+L P+LRLGAGACAGIIAMSATYPMDM+R
Sbjct  148  DSEAELNPVLRLGAGACAGIIAMSATYPMDMIR  180



>ref|XP_008376077.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Malus domestica]
Length=134

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 1/115 (1%)
 Frame = +3

Query  261  LARDEI-KPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQ  437
            +AR+ + K  + ALLS+CKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPHNIKYNGT+Q
Sbjct  1    MAREGVVKAPNLALLSVCKSLVAGGVAGGVSRTAVAPLERLKILLQVQNPHNIKYNGTIQ  60

Query  438  GLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNED  602
            GLKYIW++EGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYR+QTGN D
Sbjct  61   GLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYRDQTGNGD  115



>emb|CDY66909.1| BnaCnng52820D [Brassica napus]
Length=122

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 4/125 (3%)
 Frame = +3

Query  189  MASEEVKTGE-LAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtava  365
            MA+E+VK  E  AV  IVNLAEEA   R+ +K   +A+LSICKSL AGGVAGGVSRTAVA
Sbjct  1    MATEDVKRSESAAVSTIVNLAEEA---REGVKAPGYAVLSICKSLFAGGVAGGVSRTAVA  57

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KILLQVQNPHNIKYNGTVQGLKYIW+TEG RGLFKGNGTNCARIVPNSAVKFFSY
Sbjct  58   PLERMKILLQVQNPHNIKYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSY  117

Query  546  EQASK  560
            EQASK
Sbjct  118  EQASK  122



>gb|AFV46218.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=305

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLT  614
             GLKYI++TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL+LY++QTG+E+A+LT
Sbjct  34   SGLKYIYRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILFLYQQQTGDENAKLT  93

Query  615  PLLRLGAGACAGIIAMSATYPMDMVR  692
            PLLRLGAGACAGI+AMSATYPMDMVR
Sbjct  94   PLLRLGAGACAGIVAMSATYPMDMVR  119


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   +  +Y G +  L  + + EGFRGL+KG   +   +VP   + F  
Sbjct  114  PMDMVRGRLTVQTDKSPYQYRGMLHALSTVLREEGFRGLYKGWLPSVIGVVPYVGLNFAV  173

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED +L    RL  GA AG +  +  YP+D++R
Sbjct  174  YESLKD---WLIKSKALGLVEDNELGVATRLMCGAAAGTVGQTVAYPLDVIR  222



>gb|KJB24253.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=258

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +3

Query  477  LFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGII  656
            +FKGNGTNCARI+PNSAVKFFSYE+ASKGIL+LYR+Q+GNEDAQLTPLLRLGAGACAGII
Sbjct  1    MFKGNGTNCARIIPNSAVKFFSYEEASKGILYLYRQQSGNEDAQLTPLLRLGAGACAGII  60

Query  657  AMSATYPMDMVR  692
            AMSATYPMDMVR
Sbjct  61   AMSATYPMDMVR  72


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 56/114 (49%), Gaps = 10/114 (9%)
 Frame = +3

Query  366  PLERLKILLQVQ---NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKF  536
            P++ ++  L VQ   +PH  +Y G    L  + + EG R L+KG   +   +VP   + F
Sbjct  67   PMDMVRGRLTVQTEKSPH--QYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNF  124

Query  537  FSYEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              YE       WL + +     ED++L    RL  GA AG I  +  YP+D++R
Sbjct  125  AVYESLKD---WLIKRKPLGLVEDSELGVTTRLACGAAAGTIGQTVAYPLDVIR  175



>ref|XP_007040459.1| Adenine nucleotide transporter 1 isoform 2 [Theobroma cacao]
 gb|EOY24960.1| Adenine nucleotide transporter 1 isoform 2 [Theobroma cacao]
Length=258

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  477  LFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGII  656
            +FKGNGTNCARI+PNSAVKFFSYE+ASK IL+LYR+ +GNEDAQLTP+LRLGAGACAGII
Sbjct  1    MFKGNGTNCARIIPNSAVKFFSYEEASKQILYLYRQHSGNEDAQLTPVLRLGAGACAGII  60

Query  657  AMSATYPMDMVR  692
            AMSATYPMDMVR
Sbjct  61   AMSATYPMDMVR  72


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            P++ ++  L VQ   + + Y G    L  + + EG R L+KG   +   +VP   + F  
Sbjct  67   PMDMVRGRLTVQTEKSPRQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAV  126

Query  543  YEQASKGILWLYREQTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE       WL + +     ED++L  + RL  GA AG +  +  YP+D++R
Sbjct  127  YESLKD---WLIKSKPFGLVEDSELGVMTRLACGAAAGTVGQTVAYPLDVIR  175



>ref|XP_002957829.1| mitochondrial substrate carrier [Volvox carteri f. nagariensis]
 gb|EFJ41066.1| mitochondrial substrate carrier [Volvox carteri f. nagariensis]
Length=316

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 105/136 (77%), Gaps = 3/136 (2%)
 Frame = +3

Query  285  TSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTE  464
            T  +  S+CKSLVAGGVAGG+SRTAVAPLERLKIL+QVQ    I Y G  QGL ++ +TE
Sbjct  4    TRPSFASLCKSLVAGGVAGGLSRTAVAPLERLKILMQVQGNEKI-YRGVWQGLVHMARTE  62

Query  465  GFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGAC  644
            G RG+ KGN TNC RI+PNSAVKF +YEQ S+ +   YR  TG+   +LTP LRL AGAC
Sbjct  63   GVRGMMKGNWTNCVRIIPNSAVKFLTYEQLSREMSDHYRSTTGS--GELTPTLRLLAGAC  120

Query  645  AGIIAMSATYPMDMVR  692
            AGIIAMSATYP+DMVR
Sbjct  121  AGIIAMSATYPLDMVR  136


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 63/141 (45%), Gaps = 13/141 (9%)
 Frame = +3

Query  273  EIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYI  452
            E+ PT   L   C  ++A             PL+ ++  L VQ   N +Y G V   + I
Sbjct  108  ELTPTLRLLAGACAGIIAMSATY--------PLDMVRGRLTVQEGRNQQYRGIVHATRMI  159

Query  453  WKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDA-QLTPLLRL  629
               EG   L++G   +   +VP   + F  YE    G++    +Q G  D  +L+ + RL
Sbjct  160  VSQEGPLALYRGWLPSVIGVVPYVGLNFAVYETLKAGLM----KQYGMRDERELSIVTRL  215

Query  630  GAGACAGIIAMSATYPMDMVR  692
            G GA AG +  +  YP D+ R
Sbjct  216  GCGAMAGSMGQTVAYPFDVAR  236



>ref|XP_001693350.1| mitochondrial carrier protein [Chlamydomonas reinhardtii]
 gb|EDP03376.1| mitochondrial carrier protein [Chlamydomonas reinhardtii]
Length=345

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 109/154 (71%), Gaps = 6/154 (4%)
 Frame = +3

Query  240  NLAEEAKLA---RDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPH  410
            N AEE + A   +  +  T      ICKSL AGGVAGG+SRTAVAPLERLKIL+QVQ   
Sbjct  15   NRAEEPRQAPPTQAVVTSTRPTFSQICKSLFAGGVAGGLSRTAVAPLERLKILMQVQGNE  74

Query  411  NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQT  590
             I Y G  QGL ++ +TEG RG+ KGN TNC RI+PNSAVKF +YEQ S+ +   YR  T
Sbjct  75   QI-YRGVWQGLVHMARTEGVRGMMKGNWTNCVRIIPNSAVKFLTYEQLSREMSDHYRATT  133

Query  591  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            G+   +LTP  RL AGACAGIIAMSATYP+DMVR
Sbjct  134  GS--GELTPGTRLLAGACAGIIAMSATYPLDMVR  165


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 61/147 (41%), Gaps = 13/147 (9%)
 Frame = +3

Query  255  AKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTV  434
            A     E+ P +  L   C  ++A             PL+ ++  L VQ   N +Y G V
Sbjct  131  ATTGSGELTPGTRLLAGACAGIIAMSATY--------PLDMVRGRLTVQEGKNQQYRGIV  182

Query  435  QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDA-QL  611
               + I   EG    +KG   +   +VP   + F  YE     +L    +Q G  D  +L
Sbjct  183  HAARTILAQEGPLAFYKGWLPSVIGVVPYVGLNFAVYETLKAMLL----KQYGLRDEREL  238

Query  612  TPLLRLGAGACAGIIAMSATYPMDMVR  692
            T   RLG GA AG +  +  YP D+ R
Sbjct  239  TIGARLGCGAIAGSMGQTVAYPFDVAR  265



>ref|XP_005849239.1| hypothetical protein CHLNCDRAFT_34838 [Chlorella variabilis]
 gb|EFN57137.1| hypothetical protein CHLNCDRAFT_34838 [Chlorella variabilis]
Length=320

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 95/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  306  ICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFK  485
            I KSL AGGVAG VSRTAVAPLERLKIL+QVQ    + Y G  QG  ++++ +G RG+FK
Sbjct  15   ITKSLCAGGVAGAVSRTAVAPLERLKILMQVQGNEKM-YTGVWQGTSHMFRNDGIRGMFK  73

Query  486  GNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMS  665
            GNG NC RIVPN A+KF +YEQ S+ I     +  G  D QLTPLLRL AGA AG++ MS
Sbjct  74   GNGLNCIRIVPNQAIKFLTYEQLSRKISHHLIDNGG--DGQLTPLLRLSAGAAAGVVGMS  131

Query  666  ATYPMDMVR  692
            ATYP+DMVR
Sbjct  132  ATYPLDMVR  140


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 52/111 (47%), Gaps = 7/111 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PL+ ++  + VQ   N +Y G       I + EG   L++G   +   +VP   + F  Y
Sbjct  135  PLDMVRGRITVQEAGNPQYRGLWHATGCIIREEGLLALWRGWLPSVIGVVPYVGLNFGVY  194

Query  546  EQASKGIL--WLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E     I+  W  R++       L+  +RLG GA AG +  +  YP D+VR
Sbjct  195  ETLKDVIIKTWGLRDER-----DLSIAVRLGCGALAGTMGQTLAYPFDVVR  240



>emb|CEF97253.1| Mitochondrial substrate/solute carrier [Ostreococcus tauri]
Length=323

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 103/131 (79%), Gaps = 4/131 (3%)
 Frame = +3

Query  300  LSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGL  479
            ++I  SL+AGGVAGGVSRTAVAPLERLKIL QV +  N  YNG V G+ ++WKTEG RGL
Sbjct  22   MAIATSLLAGGVAGGVSRTAVAPLERLKILQQVSS--NGAYNGVVSGMAHMWKTEGMRGL  79

Query  480  FKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIA  659
            FKGNG NC RIVPNSAVKFF YE  + G+L L R  T +++A++  L RLG GA AGI+A
Sbjct  80   FKGNGANCVRIVPNSAVKFFCYEHMAHGLLELRR--TFDQNAEMDVLTRLGGGAGAGIVA  137

Query  660  MSATYPMDMVR  692
            MSATYP+DM+R
Sbjct  138  MSATYPLDMIR  148



>ref|XP_002500487.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61745.1| predicted protein, partial [Micromonas sp. RCC299]
Length=303

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 93/127 (73%), Gaps = 2/127 (2%)
 Frame = +3

Query  312  KSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGN  491
            KSLVAGGVAGGVSRTAVAPLERLKIL QV       YNG ++GL +I +TEG  G+FKGN
Sbjct  1    KSLVAGGVAGGVSRTAVAPLERLKILQQVAGSTTTAYNGVLRGLTHIMRTEGMVGMFKGN  60

Query  492  GTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSAT  671
            G NC RIVPNSA KF +YE     +L   RE   + +AQL PL RL AGA AGI AMSAT
Sbjct  61   GANCIRIVPNSASKFLAYETLESWLLSRARES--DPNAQLGPLTRLTAGAGAGIFAMSAT  118

Query  672  YPMDMVR  692
            YP+DMVR
Sbjct  119  YPLDMVR  125



>ref|XP_003055917.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH59293.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=393

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +3

Query  303  SICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLF  482
            S+CKSL+AGGVAGGVSRTAVAPLERLKIL QV       Y G + GL +I +TEG  G+F
Sbjct  81   SVCKSLLAGGVAGGVSRTAVAPLERLKILQQVAGSTTKSYKGVLGGLSHILRTEGVLGMF  140

Query  483  KGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAM  662
            KGNG NC RIVPNSA KF +YE   +G L + R +  +E+AQL P+ RL AGA AG+ AM
Sbjct  141  KGNGANCVRIVPNSASKFLAYEFL-EGFL-VKRARESDENAQLGPVTRLIAGAGAGVFAM  198

Query  663  SATYPMDMVR  692
            SATYP+DMVR
Sbjct  199  SATYPLDMVR  208



>ref|XP_001416737.1| MC family transporter: aspartate/glutamate (Ca2+-activated) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO95030.1| MC family transporter: aspartate/glutamate (Ca2+-activated) [Ostreococcus 
lucimarinus CCE9901]
Length=340

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = +3

Query  303  SICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLF  482
            +I +SL+AGGVAGGVSRTAVAPLERLKIL QV +     YNG   GL ++WKTEG +GLF
Sbjct  31   AIARSLIAGGVAGGVSRTAVAPLERLKILQQVSSSS--AYNGVYSGLSHMWKTEGVKGLF  88

Query  483  KGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAM  662
            KGNG NC RIVPNSAVKFF YE  + G+L L R  T ++DA++  L RLG GA AGI+AM
Sbjct  89   KGNGANCVRIVPNSAVKFFCYEHMAHGLLDLRR--TFDKDAEMDVLTRLGGGAGAGIVAM  146

Query  663  SATYPMDMVR  692
            SATYP+DM+R
Sbjct  147  SATYPLDMIR  156



>ref|XP_005643443.1| mitochondrial carrier protein [Coccomyxa subellipsoidea C-169]
 gb|EIE18899.1| mitochondrial carrier protein [Coccomyxa subellipsoidea C-169]
Length=326

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 99/130 (76%), Gaps = 3/130 (2%)
 Frame = +3

Query  303  SICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLF  482
            SI KSLVAGGVAGGVSRTAVAPLERLKIL+QVQ  + + Y G  QGLK + K EG RG+F
Sbjct  22   SIVKSLVAGGVAGGVSRTAVAPLERLKILMQVQGSNKV-YTGVWQGLKLMSKNEGIRGMF  80

Query  483  KGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAM  662
            +GN TNC RI+PNSAVKF +YEQ  + I     E  G  D Q+TPLLRL AGA AGI+ M
Sbjct  81   RGNWTNCVRIIPNSAVKFLTYEQLCRRISHHLIENGG--DGQMTPLLRLAAGAGAGIVGM  138

Query  663  SATYPMDMVR  692
            SATYP+DMVR
Sbjct  139  SATYPLDMVR  148



>ref|XP_011399125.1| Calcium-binding mitochondrial carrier protein SCaMC-2-A [Auxenochlorella 
protothecoides]
 gb|KFM26229.1| Calcium-binding mitochondrial carrier protein SCaMC-2-A [Auxenochlorella 
protothecoides]
Length=320

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 97/129 (75%), Gaps = 3/129 (2%)
 Frame = +3

Query  306  ICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFK  485
            + KSL AGG+AG VSRT+VAPLERLKIL+QVQ    + Y G  QG++++W ++G RGLFK
Sbjct  15   LTKSLCAGGIAGAVSRTSVAPLERLKILMQVQGTEKV-YTGIFQGVRHMWVSDGIRGLFK  73

Query  486  GNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMS  665
            GNG NC RI+PN A+KF +YEQ S+ I     ++ G  D QLTP LRL AGA AGI+ MS
Sbjct  74   GNGLNCIRIIPNQAIKFMTYEQLSRKISHALIDRGG--DGQLTPGLRLAAGAGAGIVGMS  131

Query  666  ATYPMDMVR  692
            ATYP+DM+R
Sbjct  132  ATYPLDMIR  140



>ref|XP_003078331.1| putative carrier protein (ISS) [Ostreococcus tauri]
Length=424

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +3

Query  411  NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQT  590
            N  YNG V G+ ++WKTEG RGLFKGNG NC RIVPNSAVKFF YE  + G+L L R  T
Sbjct  60   NGAYNGVVSGMAHMWKTEGMRGLFKGNGANCVRIVPNSAVKFFCYEHMAHGLLELRR--T  117

Query  591  GNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
             +++A++  L RLG GA AGI+AMSATYP+DM+R
Sbjct  118  FDQNAEMDVLTRLGGGAGAGIVAMSATYPLDMIR  151



>gb|KDD76091.1| hypothetical protein H632_c360p1 [Helicosporidium sp. ATCC 50920]
Length=264

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  441  LKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPL  620
            ++++W++EG RGLF GNG NC RI+PNSA+KFF+YEQ S+ I     +  G  D  LTPL
Sbjct  1    MRHMWRSEGLRGLFVGNGLNCMRIIPNSAIKFFTYEQLSRKIGHYLIDHHGG-DGTLTPL  59

Query  621  LRLGAGACAGIIAMSATYPMDMVR  692
             RL AGA AGIIAMS TYP+DMVR
Sbjct  60   QRLTAGAGAGIIAMSTTYPLDMVR  83



>emb|CCX16202.1| Similar to Uncharacterized mitochondrial carrier YPR011C; acc. 
no. Q12251 [Pyronema omphalodes CBS 100304]
Length=341

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 8/109 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKI+ QVQ P N  YNG    L  +WK EG+RGL +GNGTNC RIVP SAV+F SY
Sbjct  67   PLERLKIIFQVQGPGNASYNGVGPALLKMWKEEGWRGLMRGNGTNCIRIVPYSAVQFSSY  126

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
                     +Y++    E  ++    RL +GA AG+ ++ ATYP+D+VR
Sbjct  127  T--------VYKKWLTPESGEMDTYRRLLSGAMAGVTSVVATYPLDIVR  167



>gb|KIM23813.1| hypothetical protein M408DRAFT_76951 [Serendipita vermifera MAFF 
305830]
Length=349

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN--IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            PLERLKI+ QVQ        YNG    L  +WK EGFRG  +GNG NC RIVP SAV+F 
Sbjct  41   PLERLKIIQQVQGASGGGATYNGVWNSLVRMWKEEGFRGYMRGNGVNCLRIVPYSAVQFT  100

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +YE   + +++        +  +L P  R GAGA AGI+A+++TYP+D+VR
Sbjct  101  TYEFMKRVVVF--------QGFELNPFFRFGAGAIAGIVAVTSTYPLDIVR  143



>gb|KIM32048.1| hypothetical protein M408DRAFT_63862 [Serendipita vermifera MAFF 
305830]
Length=349

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN--IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            PLERLKI+ QVQ        YNG    L  +WK EGFRG  +GNG NC RIVP SAV+F 
Sbjct  41   PLERLKIIQQVQGASGGGATYNGVWNSLVRMWKEEGFRGYMRGNGVNCLRIVPYSAVQFT  100

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +YE   + +++        +  +L P  R GAGA AGI+A+++TYP+D+VR
Sbjct  101  TYEFMKRVVVF--------QGFELNPFFRFGAGAIAGIVAVTSTYPLDIVR  143



>gb|EJT97303.1| mitochondrial carrier, partial [Dacryopinax sp. DJM-731 SS1]
Length=298

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 70/115 (61%), Gaps = 11/115 (10%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN----IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVK  533
            PLERLKIL QVQ PH     + Y G   GL  +W+ EGF+G  +GNG NC RIVP SAV+
Sbjct  22   PLERLKILQQVQ-PHQSGRALAYTGVWSGLVKMWQEEGFKGFMRGNGVNCVRIVPYSAVQ  80

Query  534  FFSYEQ--ASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            F SYEQ   +   LW     T N   +L    RL AGA AGI ++  TYP+D+VR
Sbjct  81   FTSYEQLKTASSRLWF----TNNGQTKLDTPTRLCAGALAGITSVVTTYPLDLVR  131



>gb|EPS99909.1| hypothetical protein FOMPIDRAFT_1041944 [Fomitopsis pinicola 
FP-58527 SS1]
Length=352

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPH-NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ+P    +Y G    L  +WK EGFRG  +GNG NC RI+P SAV+F +
Sbjct  55   PLERLKIIQQVQSPTAEGQYKGVWASLVRMWKEEGFRGYLRGNGINCIRIIPYSAVQFTT  114

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K   W     T N +  L   +RL AGA AGI ++ +TYP+D+VR
Sbjct  115  YEQLKK---WF----TNNGERPLDTPIRLSAGALAGIASVCSTYPLDLVR  157



>ref|XP_008034413.1| mitochondrial carrier [Trametes versicolor FP-101664 SS1]
 gb|EIW63075.1| mitochondrial carrier [Trametes versicolor FP-101664 SS1]
Length=321

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 69/111 (62%), Gaps = 6/111 (5%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ P + K Y G    L  +W+ EGFRG  +GNG NC RI+P SAV+F +
Sbjct  38   PLERLKIIQQVQPPSSDKQYKGVWSSLVRMWREEGFRGFMRGNGVNCMRIIPYSAVQFTT  97

Query  543  YEQASKGIL-WLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K +L W     TG     L    RL AGA AGI ++  TYP+D+VR
Sbjct  98   YEQLKKVLLQWF----TGYGATPLDTPTRLCAGALAGITSVCITYPLDLVR  144



>gb|EFQ34060.1| hypothetical protein GLRG_09204 [Colletotrichum graminicola M1.001]
Length=339

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL Q+Q+     Y  +V QGL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  56   PLERLKILFQIQSVGRDAYKLSVGQGLAKMWREEGWRGFMRGNGTNCVRIVPYSAVQFGS  115

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I     E T N D  L+P+ RL  G  AGI ++  TYP+D+VR
Sbjct  116  YNFYKRSIF----ESTPNAD--LSPIARLTCGGMAGITSVFFTYPLDIVR  159



>ref|XP_007864537.1| mitochondrial carrier [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ57439.1| mitochondrial carrier [Gloeophyllum trabeum ATCC 11539]
Length=347

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ  ++ K Y G  + L  +WK EGFRG  +GNG NC RIVP SAV+F +
Sbjct  56   PLERLKIIQQVQAQNSDKQYKGVWRSLVRMWKEEGFRGFMRGNGINCLRIVPYSAVQFTT  115

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K         T N  A L    RL AGA AGI ++ ATYP+D+VR
Sbjct  116  YEQIKKFF-------TRNGTATLDTPKRLTAGALAGITSVCATYPLDLVR  158



>gb|KDN61012.1| hypothetical protein CSUB01_01149 [Colletotrichum sublineola]
Length=339

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL Q+Q+     Y  +V QGL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  56   PLERLKILFQIQSVGRDAYKLSVGQGLAKMWREEGWRGFMRGNGTNCVRIVPYSAVQFGS  115

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I     E T N D  L+P+ RL  G  AGI ++  TYP+D+VR
Sbjct  116  YNFYKRSIF----ESTPNAD--LSPIARLTCGGMAGITSVFFTYPLDIVR  159



>ref|XP_007309764.1| mitochondrial carrier [Stereum hirsutum FP-91666 SS1]
 gb|EIM81084.1| mitochondrial carrier [Stereum hirsutum FP-91666 SS1]
Length=369

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ+  + K Y G  + L  IW  EGF+G  +GNG NC RI+P SAV+F +
Sbjct  51   PLERLKIIQQVQSTSSDKQYKGVFRSLVRIWNEEGFKGYMRGNGINCVRIIPYSAVQFTT  110

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K         TGN   QL    RL +GA AGI ++  TYP+D++R
Sbjct  111  YEQLKKFF-------TGNGTKQLDTPTRLVSGALAGITSVCTTYPLDLIR  153



>ref|XP_007361771.1| mitochondrial carrier [Dichomitus squalens LYAD-421 SS1]
 gb|EJF65135.1| mitochondrial carrier [Dichomitus squalens LYAD-421 SS1]
Length=343

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ P + + Y G    L  +W+ EGF+G  +GNG NC RI+P SAV+F +
Sbjct  41   PLERLKIIQQVQPPSSDRQYKGVWNSLVRMWREEGFKGFMRGNGINCLRIIPYSAVQFTT  100

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K   W     TG  + QL    RL AGA AGI ++  TYP+D+VR
Sbjct  101  YEQLKK---WF----TGYGNKQLDTPKRLCAGALAGITSVCTTYPLDLVR  143



>gb|EME42258.1| hypothetical protein DOTSEDRAFT_73171 [Dothistroma septosporum 
NZE10]
Length=341

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ   + +Y  ++ + L  IW+ EGFRG+  GNG NC RIVP SAV+F S
Sbjct  52   PLERLKILLQVQAKGHTEYKMSIPKALAKIWREEGFRGMMAGNGVNCIRIVPYSAVQFGS  111

Query  543  YEQASKGILWLYREQTGNEDAQ-LTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y         LY+     E  + LTPL RL  GA AGI +++ TYP+D+VR
Sbjct  112  YN--------LYKPYFEPEPGEPLTPLRRLCCGAVAGITSVTVTYPLDIVR  154



>ref|XP_011405585.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Amphimedon queenslandica]
Length=334

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 70/109 (64%), Gaps = 7/109 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKIL QV    N K+ G    L+ IW+ EG RG +KGNGTN  RIVP  AV+F +Y
Sbjct  50   PLERLKILYQVHTT-NRKFQGVTSSLRTIWREEGIRGYYKGNGTNVIRIVPYVAVQFAAY  108

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E+  K +      +  ++  + +P  RL AGA AGI +++ATYP+D+VR
Sbjct  109  EEFKKLL------KVSSDAREQSPFKRLLAGALAGITSVTATYPLDLVR  151



>gb|KDQ57586.1| hypothetical protein JAAARDRAFT_35278 [Jaapia argillacea MUCL 
33604]
Length=350

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPH-NIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ+P  + +Y G  + L  +W+ EG+RG  +GNG NC RIVP SAV+F +
Sbjct  53   PLERLKIIQQVQSPSSDNQYRGVWRSLVRMWREEGWRGFMRGNGINCLRIVPYSAVQFTT  112

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K         TGN    L    RL +GA AGI ++ +TYP+D+VR
Sbjct  113  YEQLKKFF-------TGNGTKTLDTPTRLLSGALAGITSVCSTYPLDLVR  155



>gb|EQB48539.1| hypothetical protein CGLO_12225 [Colletotrichum gloeosporioides 
Cg-14]
Length=336

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL QVQ+     Y  +V QGL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  53   PLERLKILFQVQSVGRDAYKLSVGQGLAKMWREEGWRGFMRGNGTNCVRIVPYSAVQFGS  112

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    +     + +Q G   A L+PL RL  G  AGI ++  TYP+D+VR
Sbjct  113  YNFYKRN---FFEKQPG---ADLSPLARLTCGGIAGITSVFFTYPLDIVR  156



>ref|XP_007284603.1| mitochondrial carrier [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA26374.1| mitochondrial carrier [Colletotrichum gloeosporioides Nara gc5]
Length=336

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL QVQ+     Y  +V QGL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  53   PLERLKILFQVQSVGRDAYKLSVGQGLAKMWREEGWRGFMRGNGTNCVRIVPYSAVQFGS  112

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    +     + +Q G   A L+PL RL  G  AGI ++  TYP+D+VR
Sbjct  113  YNFYKRN---FFEKQPG---ADLSPLARLTCGGIAGITSVFFTYPLDIVR  156



>gb|EZF22229.1| hypothetical protein H100_04887 [Trichophyton rubrum MR850]
 gb|EZF41308.1| hypothetical protein H102_04872 [Trichophyton rubrum CBS 100081]
 gb|EZF51934.1| hypothetical protein H103_04877 [Trichophyton rubrum CBS 288.86]
 gb|EZF62519.1| hypothetical protein H104_04868 [Trichophyton rubrum CBS 289.86]
 gb|EZF73126.1| hypothetical protein H105_04893 [Trichophyton soudanense CBS 
452.61]
 gb|EZF83812.1| hypothetical protein H110_04874 [Trichophyton rubrum MR1448]
 gb|EZG16093.1| hypothetical protein H107_05004 [Trichophyton rubrum CBS 202.88]
Length=277

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSISKGLAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176



>ref|XP_007511830.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17951.1| predicted protein [Bathycoccus prasinos]
Length=415

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +3

Query  279  KPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQNPHNIKYNGTVQGLKYIWK  458
            +P  H   SI KSL AGG+AGGVSRTAVAPLERLKIL QV      +Y    +GL  I +
Sbjct  101  EPKVHTWTSIAKSLFAGGIAGGVSRTAVAPLERLKILQQVHGRTATEYGTVYRGLNTILR  160

Query  459  TEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAG  638
             +G RG F GNG NC RIVPNSAVKFF YE+ +  I    R  T + + ++    RL  G
Sbjct  161  KDGLRGFFIGNGANCIRIVPNSAVKFFCYERITDAIFQFRR--TLDPECEMNVFNRLAGG  218

Query  639  ACAGIIAMSATYPMDMVR  692
            A AGIIAM++ YP+DMVR
Sbjct  219  AGAGIIAMTSVYPLDMVR  236



>ref|XP_003851503.1| hypothetical protein MYCGRDRAFT_100510 [Zymoseptoria tritici 
IPO323]
 gb|EGP86479.1| hypothetical protein MYCGRDRAFT_100510 [Zymoseptoria tritici 
IPO323]
Length=329

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ + L  IWK EGF+G+  GNGTNC RIVP SAV+F S
Sbjct  44   PLERLKILLQVQSNGRTEYKMSIPKALGKIWKEEGFKGMMAGNGTNCIRIVPYSAVQFGS  103

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y          Y E    E   LTP+ RL  GA AGI +++ TYP+D+VR
Sbjct  104  YNLYKP-----YFEPAPGEP--LTPVRRLCCGAVAGITSVTVTYPLDIVR  146



>gb|KEZ40628.1| hypothetical protein SAPIO_CDS8549 [Scedosporium apiospermum]
Length=333

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL QVQ+     Y  +V Q L  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  51   PLERLKILFQVQSAGRDAYKLSVGQALGKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  110

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y         +LTPLLRL  G  AGI ++  TYP+D+VR
Sbjct  111  YNFYKRTIFEPY------AGGELTPLLRLTCGGLAGITSVIFTYPLDIVR  154



>ref|XP_002837709.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81900.1| unnamed protein product [Tuber melanosporum]
Length=322

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 7/109 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKI+ QVQ P N  Y G    L  +W+ EG+RG  +GNGTNC RIVP SAV+F SY
Sbjct  45   PLERLKIIFQVQGPGNSSYRGVGPALVKMWREEGWRGYMRGNGTNCIRIVPYSAVQFSSY  104

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
                + +L       G  D  L  L RL AGA AG+ ++ ATYP+D+ R
Sbjct  105  TIYKRLLL-----PEGGTD--LGTLRRLCAGAMAGVTSVVATYPLDITR  146


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 17/118 (14%)
 Frame = +3

Query  366  PLERLKILLQVQN--------PHNIKYNGTVQGLKYIWKTEGFR-GLFKGNGTNCARIVP  518
            PL+  +  L VQ+        PH  K  G    +K +++TEG    L++G G   A + P
Sbjct  141  PLDITRTRLSVQSASFSSKGVPHT-KLPGMWATMKTMYRTEGGTISLYRGLGPTLAGVAP  199

Query  519  NSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
               + F +YE   K +       T   +A  T L +L AGA +G +A S TYP D++R
Sbjct  200  YVGINFATYEAMRKFM-------TPEGEANPTALGKLCAGAVSGAVAQSVTYPFDVLR  250



>gb|KIZ03643.1| putative calcium-binding carrier [Monoraphidium neglectum]
Length=304

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = +3

Query  435  QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLT  614
            +GL ++ +TEG RG+ KGN TNC RI+PNSA+KFF++EQ  + I     E TG+    LT
Sbjct  41   EGLVHMARTEGMRGMMKGNWTNCVRIIPNSAMKFFTFEQLCRLISDRQLEATGS--GALT  98

Query  615  PLLRLGAGACAGIIAMSATYPMDMVR  692
            P LRL AGA AGI+AMSATYP+DMVR
Sbjct  99   PGLRLMAGAGAGIVAMSATYPLDMVR  124


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 52/109 (48%), Gaps = 3/109 (3%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PL+ ++  L VQ   N++Y G V   + I K EG    ++G   +   ++P   + F  Y
Sbjct  119  PLDMVRGRLTVQEGRNVQYTGIVHAARTILKEEGALAFYRGWLPSVIGVIPYVGLNFGVY  178

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E     +L  Y  +   ++ +L+   RLG GA AG    +  YP D+ R
Sbjct  179  ETLKASLLTHYGLR---DERELSVAARLGCGALAGTTGQTVAYPFDVAR  224



>gb|EZF33664.1| hypothetical protein H101_02759 [Trichophyton interdigitale H6]
 gb|KDB24684.1| hypothetical protein H109_03468 [Trichophyton interdigitale MR816]
Length=349

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSISKGLAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176



>gb|EGE08862.1| mitochondrial carrier protein [Trichophyton equinum CBS 127.97]
Length=349

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSISKGLAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176



>gb|EMD37486.1| hypothetical protein CERSUDRAFT_114129 [Ceriporiopsis subvermispora 
B]
Length=370

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ   + K Y G    L  +W+ EGF+G  +GNG NC RIVP SAV+F +
Sbjct  67   PLERLKIIQQVQPQSSDKQYKGVWSSLVRMWREEGFKGFMRGNGINCLRIVPYSAVQFTT  126

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  +   WL    T N   +L    RL AGA AGI ++ ATYP+D+VR
Sbjct  127  YEQLKR---WL----TNNGARKLDTPTRLCAGAIAGITSVCATYPLDLVR  169



>gb|EFA80605.1| transmembrane protein [Polysphondylium pallidum PN500]
Length=323

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 11/111 (10%)
 Frame = +3

Query  366  PLERLKILLQVQN--PHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            PLERLKIL QVQ    +  KYN    G+K IW+ EGF GLF+GNG N  +  P SA++FF
Sbjct  28   PLERLKILNQVQPLLENGTKYNSIGSGIKTIWQEEGFIGLFRGNGVNVLKAGPQSAIRFF  87

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            SYE A K I+        +ED +LT   ++ AGACAG+ +++ATYP+++V+
Sbjct  88   SYE-AFKNII--------SEDKKLTTTQQMWAGACAGVTSVTATYPLEVVK  129



>gb|EGD98731.1| mitochondrial carrier protein [Trichophyton tonsurans CBS 112818]
Length=349

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSISKGLAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176



>ref|XP_003022834.1| hypothetical protein TRV_03058 [Trichophyton verrucosum HKI 0517]
 gb|EFE42216.1| hypothetical protein TRV_03058 [Trichophyton verrucosum HKI 0517]
Length=364

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSISKGLAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176



>ref|XP_003011121.1| hypothetical protein ARB_02643 [Arthroderma benhamiae CBS 112371]
 gb|EFE30481.1| hypothetical protein ARB_02643 [Arthroderma benhamiae CBS 112371]
Length=349

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSISKGLAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 16/153 (10%)
 Frame = +3

Query  261  LARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQ--------NPHNI  416
            L +   +PT    L+  + L  GG+AG  S T   PL+ ++  L +Q        N H  
Sbjct  136  LYKKAFEPTPGGELTPLRRLTCGGLAGITSVTFTYPLDIVRTRLSIQSASFAELKNQHQT  195

Query  417  KYNGTVQGLKYIWKTEG-FRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTG  593
            K  G  + ++ ++K EG    L++G     A + P   + F +YE   K +       T 
Sbjct  196  KLPGMYETMRLMYKNEGGIVALYRGILPTVAGVAPYVGLNFMTYESIRKVL-------TP  248

Query  594  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              DA  + L +L AGA +G +A + TYP D++R
Sbjct  249  EGDANPSALRKLLAGAISGAVAQTCTYPFDVLR  281



>ref|XP_003235588.1| mitochondrial carrier protein [Trichophyton rubrum CBS 118892]
 gb|EGD88393.1| hypothetical protein TERG_04644 [Trichophyton rubrum CBS 118892]
 gb|EZF22228.1| hypothetical protein H100_04887 [Trichophyton rubrum MR850]
 gb|EZF41307.1| hypothetical protein H102_04872 [Trichophyton rubrum CBS 100081]
 gb|EZF51933.1| hypothetical protein H103_04877 [Trichophyton rubrum CBS 288.86]
 gb|EZF62518.1| hypothetical protein H104_04868 [Trichophyton rubrum CBS 289.86]
 gb|EZF73125.1| hypothetical protein H105_04893 [Trichophyton soudanense CBS 
452.61]
 gb|EZF83811.1| hypothetical protein H110_04874 [Trichophyton rubrum MR1448]
 gb|EZF94514.1| hypothetical protein H113_04916 [Trichophyton rubrum MR1459]
 gb|EZG00729.1| hypothetical protein H106_08934 [Trichophyton rubrum CBS 735.88]
 gb|EZG16092.1| hypothetical protein H107_05004 [Trichophyton rubrum CBS 202.88]
Length=349

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSISKGLAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 16/153 (10%)
 Frame = +3

Query  261  LARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQ--------NPHNI  416
            L +   +PT    L+  + L  GG+AG  S T   PL+ ++  L +Q        N H  
Sbjct  136  LYKKAFEPTPGGELTPLRRLTCGGLAGITSVTFTYPLDIVRTRLSIQSASFAELKNQHQT  195

Query  417  KYNGTVQGLKYIWKTEG-FRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTG  593
            K  G  + ++ ++K EG    L++G     A + P   + F +YE   K +       T 
Sbjct  196  KLPGMYETMRLMYKNEGGIVALYRGILPTVAGVAPYVGLNFMTYESIRKVL-------TP  248

Query  594  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
              DA  + L +L AGA +G +A + TYP D++R
Sbjct  249  EGDANPSALRKLLAGAISGAVAQTCTYPFDVLR  281



>ref|XP_003177849.1| solute carrier family 25 member 42 [Microsporum gypseum CBS 118893]
 gb|EFQ98897.1| solute carrier family 25 member 42 [Microsporum gypseum CBS 118893]
Length=349

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSIGKGLAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176



>ref|XP_007397036.1| hypothetical protein PHACADRAFT_258126 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM54338.1| hypothetical protein PHACADRAFT_258126 [Phanerochaete carnosa 
HHB-10118-sp]
Length=356

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNI--KYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            PLERLKI+ QVQ P N   +Y G  + L  +WK EGF+G  +GNG NC RI+P SAV+F 
Sbjct  55   PLERLKIIQQVQ-PQNADGQYTGVWRSLVRMWKEEGFKGFMRGNGINCLRIIPYSAVQFT  113

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +YEQ  K   W     T + + QL    RL +GA AGI ++ +TYP+D+VR
Sbjct  114  TYEQLKK---WF----TASGNRQLDTPTRLLSGALAGITSVCSTYPLDLVR  157


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +3

Query  366  PLERLKILLQV--QNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            P + L+  +QV   N   IKYNG +  L+ I +TEG RGL++G   N  ++ P+ A  FF
Sbjct  285  PFDVLRRKMQVTGMNALGIKYNGALDALQSIIRTEGIRGLYRGLWPNLLKVAPSIATSFF  344

Query  540  SYE  548
            +YE
Sbjct  345  TYE  347



>emb|CBQ71101.1| related to mitochondrial carrier protein [Sporisorium reilianum 
SRZ2]
Length=465

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 69/123 (56%), Gaps = 21/123 (17%)
 Frame = +3

Query  366  PLERLKILLQVQ--------------NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNC  503
            PLERLKI++QVQ               P N  YNG   GL  +W+ EGF G  +GNG NC
Sbjct  140  PLERLKIIMQVQPQSATRSTSSKGKLAPRNRAYNGVWTGLVKMWQEEGFAGFMRGNGINC  199

Query  504  ARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMD  683
             RI P SAV+F +YE       WL  + TG  D     L +L AGA AGI ++ +TYP+D
Sbjct  200  LRIAPYSAVQFTTYEMCKA---WLRDDATGEIDV----LRKLTAGAVAGIASVVSTYPLD  252

Query  684  MVR  692
            +VR
Sbjct  253  LVR  255


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 46/82 (56%), Gaps = 9/82 (11%)
 Frame = +3

Query  450  IWKTEG-FRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLTPLLR  626
            +++ EG  RGL++G       + P  A+ F+ YE A        R++   +  + +PL++
Sbjct  305  VYREEGGIRGLYRGCVPTSVGVAPYVALNFYFYEAA--------RKRISRDGVEPSPLMK  356

Query  627  LGAGACAGIIAMSATYPMDMVR  692
            L  GA AG I+ + TYP+D++R
Sbjct  357  LACGALAGSISQTLTYPLDVLR  378



>gb|EST05863.1| hypothetical protein PSEUBRA_SCAF4g05013 [Pseudozyma brasiliensis 
GHG001]
Length=443

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 85/146 (58%), Gaps = 15/146 (10%)
 Frame = +3

Query  270  DEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQVQ-----NPHNIKYNGTV  434
            D    TSHA L      VAGG AG  SRT V+PLERLKI++QVQ     N  N  YNG  
Sbjct  99   DHSHGTSHAFL--ITYFVAGGAAGATSRTVVSPLERLKIIMQVQPQSSANKRNRAYNGVW  156

Query  435  QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREQTGNEDAQLT  614
             GL  +W+ EGF G  +GNG NC RI P SAV+F +YE       WL  E       +L 
Sbjct  157  TGLVKMWQEEGFAGFMRGNGINCLRIAPYSAVQFTTYEMCKT---WLRPEH-----GELD  208

Query  615  PLLRLGAGACAGIIAMSATYPMDMVR  692
             + RL AGA AGI ++ +TYP+D+VR
Sbjct  209  VVRRLTAGAVAGIASVVSTYPLDLVR  234



>gb|KIO19166.1| hypothetical protein M407DRAFT_150116 [Tulasnella calospora MUT 
4182]
Length=388

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 9/111 (8%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK--YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            PLERLKI+ QVQ   +    YNG  + L  +W+ EGFRG  +GNG NC RIVP SAV+F 
Sbjct  51   PLERLKIIQQVQPKRSGAGAYNGVYRSLVRMWQEEGFRGFMRGNGANCIRIVPYSAVQFT  110

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +YEQ  K         T     +L  L RL AGA AGI +++ TYP+D+VR
Sbjct  111  AYEQLKKFF-------TNGGTRELDTLTRLTAGALAGITSVTTTYPLDLVR  154



>ref|XP_001903889.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP61665.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP28016.1| Putative carrier [Podospora anserina S mat+]
Length=286

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL QVQ+     Y  +V + L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  43   PLERLKILFQVQSAGRDAYKLSVGKALMKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFGS  102

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y        +  R    + D  LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  103  YN------FYKRRFFERHPDDSLTPLSRLTCGGIAGITSVTVTYPLDIVR  146



>gb|KIK67484.1| hypothetical protein GYMLUDRAFT_37615 [Gymnopus luxurians FD-317 
M1]
Length=337

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQ-NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ    N +Y G  + L  +WK EGF+G  +GNG NC RIVP SAV+F +
Sbjct  43   PLERLKIIQQVQPRDSNSQYRGVWRSLVRMWKEEGFKGFMRGNGINCLRIVPYSAVQFTT  102

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K   W  +  +   D   TP  RL +GA AGI ++  TYP+D+VR
Sbjct  103  YEQLKK---WFTKHGSKELD---TP-KRLASGALAGITSVCTTYPLDLVR  145



>gb|KFH46822.1| putative mitochondrial carrier-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=332

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 69/110 (63%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL+Q+Q+     Y  ++ Q L  +W+ EG++G  +GNGTNC RIVP SAV+F S
Sbjct  50   PLERLKILMQIQSAGRDAYKLSIGQALGKMWREEGWKGFMRGNGTNCIRIVPYSAVQFSS  109

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y        A+LTPL RL  G  AGI ++  TYP+D+VR
Sbjct  110  YNFYKRNIFEPY------PGAELTPLTRLVCGGAAGITSVFFTYPLDIVR  153



>gb|KJF61631.1| mitochondrial carrier protein, variant [Coccidioides immitis 
RS]
Length=273

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 68/110 (62%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQN     Y  ++ + L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  70   PLERLKILLQVQNAGRNDYKLSISKALIKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFGS  129

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K          G E   +TPL RL  G  AGI ++S TYP+D+VR
Sbjct  130  YSIYKK----FAEPYPGGE---MTPLSRLVCGGLAGITSVSVTYPLDIVR  172



>emb|CEI95370.1| hypothetical protein RMCBS344292_09559 [Rhizopus microsporus]
Length=319

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (60%), Gaps = 11/159 (7%)
 Frame = +3

Query  216  ELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKILLQ  395
            ++ V   +  +E + L R +   TS  +    K L++G +AG +SRT V+P+ER+KIL Q
Sbjct  2    DIVVTHTITSSEPSVLDRYKAMLTSDTM----KHLISGAIAGALSRTVVSPMERMKILFQ  57

Query  396  VQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWL  575
            VQ P    Y G    L  IWK EGFRG  +GNGTN  R+VP SA +F +YEQ  K IL  
Sbjct  58   VQGPETAAYTGIWSTLSKIWKEEGFRGFMRGNGTNVIRMVPYSASQFAAYEQL-KSILM-  115

Query  576  YREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
               + G  +   TP  RL AGA AG ++++ TYP+D+VR
Sbjct  116  ---EPGKTELD-TP-RRLVAGAFAGTVSVACTYPLDLVR  149



>ref|XP_007339346.1| mitochondrial carrier [Auricularia delicata TFB-10046 SS5]
 gb|EJD52615.1| mitochondrial carrier [Auricularia delicata TFB-10046 SS5]
Length=363

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIK-YNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ P + K Y G  + L  IW+ EGF+G  +GNG NC RI+P SAV+F +
Sbjct  47   PLERLKIIQQVQPPGSDKQYKGVWRSLVRIWREEGFKGFMRGNGINCVRIIPYSAVQFTT  106

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K   +  R +    D   TP  RL +GA AGI +++ TYP+D+VR
Sbjct  107  YEQLKK---FFQRHRQSELD---TP-TRLLSGALAGITSVTTTYPLDLVR  149



>dbj|GAA99260.1| hypothetical protein E5Q_05954 [Mixia osmundae IAM 14324]
 gb|KEI39890.1| hypothetical protein L969DRAFT_384968 [Mixia osmundae IAM 14324]
Length=334

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLK++ Q Q+   + YNG +  L+ IW+ EG RG+F+GN  N  RI P SA +F +Y
Sbjct  63   PLERLKLIYQCQSQSEVAYNGLIASLRKIWREEGMRGMFRGNYANVLRIAPYSATQFLAY  122

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQA + +         NE  +L+   +L AGA AG+ ++  TYP+D++R
Sbjct  123  EQAKRVL--------SNEQHELSTPRKLLAGAIAGVASVVTTYPLDLIR  163



>ref|XP_007843299.1| mitochondrial carrier [Moniliophthora roreri MCA 2997]
 gb|ESK97415.1| mitochondrial carrier [Moniliophthora roreri MCA 2997]
Length=361

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 8/109 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKI+ QVQ   + +Y G    L  +WK EGF+G  +GNG NC RIVP SAV+F +Y
Sbjct  40   PLERLKIIQQVQPKGSTQYKGVWNSLVRMWKEEGFKGYMRGNGINCLRIVPYSAVQFTTY  99

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            EQ  K   W  R   G+ +   TP  RL +GA AGI ++ +TYP+D+VR
Sbjct  100  EQLKK---WFAR---GSRELD-TP-KRLASGALAGITSVCSTYPLDLVR  140



>gb|KID61571.1| Mitochondrial carrier domain protein, partial [Metarhizium anisopliae 
ARSEF 549]
Length=353

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+     Y  +V Q L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  71   PLERLKILLQVQSVGRDAYKLSVGQALAKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  130

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y  Q      +L+P  RL  G  AGI ++  TYP+D+VR
Sbjct  131  YNFYKRNIFESYPGQ------ELSPFTRLICGGIAGITSVFFTYPLDIVR  174



>ref|XP_007600382.1| hypothetical protein CFIO01_00423 [Colletotrichum fioriniae PJ7]
 gb|EXF75938.1| hypothetical protein CFIO01_00423 [Colletotrichum fioriniae PJ7]
Length=342

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL QVQ+     Y  +V QGL  +W+ EG+RG   GNGTNC RIVP SAV+F S
Sbjct  59   PLERLKILFQVQSVGRDAYKLSVGQGLAKMWREEGWRGFMAGNGTNCVRIVPYSAVQFGS  118

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    +       E T   D  L+PL RL  G  AGI ++  TYP+D+VR
Sbjct  119  YNFYKRNFF----ESTPGAD--LSPLARLTCGGIAGITSVFCTYPLDIVR  162



>gb|EQK99301.1| Mitochondrial carrier domain protein [Ophiocordyceps sinensis 
CO18]
Length=347

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL+QVQ+     Y  +V Q L  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  65   PLERLKILMQVQSAGREAYKLSVGQALAKMWREEGWRGFMRGNGTNCIRIVPYSAVQFSS  124

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y   +  +   Y        A+LTP  RL  G  AGI ++  TYP+D+VR
Sbjct  125  YNFYNTNVFAPY------PGAELTPFSRLICGGAAGITSVIVTYPLDIVR  168



>gb|KIY44486.1| mitochondrial carrier [Fistulina hepatica ATCC 64428]
Length=379

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQ-NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ    + +Y G  + L  +WK EG RG  +GNG NC RIVP SAV+F +
Sbjct  69   PLERLKIIQQVQPRTSDQQYKGVWRSLVRMWKEEGIRGYMRGNGINCLRIVPYSAVQFTT  128

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  +   WL R  T   D   TP  RL +GA AG++++ +TYP+D+VR
Sbjct  129  YEQLKQ---WLTRNGTRELD---TP-KRLASGAMAGVVSVCSTYPLDIVR  171



>gb|KIL62548.1| hypothetical protein M378DRAFT_12756 [Amanita muscaria Koide 
BX008]
Length=372

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQ-NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ    + +Y G  + L  +W+ EGF+G  +GNG NC RIVP SAV+F +
Sbjct  76   PLERLKIIQQVQPRGSDSQYKGVWRSLARMWQEEGFKGFMRGNGINCLRIVPYSAVQFTT  135

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K   WL    T   D   TP  RL AGA AGI ++ +TYP+D+VR
Sbjct  136  YEQLKK---WLTAHGTRELD---TP-KRLTAGALAGITSVCSTYPLDLVR  178



>gb|ERZ99393.1| hypothetical protein GLOINDRAFT_329195 [Rhizophagus irregularis 
DAOM 181602]
Length=350

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KIL QVQ P    Y G +  +  IW+ EG+ G+ +GNGTN  RIVP SA +F SY
Sbjct  80   PLERMKILFQVQGPEPASYRGIIPTIAKIWREEGWVGMLRGNGTNVIRIVPYSATQFASY  139

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E+  + +L     + G   ++L    RL AGA AGI ++S TYP+D+VR
Sbjct  140  EKYKRLLL-----EEGK--SELDAPRRLTAGALAGITSVSCTYPLDIVR  181



>gb|KHN96172.1| Mitochondrial carrier domain protein [Metarhizium album ARSEF 
1941]
Length=353

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+     Y  +V Q L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  71   PLERLKILLQVQSAGRDAYKLSVGQALGKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  130

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y  Q      +L P  RL  G  AGI ++  TYP+D+VR
Sbjct  131  YNFYKRNIFESYPGQ------ELAPFTRLICGGIAGITSVFFTYPLDIVR  174



>gb|EXX70128.1| hypothetical protein RirG_090420 [Rhizophagus irregularis DAOM 
197198w]
Length=359

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KIL QVQ P    Y G +  +  IW+ EG+ G+ +GNGTN  RIVP SA +F SY
Sbjct  89   PLERMKILFQVQGPEPASYRGIIPTIAKIWREEGWVGMLRGNGTNVIRIVPYSATQFASY  148

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E+  + +L    E+  +E   L    RL AGA AGI ++S TYP+D+VR
Sbjct  149  EKYKRLLL----EEGKSE---LDAPRRLTAGALAGITSVSCTYPLDIVR  190



>gb|KFG77864.1| putative mitochondrial carrier protein [Metarhizium anisopliae]
Length=372

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+     Y  +V Q L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  71   PLERLKILLQVQSVGRDAYKLSVGQALAKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  130

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y  Q      +L+P  RL  G  AGI ++  TYP+D+VR
Sbjct  131  YNFYKRNIFESYPGQ------ELSPFTRLICGGIAGITSVFFTYPLDIVR  174



>ref|XP_002851261.1| Lpz11p [Arthroderma otae CBS 113480]
 gb|EEQ28477.1| Lpz11p [Arthroderma otae CBS 113480]
Length=351

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+    +Y  ++ +GL  +W+ EG++G  +GNGTNC RIVP SAV+F S
Sbjct  74   PLERLKILLQVQSVGREEYKLSIGKGLAKMWREEGWKGFMRGNGTNCIRIVPYSAVQFGS  133

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K     +    G E   LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  134  YNLYKKA----FEPTPGGE---LTPLRRLTCGGLAGITSVTFTYPLDIVR  176



>tpe|CBF70821.1| TPA: mitochondrial carrier protein, putative (AFU_orthologue; 
AFUA_2G07400) [Aspergillus nidulans FGSC A4]
Length=352

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQ+Q+    +Y  ++ Q LK I + EG+RG  +GNGTNC RI+P SAV+F S
Sbjct  75   PLERLKILLQIQSVGREEYKLSIWQALKKIGREEGWRGFLRGNGTNCIRIIPYSAVQFGS  134

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y        +  R    + DA LTP+ RL  G  AGI ++  TYP+D+VR
Sbjct  135  YN-------FYKRFAEPSPDADLTPIRRLICGGAAGITSVIVTYPLDLVR  177



>ref|XP_003321187.2| hypothetical protein PGTG_02229 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP76768.2| hypothetical protein PGTG_02229 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=354

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 68/109 (62%), Gaps = 6/109 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKI+ Q Q P +  Y G    L  I + EG+RG FKGNG N  RI P SA++F SY
Sbjct  74   PLERLKIIFQCQGPGSANYQGMWPSLVKIGREEGWRGYFKGNGINVIRIAPYSAIQFSSY  133

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E A K    L R  +  E   LT  LRLGAGA AGI ++ +TYP+D+VR
Sbjct  134  EIAKK---LLSRFSSTGE---LTTPLRLGAGAIAGICSVVSTYPLDLVR  176



>ref|XP_007807139.1| mitochondrial carrier protein, putative [Metarhizium acridum 
CQMa 102]
 gb|EFY93016.1| mitochondrial carrier protein, putative [Metarhizium acridum 
CQMa 102]
Length=353

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+     Y  +V Q L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  71   PLERLKILLQVQSVGRDAYKLSVGQALAKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  130

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y  Q      +L P  RL  G  AGI ++  TYP+D+VR
Sbjct  131  YNFYKRNIFESYPGQ------ELAPFTRLVCGGIAGITSVFFTYPLDIVR  174



>gb|KIM78890.1| hypothetical protein PILCRDRAFT_824006 [Piloderma croceum F 1598]
Length=369

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQ-NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ    +++Y G  + L  +W+ EGF+G  +GN  NC RIVP SAV+F +
Sbjct  60   PLERLKIIQQVQPQGSDLQYKGVWRSLVRMWREEGFKGYMRGNAINCLRIVPYSAVQFTT  119

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K   W  R  T   D   TP  RL +GA AGI ++ +TYP+D+VR
Sbjct  120  YEQLKK---WFTRHGTKELD---TP-KRLASGALAGITSVCSTYPLDLVR  162



>ref|XP_001244797.1| hypothetical protein CIMG_04238 [Coccidioides immitis RS]
 gb|KJF61630.1| mitochondrial carrier protein [Coccidioides immitis RS]
Length=348

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 68/110 (62%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQN     Y  ++ + L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  70   PLERLKILLQVQNAGRNDYKLSISKALIKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFGS  129

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K          G E   +TPL RL  G  AGI ++S TYP+D+VR
Sbjct  130  YSIYKK----FAEPYPGGE---MTPLSRLVCGGLAGITSVSVTYPLDIVR  172



>gb|EJT46041.1| hypothetical protein A1Q1_05423 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKD04328.1| hypothetical protein A1Q2_01359 [Trichosporon asahii var. asahii 
CBS 8904]
Length=363

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 12/114 (11%)
 Frame = +3

Query  366  PLERLKILLQVQNP----HNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVK  533
            PLERLKI+LQVQ+         Y+G  + L  +WK EGF+G  KGNG N  RI+P SA++
Sbjct  69   PLERLKIILQVQSSKPGGSGEAYDGVWKSLVRMWKDEGFKGFMKGNGINVIRILPYSALQ  128

Query  534  FFSYEQASKGIL-WLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            F SY     GI   L R  +G E  +L+  LRL AGA AGI+A+ ATYP+D+VR
Sbjct  129  FSSY-----GIFKTLLRNWSGQE--ELSSFLRLTAGAGAGIVAVVATYPLDLVR  175



>ref|XP_663405.1| hypothetical protein AN5801.2 [Aspergillus nidulans FGSC A4]
 gb|EAA58310.1| hypothetical protein AN5801.2 [Aspergillus nidulans FGSC A4]
Length=367

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQ+Q+    +Y  ++ Q LK I + EG+RG  +GNGTNC RI+P SAV+F S
Sbjct  75   PLERLKILLQIQSVGREEYKLSIWQALKKIGREEGWRGFLRGNGTNCIRIIPYSAVQFGS  134

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y        +  R    + DA LTP+ RL  G  AGI ++  TYP+D+VR
Sbjct  135  YN-------FYKRFAEPSPDADLTPIRRLICGGAAGITSVIVTYPLDLVR  177



>gb|KJA27564.1| hypothetical protein HYPSUDRAFT_34657 [Hypholoma sublateritium 
FD-334 SS-4]
Length=375

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQ-NPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ    N +Y G  + L  +WK EGF+G  +GNG NC RIVP SAV+F +
Sbjct  58   PLERLKIIQQVQPRGSNSQYKGVYRSLLRMWKEEGFQGFMRGNGINCLRIVPYSAVQFTT  117

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K   W  +  +   D   TP  RL +GA AGI ++ +TYP+D+VR
Sbjct  118  YEQLKK---WFTKHGSKELD---TP-KRLVSGALAGITSVCSTYPLDLVR  160



>emb|CEG72434.1| hypothetical protein RMATCC62417_07994 [Rhizopus microsporus]
Length=407

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 96/162 (59%), Gaps = 11/162 (7%)
 Frame = +3

Query  207  KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKI  386
            K  ++ V   +  +E + L R +   TS  +    K L++G +AG +SRT V+P+ER+KI
Sbjct  87   KIMDIVVTHTITSSEPSVLDRYKAMLTSDTM----KHLISGAIAGALSRTVVSPMERMKI  142

Query  387  LLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGI  566
            L QVQ P    Y G    L  IWK EGFRG  +GNGTN  R+VP SA +F +YEQ  K I
Sbjct  143  LFQVQGPETAAYTGIWSTLSKIWKEEGFRGFMRGNGTNVIRMVPYSASQFAAYEQL-KSI  201

Query  567  LWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            L     + G  +   TP  RL AGA AG ++++ TYP+D+VR
Sbjct  202  LM----EPGKTELD-TP-RRLVAGAFAGTVSVACTYPLDLVR  237



>ref|XP_007824422.2| mitochondrial carrier [Metarhizium robertsii ARSEF 23]
 gb|EFY96321.2| mitochondrial carrier [Metarhizium robertsii ARSEF 23]
Length=353

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQ+Q+     Y  +V Q L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  71   PLERLKILLQIQSVGRDAYKLSVGQALAKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  130

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y  Q      +L+P  RL  G  AGI ++  TYP+D+VR
Sbjct  131  YNFYKRNIFESYPGQ------ELSPFTRLICGGIAGITSVFFTYPLDIVR  174



>ref|XP_009494162.1| hypothetical protein H696_01987 [Fonticula alba]
 gb|KCV71039.1| hypothetical protein H696_01987 [Fonticula alba]
Length=336

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 68/109 (62%), Gaps = 6/109 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLER+KIL QVQ+     Y G V  L+ I   EG+RG FKGNGTN  RI P SA++F S+
Sbjct  62   PLERMKILFQVQDGAADAYRGIVPTLRKIATEEGWRGFFKGNGTNVIRIAPYSAIQFASF  121

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
             Q  K  L +    TG E   L P+  L AGACAGI + + TYP+D++R
Sbjct  122  SQYKKIALSI----TGTE--YLAPVPSLIAGACAGITSSTMTYPLDIIR  164



>emb|CEI95369.1| hypothetical protein RMCBS344292_09558 [Rhizopus microsporus]
Length=407

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 96/162 (59%), Gaps = 11/162 (7%)
 Frame = +3

Query  207  KTGELAVEKIVNLAEEAKLARDEIKPTSHALLSICKSLvaggvaggvsrtavaPLERLKI  386
            K  ++ V   +  +E + L R +   TS  +    K L++G +AG +SRT V+P+ER+KI
Sbjct  87   KIMDIVVTHTITSSEPSVLDRYKAMLTSDTM----KHLISGAIAGALSRTVVSPMERMKI  142

Query  387  LLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGI  566
            L QVQ P    Y G    L  IWK EGFRG  +GNGTN  R+VP SA +F +YEQ  K I
Sbjct  143  LFQVQGPETAAYTGIWSTLSKIWKEEGFRGFMRGNGTNVIRMVPYSASQFAAYEQL-KSI  201

Query  567  LWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            L     + G  +   TP  RL AGA AG ++++ TYP+D+VR
Sbjct  202  LM----EPGKTELD-TP-RRLVAGAFAGTVSVACTYPLDLVR  237



>emb|CCA67191.1| related to mitochondrial carrier protein [Piriformospora indica 
DSM 11827]
Length=654

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNI--KYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFF  539
            PLERLKI+ QVQ+      +Y G  + L  +WK EGF+G  +GNG NC RIVP SAV+F 
Sbjct  49   PLERLKIIQQVQSASGNAGRYQGVWKSLVRMWKEEGFKGYMRGNGVNCLRIVPYSAVQFT  108

Query  540  SYEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            +YEQ  K +         +   +L  L RLG GA AGI++++ TYP+D+VR
Sbjct  109  TYEQMKKIVT--------HNGFELNTLTRLGCGAIAGIVSVTVTYPLDLVR  151



>gb|KIM45458.1| hypothetical protein M413DRAFT_442127 [Hebeloma cylindrosporum 
h7]
Length=372

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHN-IKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI+ QVQ   N  +Y G  + L  +W  EGF+G  +GNG NC RIVP SAV+F +
Sbjct  54   PLERLKIIQQVQPRGNDSQYKGVWRSLARMWTEEGFKGFMRGNGINCLRIVPYSAVQFTT  113

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YEQ  K   W  R  +   D   TP  RL +GA AGI ++ +TYP+D+VR
Sbjct  114  YEQLKK---WFTRHGSKELD---TP-KRLASGALAGITSVCSTYPLDLVR  156



>emb|CDM26906.1| Mitochondrial carrier protein [Penicillium roqueforti FM164]
Length=354

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 72/110 (65%), Gaps = 9/110 (8%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQ+Q+    +Y  ++ + L  + + EG+RG  +GNGTNC RI+P SAV+F S
Sbjct  77   PLERLKILLQIQSVGRTEYRLSIWKALVKMGREEGWRGFMRGNGTNCIRIIPYSAVQFGS  136

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y          Y++   + D ++TP+LRL  G  AGI +++ TYP+D+VR
Sbjct  137  YN--------FYKQFVESPDGEMTPMLRLFCGGLAGITSVTITYPLDIVR  178



>gb|EXU98601.1| mitochondrial carrier protein [Metarhizium robertsii]
Length=372

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQ+Q+     Y  +V Q L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  71   PLERLKILLQIQSVGRDAYKLSVGQALAKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  130

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y  Q      +L+P  RL  G  AGI ++  TYP+D+VR
Sbjct  131  YNFYKRNIFESYPGQ------ELSPFTRLICGGIAGITSVFFTYPLDIVR  174



>gb|KID97211.1| Mitochondrial carrier domain protein, partial [Metarhizium majus 
ARSEF 297]
Length=353

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+     Y  +V Q L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  71   PLERLKILLQVQSVGRDAYKLSVGQALAKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  130

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y  Q      +L P  RL  G  AGI ++  TYP+D+VR
Sbjct  131  YNFYKRNIFESYPGQ------ELAPFTRLICGGIAGITSVFFTYPLDIVR  174



>gb|KID83402.1| Mitochondrial carrier domain protein [Metarhizium guizhouense 
ARSEF 977]
Length=353

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQ+     Y  +V Q L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  71   PLERLKILLQVQSVGRDAYKLSVGQALAKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  130

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I   Y  Q      +L P  RL  G  AGI ++  TYP+D+VR
Sbjct  131  YNFYKRNIFESYPGQ------ELAPFTRLICGGIAGITSVFFTYPLDIVR  174



>gb|KFA70740.1| hypothetical protein S40288_08885 [Stachybotrys chartarum IBT 
40288]
Length=345

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 69/110 (63%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL+QVQ+     Y  +V Q L  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  63   PLERLKILMQVQSAGREAYKMSVGQALGKMWREEGWRGFMRGNGTNCIRIVPYSAVQFSS  122

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I         + +A L+PL RL  G  AG+ ++  TYP+D+VR
Sbjct  123  YNFYKRSIF------EPHPNADLSPLSRLVCGGLAGVTSVFFTYPLDIVR  166



>gb|KEY66716.1| hypothetical protein S7711_06764 [Stachybotrys chartarum IBT 
7711]
 gb|KFA47184.1| hypothetical protein S40293_06695 [Stachybotrys chartarum IBT 
40293]
Length=332

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 69/110 (63%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL+QVQ+     Y  +V Q L  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  50   PLERLKILMQVQSAGREAYKMSVGQALGKMWREEGWRGFMRGNGTNCIRIVPYSAVQFSS  109

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I         + +A L+PL RL  G  AG+ ++  TYP+D+VR
Sbjct  110  YNFYKRSIF------EPHPNADLSPLSRLVCGGLAGVTSVFFTYPLDIVR  153



>gb|EPS29110.1| hypothetical protein PDE_04059 [Penicillium oxalicum 114-2]
Length=353

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 71/110 (65%), Gaps = 9/110 (8%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQ+Q+    +Y  ++ +GLK + + EG+RG  +GNGTNC RI+P SAV+F S
Sbjct  76   PLERLKILLQIQSVGREEYKLSIWEGLKKMKREEGWRGFMRGNGTNCIRIIPYSAVQFGS  135

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y          Y+      D ++TP+ RL  G  AGI +++ TYP+D+VR
Sbjct  136  YN--------FYKRFAETPDGEMTPVRRLICGGFAGITSVTVTYPLDIVR  177



>gb|EMS24452.1| mitochondrial carrier protein [Rhodosporidium toruloides NP11]
 emb|CDR36097.1| RHTO0S01e14202g1_1 [Rhodosporidium toruloides]
Length=372

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 67/109 (61%), Gaps = 9/109 (8%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSY  545
            PLERLKILLQVQ   + +Y G   GL  +W+ EGF+G  +GNG N  RI P SAV+F SY
Sbjct  83   PLERLKILLQVQG-ASAQYKGVWHGLTKMWREEGFKGYMRGNGINVLRIAPYSAVQFSSY  141

Query  546  EQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            E        L++     ED  +    RL AG+ AGI ++ +TYP+D+VR
Sbjct  142  E--------LFKSALRGEDGSMDTPRRLTAGSLAGICSVVSTYPLDLVR  182



>gb|KFA60747.1| hypothetical protein S40285_04748 [Stachybotrys chlorohalonata 
IBT 40285]
Length=359

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 69/110 (63%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL+QVQ+     Y  +V Q L  +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  77   PLERLKILMQVQSAGREAYKMSVGQALGKMWREEGWRGFMRGNGTNCIRIVPYSAVQFSS  136

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I         + +A L+PL RL  G  AG+ ++  TYP+D+VR
Sbjct  137  YNFYKRSIF------EPHPNADLSPLSRLVCGGLAGVTSVFFTYPLDIVR  180



>ref|XP_008714823.1| hypothetical protein HMPREF1541_02245 [Cyphellophora europaea 
CBS 101466]
 gb|ETN43087.1| hypothetical protein HMPREF1541_02245 [Cyphellophora europaea 
CBS 101466]
Length=353

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL QVQ     +Y   + + LK +W  EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  73   PLERLKILYQVQGAGRNEYKLPIHKALKKMWVDEGWRGFMRGNGTNCIRIVPYSAVQFGS  132

Query  543  YEQASKGILWLY-REQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y         +Y R    +  A L PL+RL  G CAGI +++ TYP+D+VR
Sbjct  133  YN--------IYKRFAESSPGADLDPLMRLICGGCAGITSVTFTYPLDIVR  175



>ref|XP_007804599.1| hypothetical protein EPUS_07572 [Endocarpon pusillum Z07020]
 gb|ERF69746.1| hypothetical protein EPUS_07572 [Endocarpon pusillum Z07020]
Length=517

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL QVQ+    +Y+ ++ + LK +W  EG+RG  +GNGTNC RI+P SAV+F S
Sbjct  50   PLERLKILYQVQSAGRNEYHMSIYKALKKMWIEEGWRGFMRGNGTNCVRIIPYSAVQFGS  109

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y      I   + E +   D  L+PL RL  G CAGI +++ TYP+D+VR
Sbjct  110  YN-----IYKRFAEPSPGAD--LSPLRRLVCGGCAGITSVTFTYPLDIVR  152



>ref|XP_011318767.1| hypothetical protein FGSG_09865 [Fusarium graminearum PH-1]
 gb|ESU16505.1| hypothetical protein FGSG_09865 [Fusarium graminearum PH-1]
 gb|EYB22198.1| hypothetical protein FG05_09865 [Fusarium graminearum]
 emb|CEF75160.1| unnamed protein product [Fusarium graminearum]
Length=314

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL+QVQ+     Y  +V + L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  32   PLERLKILMQVQSVGRDAYKLSVGKALVKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFSS  91

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    + I         +  A L+PL RL  G  AGI ++  TYP+D+VR
Sbjct  92   YNFYKRSIF------ESHPGADLSPLTRLVCGGLAGITSVFLTYPLDIVR  135



>gb|EUC54737.1| carrier protein, partial [Rhizoctonia solani AG-3 Rhs1AP]
Length=192

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNP-HNIKYNGTVQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKI++QVQ+   N  Y G    L  +W+ EG+RG+  GNG NC RIVP SAV+F +
Sbjct  36   PLERLKIIMQVQSTGPNSAYVGVWPSLLKMWREEGWRGMMAGNGINCLRIVPYSAVQFTT  95

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            YE+  K    L+   T N    L    RL AGA AGI +++ TYP+D+VR
Sbjct  96   YEKLKK----LF---TANGTLPLDTPTRLLAGALAGITSVTTTYPLDLVR  138



>gb|ENH83702.1| mitochondrial carrier [Colletotrichum orbiculare MAFF 240422]
Length=303

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL QVQ+     Y  +V QGL  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  20   PLERLKILFQVQSVGRDAYKLSVGQGLAKMWKEEGWRGFMRGNGTNCVRIVPYSAVQFGS  79

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    +     + +  G   A L+ L RL  G  AGI ++  TYP+D+VR
Sbjct  80   YNFYKRN---FFEKHPG---ADLSSLARLTCGGIAGITSVFCTYPLDIVR  123



>ref|XP_003068173.1| Mitochondrial carrier protein [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER26028.1| Mitochondrial carrier protein [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW19844.1| mitochondrial carrier protein [Coccidioides posadasii str. Silveira]
Length=348

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKILLQVQN     Y  ++ + L  +WK EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  70   PLERLKILLQVQNAGRNDYKLSISKALIKMWKEEGWRGFMRGNGTNCIRIVPYSAVQFGS  129

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    K          G E   +TP  RL  G  AGI ++S TYP+D+VR
Sbjct  130  YSIYKK----FAEPYPGGE---MTPFSRLVCGGLAGITSVSVTYPLDIVR  172



>gb|ELQ33051.1| solute carrier family 25 member 42 [Magnaporthe oryzae Y34]
 gb|ELQ61886.1| solute carrier family 25 member 42 [Magnaporthe oryzae P131]
Length=361

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 7/110 (6%)
 Frame = +3

Query  366  PLERLKILLQVQNPHNIKYNGTV-QGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFS  542
            PLERLKIL Q+Q+    +Y  +V + LK +W+ EG+RG  +GNGTNC RIVP SAV+F S
Sbjct  81   PLERLKILFQIQSAGREEYKLSVGKALKKMWQEEGWRGFMRGNGTNCIRIVPYSAVQFGS  140

Query  543  YEQASKGILWLYREQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVR  692
            Y    +    L+    G   A LTPL RL  G  AGI +++ TYP+D+VR
Sbjct  141  YGFYKRT---LFESSPG---ADLTPLERLICGGIAGITSVTFTYPLDIVR  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520